data_9KD0 # _entry.id 9KD0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9KD0 pdb_00009kd0 10.2210/pdb9kd0/pdb WWPDB D_1300052978 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-29 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9KD0 _pdbx_database_status.recvd_initial_deposition_date 2024-11-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email hashimoto.wataru.8c@kyoto-u.ac.jp _pdbx_contact_author.name_first Wataru _pdbx_contact_author.name_last Hashimoto _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0185-2371 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kouda, Y.' 1 0000-0002-5346-1076 'Takase, R.' 2 0000-0002-7423-9407 'Mikami, B.' 3 0000-0003-0638-8619 'Hashimoto, W.' 4 0000-0003-0185-2371 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Bacteroides ovatus KduI2 responsible for metabolism of glycosaminoglycan' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kouda, Y.' 1 0000-0002-5346-1076 primary 'Takase, R.' 2 0000-0002-7423-9407 primary 'Mikami, B.' 3 0000-0003-0638-8619 primary 'Hashimoto, W.' 4 0000-0003-0185-2371 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase' _entity.formula_weight 33728.453 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.3.1.17 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQVNYKMQVACSPQDVKTYDTNRLRSSFLMEKVMVPNEINVTYSMYDRLIFGGAVPATKELVLETIDPLKSKFFLERREL GVINIGGEGIVTVDGKEYTLKFKDALYVGRGKQKVTFKSKDSSNPAKFYINSATAHKEYKTQLITIDGRKGSLKANSFAA GKLEESNDRVINQLIVNNVLEEGPCQLQMGLTELKPGSVWNTMPAHTHSRRVEAYFYFNVPAGNAICHFMGEPQEERVVW MQNEQAIMSPEWSIHAAAGTSNYMFIWGMAGENLDYGDMDKIKYTEMRLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MQVNYKMQVACSPQDVKTYDTNRLRSSFLMEKVMVPNEINVTYSMYDRLIFGGAVPATKELVLETIDPLKSKFFLERREL GVINIGGEGIVTVDGKEYTLKFKDALYVGRGKQKVTFKSKDSSNPAKFYINSATAHKEYKTQLITIDGRKGSLKANSFAA GKLEESNDRVINQLIVNNVLEEGPCQLQMGLTELKPGSVWNTMPAHTHSRRVEAYFYFNVPAGNAICHFMGEPQEERVVW MQNEQAIMSPEWSIHAAAGTSNYMFIWGMAGENLDYGDMDKIKYTEMRLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 VAL n 1 4 ASN n 1 5 TYR n 1 6 LYS n 1 7 MET n 1 8 GLN n 1 9 VAL n 1 10 ALA n 1 11 CYS n 1 12 SER n 1 13 PRO n 1 14 GLN n 1 15 ASP n 1 16 VAL n 1 17 LYS n 1 18 THR n 1 19 TYR n 1 20 ASP n 1 21 THR n 1 22 ASN n 1 23 ARG n 1 24 LEU n 1 25 ARG n 1 26 SER n 1 27 SER n 1 28 PHE n 1 29 LEU n 1 30 MET n 1 31 GLU n 1 32 LYS n 1 33 VAL n 1 34 MET n 1 35 VAL n 1 36 PRO n 1 37 ASN n 1 38 GLU n 1 39 ILE n 1 40 ASN n 1 41 VAL n 1 42 THR n 1 43 TYR n 1 44 SER n 1 45 MET n 1 46 TYR n 1 47 ASP n 1 48 ARG n 1 49 LEU n 1 50 ILE n 1 51 PHE n 1 52 GLY n 1 53 GLY n 1 54 ALA n 1 55 VAL n 1 56 PRO n 1 57 ALA n 1 58 THR n 1 59 LYS n 1 60 GLU n 1 61 LEU n 1 62 VAL n 1 63 LEU n 1 64 GLU n 1 65 THR n 1 66 ILE n 1 67 ASP n 1 68 PRO n 1 69 LEU n 1 70 LYS n 1 71 SER n 1 72 LYS n 1 73 PHE n 1 74 PHE n 1 75 LEU n 1 76 GLU n 1 77 ARG n 1 78 ARG n 1 79 GLU n 1 80 LEU n 1 81 GLY n 1 82 VAL n 1 83 ILE n 1 84 ASN n 1 85 ILE n 1 86 GLY n 1 87 GLY n 1 88 GLU n 1 89 GLY n 1 90 ILE n 1 91 VAL n 1 92 THR n 1 93 VAL n 1 94 ASP n 1 95 GLY n 1 96 LYS n 1 97 GLU n 1 98 TYR n 1 99 THR n 1 100 LEU n 1 101 LYS n 1 102 PHE n 1 103 LYS n 1 104 ASP n 1 105 ALA n 1 106 LEU n 1 107 TYR n 1 108 VAL n 1 109 GLY n 1 110 ARG n 1 111 GLY n 1 112 LYS n 1 113 GLN n 1 114 LYS n 1 115 VAL n 1 116 THR n 1 117 PHE n 1 118 LYS n 1 119 SER n 1 120 LYS n 1 121 ASP n 1 122 SER n 1 123 SER n 1 124 ASN n 1 125 PRO n 1 126 ALA n 1 127 LYS n 1 128 PHE n 1 129 TYR n 1 130 ILE n 1 131 ASN n 1 132 SER n 1 133 ALA n 1 134 THR n 1 135 ALA n 1 136 HIS n 1 137 LYS n 1 138 GLU n 1 139 TYR n 1 140 LYS n 1 141 THR n 1 142 GLN n 1 143 LEU n 1 144 ILE n 1 145 THR n 1 146 ILE n 1 147 ASP n 1 148 GLY n 1 149 ARG n 1 150 LYS n 1 151 GLY n 1 152 SER n 1 153 LEU n 1 154 LYS n 1 155 ALA n 1 156 ASN n 1 157 SER n 1 158 PHE n 1 159 ALA n 1 160 ALA n 1 161 GLY n 1 162 LYS n 1 163 LEU n 1 164 GLU n 1 165 GLU n 1 166 SER n 1 167 ASN n 1 168 ASP n 1 169 ARG n 1 170 VAL n 1 171 ILE n 1 172 ASN n 1 173 GLN n 1 174 LEU n 1 175 ILE n 1 176 VAL n 1 177 ASN n 1 178 ASN n 1 179 VAL n 1 180 LEU n 1 181 GLU n 1 182 GLU n 1 183 GLY n 1 184 PRO n 1 185 CYS n 1 186 GLN n 1 187 LEU n 1 188 GLN n 1 189 MET n 1 190 GLY n 1 191 LEU n 1 192 THR n 1 193 GLU n 1 194 LEU n 1 195 LYS n 1 196 PRO n 1 197 GLY n 1 198 SER n 1 199 VAL n 1 200 TRP n 1 201 ASN n 1 202 THR n 1 203 MET n 1 204 PRO n 1 205 ALA n 1 206 HIS n 1 207 THR n 1 208 HIS n 1 209 SER n 1 210 ARG n 1 211 ARG n 1 212 VAL n 1 213 GLU n 1 214 ALA n 1 215 TYR n 1 216 PHE n 1 217 TYR n 1 218 PHE n 1 219 ASN n 1 220 VAL n 1 221 PRO n 1 222 ALA n 1 223 GLY n 1 224 ASN n 1 225 ALA n 1 226 ILE n 1 227 CYS n 1 228 HIS n 1 229 PHE n 1 230 MET n 1 231 GLY n 1 232 GLU n 1 233 PRO n 1 234 GLN n 1 235 GLU n 1 236 GLU n 1 237 ARG n 1 238 VAL n 1 239 VAL n 1 240 TRP n 1 241 MET n 1 242 GLN n 1 243 ASN n 1 244 GLU n 1 245 GLN n 1 246 ALA n 1 247 ILE n 1 248 MET n 1 249 SER n 1 250 PRO n 1 251 GLU n 1 252 TRP n 1 253 SER n 1 254 ILE n 1 255 HIS n 1 256 ALA n 1 257 ALA n 1 258 ALA n 1 259 GLY n 1 260 THR n 1 261 SER n 1 262 ASN n 1 263 TYR n 1 264 MET n 1 265 PHE n 1 266 ILE n 1 267 TRP n 1 268 GLY n 1 269 MET n 1 270 ALA n 1 271 GLY n 1 272 GLU n 1 273 ASN n 1 274 LEU n 1 275 ASP n 1 276 TYR n 1 277 GLY n 1 278 ASP n 1 279 MET n 1 280 ASP n 1 281 LYS n 1 282 ILE n 1 283 LYS n 1 284 TYR n 1 285 THR n 1 286 GLU n 1 287 MET n 1 288 ARG n 1 289 LEU n 1 290 GLU n 1 291 HIS n 1 292 HIS n 1 293 HIS n 1 294 HIS n 1 295 HIS n 1 296 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 296 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BACOVA_04897 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides ovatus ATCC 8483' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 411476 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli B' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 37762 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLN 2 1 1 GLN GLN A . n A 1 3 VAL 3 2 2 VAL VAL A . n A 1 4 ASN 4 3 3 ASN ASN A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 MET 7 6 6 MET MET A . n A 1 8 GLN 8 7 7 GLN GLN A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 CYS 11 10 10 CYS CYS A . n A 1 12 SER 12 11 11 SER SER A . n A 1 13 PRO 13 12 12 PRO PRO A . n A 1 14 GLN 14 13 13 GLN GLN A . n A 1 15 ASP 15 14 14 ASP ASP A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 THR 18 17 17 THR THR A . n A 1 19 TYR 19 18 18 TYR TYR A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 THR 21 20 20 THR THR A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 ARG 25 24 24 ARG ARG A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 SER 27 26 26 SER SER A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 MET 30 29 29 MET MET A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 VAL 33 32 32 VAL VAL A . n A 1 34 MET 34 33 33 MET MET A . n A 1 35 VAL 35 34 34 VAL VAL A . n A 1 36 PRO 36 35 35 PRO PRO A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 GLU 38 37 37 GLU GLU A . n A 1 39 ILE 39 38 38 ILE ILE A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 THR 42 41 41 THR THR A . n A 1 43 TYR 43 42 42 TYR TYR A . n A 1 44 SER 44 43 43 SER SER A . n A 1 45 MET 45 44 44 MET MET A . n A 1 46 TYR 46 45 45 TYR TYR A . n A 1 47 ASP 47 46 46 ASP ASP A . n A 1 48 ARG 48 47 47 ARG ARG A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 ILE 50 49 49 ILE ILE A . n A 1 51 PHE 51 50 50 PHE PHE A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 PRO 56 55 55 PRO PRO A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 LYS 59 58 58 LYS LYS A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 THR 65 64 64 THR THR A . n A 1 66 ILE 66 65 65 ILE ILE A . n A 1 67 ASP 67 66 66 ASP ASP A . n A 1 68 PRO 68 67 67 PRO PRO A . n A 1 69 LEU 69 68 68 LEU LEU A . n A 1 70 LYS 70 69 69 LYS LYS A . n A 1 71 SER 71 70 70 SER SER A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 PHE 73 72 72 PHE PHE A . n A 1 74 PHE 74 73 73 PHE PHE A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 GLU 76 75 75 GLU GLU A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 ARG 78 77 77 ARG ARG A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 ILE 83 82 82 ILE ILE A . n A 1 84 ASN 84 83 83 ASN ASN A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 GLY 86 85 85 GLY GLY A . n A 1 87 GLY 87 86 86 GLY GLY A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 GLY 89 88 88 GLY GLY A . n A 1 90 ILE 90 89 89 ILE ILE A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 THR 92 91 91 THR THR A . n A 1 93 VAL 93 92 92 VAL VAL A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 TYR 98 97 97 TYR TYR A . n A 1 99 THR 99 98 98 THR THR A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 LYS 101 100 100 LYS LYS A . n A 1 102 PHE 102 101 101 PHE PHE A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 ASP 104 103 103 ASP ASP A . n A 1 105 ALA 105 104 104 ALA ALA A . n A 1 106 LEU 106 105 105 LEU LEU A . n A 1 107 TYR 107 106 106 TYR TYR A . n A 1 108 VAL 108 107 107 VAL VAL A . n A 1 109 GLY 109 108 108 GLY GLY A . n A 1 110 ARG 110 109 109 ARG ARG A . n A 1 111 GLY 111 110 110 GLY GLY A . n A 1 112 LYS 112 111 111 LYS LYS A . n A 1 113 GLN 113 112 112 GLN GLN A . n A 1 114 LYS 114 113 113 LYS LYS A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 THR 116 115 115 THR THR A . n A 1 117 PHE 117 116 116 PHE PHE A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 SER 119 118 118 SER SER A . n A 1 120 LYS 120 119 119 LYS LYS A . n A 1 121 ASP 121 120 120 ASP ASP A . n A 1 122 SER 122 121 121 SER SER A . n A 1 123 SER 123 122 122 SER SER A . n A 1 124 ASN 124 123 123 ASN ASN A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 LYS 127 126 126 LYS LYS A . n A 1 128 PHE 128 127 127 PHE PHE A . n A 1 129 TYR 129 128 128 TYR TYR A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 ASN 131 130 130 ASN ASN A . n A 1 132 SER 132 131 131 SER SER A . n A 1 133 ALA 133 132 132 ALA ALA A . n A 1 134 THR 134 133 133 THR THR A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 HIS 136 135 135 HIS HIS A . n A 1 137 LYS 137 136 136 LYS LYS A . n A 1 138 GLU 138 137 137 GLU GLU A . n A 1 139 TYR 139 138 138 TYR TYR A . n A 1 140 LYS 140 139 139 LYS LYS A . n A 1 141 THR 141 140 140 THR THR A . n A 1 142 GLN 142 141 141 GLN GLN A . n A 1 143 LEU 143 142 142 LEU LEU A . n A 1 144 ILE 144 143 143 ILE ILE A . n A 1 145 THR 145 144 144 THR THR A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 ASP 147 146 146 ASP ASP A . n A 1 148 GLY 148 147 147 GLY GLY A . n A 1 149 ARG 149 148 148 ARG ARG A . n A 1 150 LYS 150 149 149 LYS LYS A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 SER 152 151 151 SER SER A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 LYS 154 153 153 LYS LYS A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 ASN 156 155 155 ASN ASN A . n A 1 157 SER 157 156 156 SER SER A . n A 1 158 PHE 158 157 157 PHE PHE A . n A 1 159 ALA 159 158 158 ALA ALA A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 GLY 161 160 160 GLY GLY A . n A 1 162 LYS 162 161 161 LYS LYS A . n A 1 163 LEU 163 162 162 LEU LEU A . n A 1 164 GLU 164 163 163 GLU GLU A . n A 1 165 GLU 165 164 164 GLU GLU A . n A 1 166 SER 166 165 165 SER SER A . n A 1 167 ASN 167 166 166 ASN ASN A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 ARG 169 168 168 ARG ARG A . n A 1 170 VAL 170 169 169 VAL VAL A . n A 1 171 ILE 171 170 170 ILE ILE A . n A 1 172 ASN 172 171 171 ASN ASN A . n A 1 173 GLN 173 172 172 GLN GLN A . n A 1 174 LEU 174 173 173 LEU LEU A . n A 1 175 ILE 175 174 174 ILE ILE A . n A 1 176 VAL 176 175 175 VAL VAL A . n A 1 177 ASN 177 176 176 ASN ASN A . n A 1 178 ASN 178 177 177 ASN ASN A . n A 1 179 VAL 179 178 178 VAL VAL A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 GLU 181 180 180 GLU GLU A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 PRO 184 183 183 PRO PRO A . n A 1 185 CYS 185 184 184 CYS CYS A . n A 1 186 GLN 186 185 185 GLN GLN A . n A 1 187 LEU 187 186 186 LEU LEU A . n A 1 188 GLN 188 187 187 GLN GLN A . n A 1 189 MET 189 188 188 MET MET A . n A 1 190 GLY 190 189 189 GLY GLY A . n A 1 191 LEU 191 190 190 LEU LEU A . n A 1 192 THR 192 191 191 THR THR A . n A 1 193 GLU 193 192 192 GLU GLU A . n A 1 194 LEU 194 193 193 LEU LEU A . n A 1 195 LYS 195 194 194 LYS LYS A . n A 1 196 PRO 196 195 195 PRO PRO A . n A 1 197 GLY 197 196 196 GLY GLY A . n A 1 198 SER 198 197 197 SER SER A . n A 1 199 VAL 199 198 198 VAL VAL A . n A 1 200 TRP 200 199 199 TRP TRP A . n A 1 201 ASN 201 200 200 ASN ASN A . n A 1 202 THR 202 201 201 THR THR A . n A 1 203 MET 203 202 ? ? ? A . n A 1 204 PRO 204 203 ? ? ? A . n A 1 205 ALA 205 204 ? ? ? A . n A 1 206 HIS 206 205 ? ? ? A . n A 1 207 THR 207 206 ? ? ? A . n A 1 208 HIS 208 207 ? ? ? A . n A 1 209 SER 209 208 ? ? ? A . n A 1 210 ARG 210 209 ? ? ? A . n A 1 211 ARG 211 210 210 ARG ARG A . n A 1 212 VAL 212 211 211 VAL VAL A . n A 1 213 GLU 213 212 212 GLU GLU A . n A 1 214 ALA 214 213 213 ALA ALA A . n A 1 215 TYR 215 214 214 TYR TYR A . n A 1 216 PHE 216 215 215 PHE PHE A . n A 1 217 TYR 217 216 216 TYR TYR A . n A 1 218 PHE 218 217 217 PHE PHE A . n A 1 219 ASN 219 218 218 ASN ASN A . n A 1 220 VAL 220 219 219 VAL VAL A . n A 1 221 PRO 221 220 220 PRO PRO A . n A 1 222 ALA 222 221 221 ALA ALA A . n A 1 223 GLY 223 222 222 GLY GLY A . n A 1 224 ASN 224 223 223 ASN ASN A . n A 1 225 ALA 225 224 224 ALA ALA A . n A 1 226 ILE 226 225 225 ILE ILE A . n A 1 227 CYS 227 226 226 CYS CYS A . n A 1 228 HIS 228 227 227 HIS HIS A . n A 1 229 PHE 229 228 228 PHE PHE A . n A 1 230 MET 230 229 229 MET MET A . n A 1 231 GLY 231 230 230 GLY GLY A . n A 1 232 GLU 232 231 231 GLU GLU A . n A 1 233 PRO 233 232 232 PRO PRO A . n A 1 234 GLN 234 233 233 GLN GLN A . n A 1 235 GLU 235 234 234 GLU GLU A . n A 1 236 GLU 236 235 235 GLU GLU A . n A 1 237 ARG 237 236 236 ARG ARG A . n A 1 238 VAL 238 237 237 VAL VAL A . n A 1 239 VAL 239 238 238 VAL VAL A . n A 1 240 TRP 240 239 239 TRP TRP A . n A 1 241 MET 241 240 240 MET MET A . n A 1 242 GLN 242 241 241 GLN GLN A . n A 1 243 ASN 243 242 242 ASN ASN A . n A 1 244 GLU 244 243 243 GLU GLU A . n A 1 245 GLN 245 244 244 GLN GLN A . n A 1 246 ALA 246 245 245 ALA ALA A . n A 1 247 ILE 247 246 246 ILE ILE A . n A 1 248 MET 248 247 247 MET MET A . n A 1 249 SER 249 248 248 SER SER A . n A 1 250 PRO 250 249 249 PRO PRO A . n A 1 251 GLU 251 250 250 GLU GLU A . n A 1 252 TRP 252 251 251 TRP TRP A . n A 1 253 SER 253 252 252 SER SER A . n A 1 254 ILE 254 253 253 ILE ILE A . n A 1 255 HIS 255 254 254 HIS HIS A . n A 1 256 ALA 256 255 255 ALA ALA A . n A 1 257 ALA 257 256 256 ALA ALA A . n A 1 258 ALA 258 257 257 ALA ALA A . n A 1 259 GLY 259 258 258 GLY GLY A . n A 1 260 THR 260 259 259 THR THR A . n A 1 261 SER 261 260 260 SER SER A . n A 1 262 ASN 262 261 261 ASN ASN A . n A 1 263 TYR 263 262 262 TYR TYR A . n A 1 264 MET 264 263 263 MET MET A . n A 1 265 PHE 265 264 264 PHE PHE A . n A 1 266 ILE 266 265 265 ILE ILE A . n A 1 267 TRP 267 266 266 TRP TRP A . n A 1 268 GLY 268 267 267 GLY GLY A . n A 1 269 MET 269 268 268 MET MET A . n A 1 270 ALA 270 269 269 ALA ALA A . n A 1 271 GLY 271 270 270 GLY GLY A . n A 1 272 GLU 272 271 271 GLU GLU A . n A 1 273 ASN 273 272 ? ? ? A . n A 1 274 LEU 274 273 ? ? ? A . n A 1 275 ASP 275 274 ? ? ? A . n A 1 276 TYR 276 275 ? ? ? A . n A 1 277 GLY 277 276 ? ? ? A . n A 1 278 ASP 278 277 ? ? ? A . n A 1 279 MET 279 278 ? ? ? A . n A 1 280 ASP 280 279 ? ? ? A . n A 1 281 LYS 281 280 ? ? ? A . n A 1 282 ILE 282 281 ? ? ? A . n A 1 283 LYS 283 282 ? ? ? A . n A 1 284 TYR 284 283 ? ? ? A . n A 1 285 THR 285 284 ? ? ? A . n A 1 286 GLU 286 285 ? ? ? A . n A 1 287 MET 287 286 ? ? ? A . n A 1 288 ARG 288 287 ? ? ? A . n A 1 289 LEU 289 288 ? ? ? A . n A 1 290 GLU 290 289 ? ? ? A . n A 1 291 HIS 291 290 ? ? ? A . n A 1 292 HIS 292 291 ? ? ? A . n A 1 293 HIS 293 292 ? ? ? A . n A 1 294 HIS 294 293 ? ? ? A . n A 1 295 HIS 295 294 ? ? ? A . n A 1 296 HIS 296 295 ? ? ? A . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21.1_5286: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.55 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9KD0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.416 _cell.length_a_esd ? _cell.length_b 72.936 _cell.length_b_esd ? _cell.length_c 39.532 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9KD0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9KD0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG monomethyl ether 2000, Calcium acetate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER R 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-02-12 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9KD0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.91 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25764 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.58 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.54 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.106 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.91 _reflns_shell.d_res_low 3.09 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.07 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 886 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.17 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.518 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.911 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.1 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.451 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9KD0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.91 _refine.ls_d_res_low 39.53 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5616 _refine.ls_number_reflns_R_free 282 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.57 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2027 _refine.ls_R_factor_R_free 0.2572 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2000 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.91 _refine_hist.d_res_low 39.53 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2079 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2079 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.485 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.881 ? 790 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 311 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 369 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.91 3.67 . . 140 2646 99.00 . . . . 0.2247 . . . . . . . . . . . 0.2898 'X-RAY DIFFRACTION' 3.67 39.53 . . 142 2688 100.00 . . . . 0.1898 . . . . . . . . . . . 0.2449 # _struct.entry_id 9KD0 _struct.title 'Crystal structure of Bacteroides ovatus KduI2 responsible for metabolism of glycosaminoglycan' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9KD0 _struct_keywords.text 'Isomerase, Glycosaminoglycan metabolism, Bacteroides' _struct_keywords.pdbx_keywords ISOMERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0AAN3A235_BACO1 _struct_ref.pdbx_db_accession A0AAN3A235 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QVNYKMQVACSPQDVKTYDTNRLRSSFLMEKVMVPNEINVTYSMYDRLIFGGAVPATKELVLETIDPLKSKFFLERRELG VINIGGEGIVTVDGKEYTLKFKDALYVGRGKQKVTFKSKDSSNPAKFYINSATAHKEYKTQLITIDGRKGSLKANSFAAG KLEESNDRVINQLIVNNVLEEGPCQLQMGLTELKPGSVWNTMPAHTHSRRVEAYFYFNVPAGNAICHFMGEPQEERVVWM QNEQAIMSPEWSIHAAAGTSNYMFIWGMAGENLDYGDMDKIKYTEMR ; _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9KD0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 288 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0AAN3A235 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 306 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 287 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9KD0 MET A 1 ? UNP A0AAN3A235 ? ? 'initiating methionine' 0 1 1 9KD0 LEU A 289 ? UNP A0AAN3A235 ? ? 'expression tag' 288 2 1 9KD0 GLU A 290 ? UNP A0AAN3A235 ? ? 'expression tag' 289 3 1 9KD0 HIS A 291 ? UNP A0AAN3A235 ? ? 'expression tag' 290 4 1 9KD0 HIS A 292 ? UNP A0AAN3A235 ? ? 'expression tag' 291 5 1 9KD0 HIS A 293 ? UNP A0AAN3A235 ? ? 'expression tag' 292 6 1 9KD0 HIS A 294 ? UNP A0AAN3A235 ? ? 'expression tag' 293 7 1 9KD0 HIS A 295 ? UNP A0AAN3A235 ? ? 'expression tag' 294 8 1 9KD0 HIS A 296 ? UNP A0AAN3A235 ? ? 'expression tag' 295 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A 1 2 A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 12 ? LYS A 17 ? SER A 11 LYS A 16 1 ? 6 HELX_P HELX_P2 AA2 ASP A 20 ? PHE A 28 ? ASP A 19 PHE A 27 1 ? 9 HELX_P HELX_P3 AA3 ILE A 66 ? LYS A 70 ? ILE A 65 LYS A 69 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 7 ? AA3 ? 4 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 3 ? GLN A 8 ? VAL A 2 GLN A 7 AA1 2 ILE A 39 ? SER A 44 ? ILE A 38 SER A 43 AA1 3 LEU A 49 ? ALA A 54 ? LEU A 48 ALA A 53 AA1 4 PHE A 128 ? THR A 134 ? PHE A 127 THR A 133 AA1 5 ARG A 78 ? ASN A 84 ? ARG A 77 ASN A 83 AA1 6 ALA A 105 ? VAL A 108 ? ALA A 104 VAL A 107 AA1 7 GLN A 142 ? THR A 145 ? GLN A 141 THR A 144 AA1 8 LEU A 153 ? LYS A 154 ? LEU A 152 LYS A 153 AA2 1 LEU A 29 ? MET A 30 ? LEU A 28 MET A 29 AA2 2 GLN A 245 ? SER A 249 ? GLN A 244 SER A 248 AA2 3 VAL A 212 ? PHE A 218 ? VAL A 211 PHE A 217 AA2 4 MET A 264 ? ALA A 270 ? MET A 263 ALA A 269 AA2 5 GLN A 188 ? LEU A 194 ? GLN A 187 LEU A 193 AA2 6 ARG A 169 ? ILE A 175 ? ARG A 168 ILE A 174 AA2 7 ASN A 156 ? ALA A 160 ? ASN A 155 ALA A 159 AA3 1 LEU A 61 ? VAL A 62 ? LEU A 60 VAL A 61 AA3 2 VAL A 115 ? SER A 119 ? VAL A 114 SER A 118 AA3 3 GLY A 89 ? VAL A 93 ? GLY A 88 VAL A 92 AA3 4 LYS A 96 ? LEU A 100 ? LYS A 95 LEU A 99 AA4 1 GLU A 235 ? MET A 241 ? GLU A 234 MET A 240 AA4 2 ILE A 226 ? GLU A 232 ? ILE A 225 GLU A 231 AA4 3 ALA A 257 ? GLY A 259 ? ALA A 256 GLY A 258 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 6 ? N LYS A 5 O TYR A 43 ? O TYR A 42 AA1 2 3 N SER A 44 ? N SER A 43 O LEU A 49 ? O LEU A 48 AA1 3 4 N ALA A 54 ? N ALA A 53 O PHE A 128 ? O PHE A 127 AA1 4 5 O TYR A 129 ? O TYR A 128 N ILE A 83 ? N ILE A 82 AA1 5 6 N LEU A 80 ? N LEU A 79 O VAL A 108 ? O VAL A 107 AA1 6 7 N TYR A 107 ? N TYR A 106 O GLN A 142 ? O GLN A 141 AA1 7 8 N LEU A 143 ? N LEU A 142 O LEU A 153 ? O LEU A 152 AA2 1 2 N MET A 30 ? N MET A 29 O ALA A 246 ? O ALA A 245 AA2 2 3 O ILE A 247 ? O ILE A 246 N TYR A 215 ? N TYR A 214 AA2 3 4 N ALA A 214 ? N ALA A 213 O GLY A 268 ? O GLY A 267 AA2 4 5 O MET A 269 ? O MET A 268 N GLN A 188 ? N GLN A 187 AA2 5 6 O LEU A 191 ? O LEU A 190 N ASN A 172 ? N ASN A 171 AA2 6 7 O GLN A 173 ? O GLN A 172 N ASN A 156 ? N ASN A 155 AA3 1 2 N LEU A 61 ? N LEU A 60 O PHE A 117 ? O PHE A 116 AA3 2 3 O LYS A 118 ? O LYS A 117 N ILE A 90 ? N ILE A 89 AA3 3 4 N VAL A 93 ? N VAL A 92 O LYS A 96 ? O LYS A 95 AA4 1 2 O MET A 241 ? O MET A 240 N ILE A 226 ? N ILE A 225 AA4 2 3 N CYS A 227 ? N CYS A 226 O ALA A 258 ? O ALA A 257 # _pdbx_entry_details.entry_id 9KD0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 36 ? ? 19.45 58.92 2 1 LEU A 74 ? ? -91.13 44.00 3 1 ARG A 76 ? ? -149.38 47.05 4 1 ARG A 148 ? ? -79.51 -119.81 5 1 LYS A 149 ? ? -76.06 -112.90 6 1 ASP A 167 ? ? -60.04 95.06 7 1 LEU A 173 ? ? -91.51 -69.03 8 1 GLN A 185 ? ? -154.80 -40.05 9 1 GLN A 241 ? ? -110.40 -160.93 10 1 GLU A 243 ? ? 61.55 62.00 11 1 HIS A 254 ? ? -155.26 59.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A MET 202 ? A MET 203 3 1 Y 1 A PRO 203 ? A PRO 204 4 1 Y 1 A ALA 204 ? A ALA 205 5 1 Y 1 A HIS 205 ? A HIS 206 6 1 Y 1 A THR 206 ? A THR 207 7 1 Y 1 A HIS 207 ? A HIS 208 8 1 Y 1 A SER 208 ? A SER 209 9 1 Y 1 A ARG 209 ? A ARG 210 10 1 Y 1 A ASN 272 ? A ASN 273 11 1 Y 1 A LEU 273 ? A LEU 274 12 1 Y 1 A ASP 274 ? A ASP 275 13 1 Y 1 A TYR 275 ? A TYR 276 14 1 Y 1 A GLY 276 ? A GLY 277 15 1 Y 1 A ASP 277 ? A ASP 278 16 1 Y 1 A MET 278 ? A MET 279 17 1 Y 1 A ASP 279 ? A ASP 280 18 1 Y 1 A LYS 280 ? A LYS 281 19 1 Y 1 A ILE 281 ? A ILE 282 20 1 Y 1 A LYS 282 ? A LYS 283 21 1 Y 1 A TYR 283 ? A TYR 284 22 1 Y 1 A THR 284 ? A THR 285 23 1 Y 1 A GLU 285 ? A GLU 286 24 1 Y 1 A MET 286 ? A MET 287 25 1 Y 1 A ARG 287 ? A ARG 288 26 1 Y 1 A LEU 288 ? A LEU 289 27 1 Y 1 A GLU 289 ? A GLU 290 28 1 Y 1 A HIS 290 ? A HIS 291 29 1 Y 1 A HIS 291 ? A HIS 292 30 1 Y 1 A HIS 292 ? A HIS 293 31 1 Y 1 A HIS 293 ? A HIS 294 32 1 Y 1 A HIS 294 ? A HIS 295 33 1 Y 1 A HIS 295 ? A HIS 296 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 15H04629 1 'Japan Society for the Promotion of Science (JSPS)' Japan 18H02166 2 'Japan Society for the Promotion of Science (JSPS)' Japan 21H02156 3 'Yakult Bio-science Foundation' Japan ? 4 'Japan Foundation for Applied Enzymology' Japan ? 5 'Japan Environ and Organic-farming Foundation' Japan ? 6 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ywk _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9KD0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011184 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000108 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013711 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025297 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #