data_9KFQ # _entry.id 9KFQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9KFQ pdb_00009kfq 10.2210/pdb9kfq/pdb WWPDB D_1300053464 ? ? BMRB 36705 ? 10.13018/BMR36705 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-11-12 ? 2 'Structure model' 1 1 2026-05-27 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9KFQ _pdbx_database_status.recvd_initial_deposition_date 2024-11-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Loop4 engineered disulfide-rich peptides' _pdbx_database_related.db_id 36705 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email chlwu@xmu.edu.cn _pdbx_contact_author.name_first wu _pdbx_contact_author.name_last chuanliu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2946-7299 # _audit_author.name 'Liu, H.T.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 147 _citation.language ? _citation.page_first 24870 _citation.page_last 24883 _citation.title 'Proline-Mediated Enhancement in Evolvability of Disulfide-Rich Peptides for Discovering Protein Binders.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.5c07075 _citation.pdbx_database_id_PubMed 40601296 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, H.' 1 ? primary 'Song, L.' 2 ? primary 'Meng, X.' 3 ? primary 'Li, J.' 4 ? primary 'Fan, S.' 5 ? primary 'Dong, H.' 6 ? primary 'Wang, X.' 7 ? primary 'Li, M.' 8 ? primary 'Yu, H.' 9 ? primary 'Tsai, Y.H.' 10 0000-0003-0589-5088 primary 'Yin, Y.' 11 0000-0003-2466-2167 primary 'Wu, C.' 12 0000-0003-2946-7299 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description p28 _entity.formula_weight 3683.348 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CKPKGAPCSPLMYPCCTGPCTFKENENGNTVKRC _entity_poly.pdbx_seq_one_letter_code_can CKPKGAPCSPLMYPCCTGPCTFKENENGNTVKRC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 LYS n 1 3 PRO n 1 4 LYS n 1 5 GLY n 1 6 ALA n 1 7 PRO n 1 8 CYS n 1 9 SER n 1 10 PRO n 1 11 LEU n 1 12 MET n 1 13 TYR n 1 14 PRO n 1 15 CYS n 1 16 CYS n 1 17 THR n 1 18 GLY n 1 19 PRO n 1 20 CYS n 1 21 THR n 1 22 PHE n 1 23 LYS n 1 24 GLU n 1 25 ASN n 1 26 GLU n 1 27 ASN n 1 28 GLY n 1 29 ASN n 1 30 THR n 1 31 VAL n 1 32 LYS n 1 33 ARG n 1 34 CYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 34 _pdbx_entity_src_syn.organism_scientific 'Phage #D' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 77920 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 CYS 34 34 34 CYS CYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9KFQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9KFQ _struct.title 'Loop4 engineered disulfide-rich peptides' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9KFQ _struct_keywords.text 'disulfide-rich peptides, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9KFQ _struct_ref.pdbx_db_accession 9KFQ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9KFQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9KFQ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 34 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 1 A CYS 16 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 8 A CYS 20 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 15 A CYS 34 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 1 ? CYS A 16 ? CYS A 1 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 8 ? CYS A 20 ? CYS A 8 ? 1_555 CYS A 20 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 15 ? CYS A 34 ? CYS A 15 ? 1_555 CYS A 34 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9KFQ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HZ1 A LYS 4 ? ? OXT A CYS 34 ? ? 1.55 2 7 HZ1 A LYS 4 ? ? O A CYS 34 ? ? 1.53 3 8 HZ3 A LYS 4 ? ? O A CYS 34 ? ? 1.56 4 9 O A ASN 29 ? ? HG1 A THR 30 ? ? 1.57 5 10 HZ1 A LYS 4 ? ? OXT A CYS 34 ? ? 1.58 6 11 HZ1 A LYS 4 ? ? OXT A CYS 34 ? ? 1.60 7 12 HZ2 A LYS 4 ? ? OXT A CYS 34 ? ? 1.55 8 13 HZ3 A LYS 4 ? ? O A CYS 34 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 31 ? ? -84.27 -75.06 2 1 ARG A 33 ? ? 46.67 27.94 3 3 ASN A 29 ? ? 66.55 155.99 4 3 VAL A 31 ? ? -104.66 -68.90 5 4 PHE A 22 ? ? 38.48 25.74 6 4 VAL A 31 ? ? -120.02 -88.50 7 5 PHE A 22 ? ? -38.20 101.86 8 5 GLU A 24 ? ? -169.23 50.03 9 5 ASN A 27 ? ? 72.49 -44.73 10 5 VAL A 31 ? ? -92.63 -69.92 11 5 ARG A 33 ? ? 46.27 21.73 12 6 PHE A 22 ? ? 48.31 19.06 13 6 VAL A 31 ? ? -113.36 -74.05 14 7 THR A 30 ? ? 57.35 94.43 15 7 VAL A 31 ? ? -90.68 -76.11 16 7 ARG A 33 ? ? 49.93 25.06 17 8 VAL A 31 ? ? -104.87 -71.65 18 9 THR A 30 ? ? 64.41 148.11 19 9 VAL A 31 ? ? -131.01 -73.09 20 10 ARG A 33 ? ? 44.64 28.68 21 11 PHE A 22 ? ? 42.10 24.29 22 11 THR A 30 ? ? -109.21 71.25 23 11 VAL A 31 ? ? -77.09 -74.40 24 11 ARG A 33 ? ? 48.21 25.14 25 12 PHE A 22 ? ? 35.98 36.65 26 12 GLU A 24 ? ? -175.96 -18.31 27 12 ASN A 27 ? ? 70.34 -49.72 28 13 VAL A 31 ? ? -91.67 -75.92 29 13 ARG A 33 ? ? 49.91 20.48 30 14 PHE A 22 ? ? 39.45 28.59 31 14 VAL A 31 ? ? -152.16 -77.84 32 15 VAL A 31 ? ? -90.75 -76.88 # _pdbx_nmr_ensemble.entry_id 9KFQ _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9KFQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 15 # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM p28, acetone' _pdbx_nmr_sample_details.solvent_system acetone _pdbx_nmr_sample_details.label p28 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component p28 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label p28 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 anisotropic 2 1 1 '2D 1H-1H TOCSY' 1 anisotropic 3 1 1 '2D 1H-1H COSY' 1 anisotropic 4 1 1 '2D 1H-13C HSQC' 1 anisotropic 5 1 1 '2D 1H-15N HSQC' 1 anisotropic # _pdbx_nmr_refine.entry_id 9KFQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'liu hongtan' 2 'structure calculation' ARIA2alpha ? 'liu hongtan' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'liu hongtan' 4 processing NMRPipe ? 'liu hongtan' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLU N N N N 72 GLU CA C N S 73 GLU C C N N 74 GLU O O N N 75 GLU CB C N N 76 GLU CG C N N 77 GLU CD C N N 78 GLU OE1 O N N 79 GLU OE2 O N N 80 GLU OXT O N N 81 GLU H H N N 82 GLU H2 H N N 83 GLU HA H N N 84 GLU HB2 H N N 85 GLU HB3 H N N 86 GLU HG2 H N N 87 GLU HG3 H N N 88 GLU HE2 H N N 89 GLU HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 LEU N N N N 101 LEU CA C N S 102 LEU C C N N 103 LEU O O N N 104 LEU CB C N N 105 LEU CG C N N 106 LEU CD1 C N N 107 LEU CD2 C N N 108 LEU OXT O N N 109 LEU H H N N 110 LEU H2 H N N 111 LEU HA H N N 112 LEU HB2 H N N 113 LEU HB3 H N N 114 LEU HG H N N 115 LEU HD11 H N N 116 LEU HD12 H N N 117 LEU HD13 H N N 118 LEU HD21 H N N 119 LEU HD22 H N N 120 LEU HD23 H N N 121 LEU HXT H N N 122 LYS N N N N 123 LYS CA C N S 124 LYS C C N N 125 LYS O O N N 126 LYS CB C N N 127 LYS CG C N N 128 LYS CD C N N 129 LYS CE C N N 130 LYS NZ N N N 131 LYS OXT O N N 132 LYS H H N N 133 LYS H2 H N N 134 LYS HA H N N 135 LYS HB2 H N N 136 LYS HB3 H N N 137 LYS HG2 H N N 138 LYS HG3 H N N 139 LYS HD2 H N N 140 LYS HD3 H N N 141 LYS HE2 H N N 142 LYS HE3 H N N 143 LYS HZ1 H N N 144 LYS HZ2 H N N 145 LYS HZ3 H N N 146 LYS HXT H N N 147 MET N N N N 148 MET CA C N S 149 MET C C N N 150 MET O O N N 151 MET CB C N N 152 MET CG C N N 153 MET SD S N N 154 MET CE C N N 155 MET OXT O N N 156 MET H H N N 157 MET H2 H N N 158 MET HA H N N 159 MET HB2 H N N 160 MET HB3 H N N 161 MET HG2 H N N 162 MET HG3 H N N 163 MET HE1 H N N 164 MET HE2 H N N 165 MET HE3 H N N 166 MET HXT H N N 167 PHE N N N N 168 PHE CA C N S 169 PHE C C N N 170 PHE O O N N 171 PHE CB C N N 172 PHE CG C Y N 173 PHE CD1 C Y N 174 PHE CD2 C Y N 175 PHE CE1 C Y N 176 PHE CE2 C Y N 177 PHE CZ C Y N 178 PHE OXT O N N 179 PHE H H N N 180 PHE H2 H N N 181 PHE HA H N N 182 PHE HB2 H N N 183 PHE HB3 H N N 184 PHE HD1 H N N 185 PHE HD2 H N N 186 PHE HE1 H N N 187 PHE HE2 H N N 188 PHE HZ H N N 189 PHE HXT H N N 190 PRO N N N N 191 PRO CA C N S 192 PRO C C N N 193 PRO O O N N 194 PRO CB C N N 195 PRO CG C N N 196 PRO CD C N N 197 PRO OXT O N N 198 PRO H H N N 199 PRO HA H N N 200 PRO HB2 H N N 201 PRO HB3 H N N 202 PRO HG2 H N N 203 PRO HG3 H N N 204 PRO HD2 H N N 205 PRO HD3 H N N 206 PRO HXT H N N 207 SER N N N N 208 SER CA C N S 209 SER C C N N 210 SER O O N N 211 SER CB C N N 212 SER OG O N N 213 SER OXT O N N 214 SER H H N N 215 SER H2 H N N 216 SER HA H N N 217 SER HB2 H N N 218 SER HB3 H N N 219 SER HG H N N 220 SER HXT H N N 221 THR N N N N 222 THR CA C N S 223 THR C C N N 224 THR O O N N 225 THR CB C N R 226 THR OG1 O N N 227 THR CG2 C N N 228 THR OXT O N N 229 THR H H N N 230 THR H2 H N N 231 THR HA H N N 232 THR HB H N N 233 THR HG1 H N N 234 THR HG21 H N N 235 THR HG22 H N N 236 THR HG23 H N N 237 THR HXT H N N 238 TYR N N N N 239 TYR CA C N S 240 TYR C C N N 241 TYR O O N N 242 TYR CB C N N 243 TYR CG C Y N 244 TYR CD1 C Y N 245 TYR CD2 C Y N 246 TYR CE1 C Y N 247 TYR CE2 C Y N 248 TYR CZ C Y N 249 TYR OH O N N 250 TYR OXT O N N 251 TYR H H N N 252 TYR H2 H N N 253 TYR HA H N N 254 TYR HB2 H N N 255 TYR HB3 H N N 256 TYR HD1 H N N 257 TYR HD2 H N N 258 TYR HE1 H N N 259 TYR HE2 H N N 260 TYR HH H N N 261 TYR HXT H N N 262 VAL N N N N 263 VAL CA C N S 264 VAL C C N N 265 VAL O O N N 266 VAL CB C N N 267 VAL CG1 C N N 268 VAL CG2 C N N 269 VAL OXT O N N 270 VAL H H N N 271 VAL H2 H N N 272 VAL HA H N N 273 VAL HB H N N 274 VAL HG11 H N N 275 VAL HG12 H N N 276 VAL HG13 H N N 277 VAL HG21 H N N 278 VAL HG22 H N N 279 VAL HG23 H N N 280 VAL HXT H N N 281 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLU N CA sing N N 68 GLU N H sing N N 69 GLU N H2 sing N N 70 GLU CA C sing N N 71 GLU CA CB sing N N 72 GLU CA HA sing N N 73 GLU C O doub N N 74 GLU C OXT sing N N 75 GLU CB CG sing N N 76 GLU CB HB2 sing N N 77 GLU CB HB3 sing N N 78 GLU CG CD sing N N 79 GLU CG HG2 sing N N 80 GLU CG HG3 sing N N 81 GLU CD OE1 doub N N 82 GLU CD OE2 sing N N 83 GLU OE2 HE2 sing N N 84 GLU OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 LEU N CA sing N N 95 LEU N H sing N N 96 LEU N H2 sing N N 97 LEU CA C sing N N 98 LEU CA CB sing N N 99 LEU CA HA sing N N 100 LEU C O doub N N 101 LEU C OXT sing N N 102 LEU CB CG sing N N 103 LEU CB HB2 sing N N 104 LEU CB HB3 sing N N 105 LEU CG CD1 sing N N 106 LEU CG CD2 sing N N 107 LEU CG HG sing N N 108 LEU CD1 HD11 sing N N 109 LEU CD1 HD12 sing N N 110 LEU CD1 HD13 sing N N 111 LEU CD2 HD21 sing N N 112 LEU CD2 HD22 sing N N 113 LEU CD2 HD23 sing N N 114 LEU OXT HXT sing N N 115 LYS N CA sing N N 116 LYS N H sing N N 117 LYS N H2 sing N N 118 LYS CA C sing N N 119 LYS CA CB sing N N 120 LYS CA HA sing N N 121 LYS C O doub N N 122 LYS C OXT sing N N 123 LYS CB CG sing N N 124 LYS CB HB2 sing N N 125 LYS CB HB3 sing N N 126 LYS CG CD sing N N 127 LYS CG HG2 sing N N 128 LYS CG HG3 sing N N 129 LYS CD CE sing N N 130 LYS CD HD2 sing N N 131 LYS CD HD3 sing N N 132 LYS CE NZ sing N N 133 LYS CE HE2 sing N N 134 LYS CE HE3 sing N N 135 LYS NZ HZ1 sing N N 136 LYS NZ HZ2 sing N N 137 LYS NZ HZ3 sing N N 138 LYS OXT HXT sing N N 139 MET N CA sing N N 140 MET N H sing N N 141 MET N H2 sing N N 142 MET CA C sing N N 143 MET CA CB sing N N 144 MET CA HA sing N N 145 MET C O doub N N 146 MET C OXT sing N N 147 MET CB CG sing N N 148 MET CB HB2 sing N N 149 MET CB HB3 sing N N 150 MET CG SD sing N N 151 MET CG HG2 sing N N 152 MET CG HG3 sing N N 153 MET SD CE sing N N 154 MET CE HE1 sing N N 155 MET CE HE2 sing N N 156 MET CE HE3 sing N N 157 MET OXT HXT sing N N 158 PHE N CA sing N N 159 PHE N H sing N N 160 PHE N H2 sing N N 161 PHE CA C sing N N 162 PHE CA CB sing N N 163 PHE CA HA sing N N 164 PHE C O doub N N 165 PHE C OXT sing N N 166 PHE CB CG sing N N 167 PHE CB HB2 sing N N 168 PHE CB HB3 sing N N 169 PHE CG CD1 doub Y N 170 PHE CG CD2 sing Y N 171 PHE CD1 CE1 sing Y N 172 PHE CD1 HD1 sing N N 173 PHE CD2 CE2 doub Y N 174 PHE CD2 HD2 sing N N 175 PHE CE1 CZ doub Y N 176 PHE CE1 HE1 sing N N 177 PHE CE2 CZ sing Y N 178 PHE CE2 HE2 sing N N 179 PHE CZ HZ sing N N 180 PHE OXT HXT sing N N 181 PRO N CA sing N N 182 PRO N CD sing N N 183 PRO N H sing N N 184 PRO CA C sing N N 185 PRO CA CB sing N N 186 PRO CA HA sing N N 187 PRO C O doub N N 188 PRO C OXT sing N N 189 PRO CB CG sing N N 190 PRO CB HB2 sing N N 191 PRO CB HB3 sing N N 192 PRO CG CD sing N N 193 PRO CG HG2 sing N N 194 PRO CG HG3 sing N N 195 PRO CD HD2 sing N N 196 PRO CD HD3 sing N N 197 PRO OXT HXT sing N N 198 SER N CA sing N N 199 SER N H sing N N 200 SER N H2 sing N N 201 SER CA C sing N N 202 SER CA CB sing N N 203 SER CA HA sing N N 204 SER C O doub N N 205 SER C OXT sing N N 206 SER CB OG sing N N 207 SER CB HB2 sing N N 208 SER CB HB3 sing N N 209 SER OG HG sing N N 210 SER OXT HXT sing N N 211 THR N CA sing N N 212 THR N H sing N N 213 THR N H2 sing N N 214 THR CA C sing N N 215 THR CA CB sing N N 216 THR CA HA sing N N 217 THR C O doub N N 218 THR C OXT sing N N 219 THR CB OG1 sing N N 220 THR CB CG2 sing N N 221 THR CB HB sing N N 222 THR OG1 HG1 sing N N 223 THR CG2 HG21 sing N N 224 THR CG2 HG22 sing N N 225 THR CG2 HG23 sing N N 226 THR OXT HXT sing N N 227 TYR N CA sing N N 228 TYR N H sing N N 229 TYR N H2 sing N N 230 TYR CA C sing N N 231 TYR CA CB sing N N 232 TYR CA HA sing N N 233 TYR C O doub N N 234 TYR C OXT sing N N 235 TYR CB CG sing N N 236 TYR CB HB2 sing N N 237 TYR CB HB3 sing N N 238 TYR CG CD1 doub Y N 239 TYR CG CD2 sing Y N 240 TYR CD1 CE1 sing Y N 241 TYR CD1 HD1 sing N N 242 TYR CD2 CE2 doub Y N 243 TYR CD2 HD2 sing N N 244 TYR CE1 CZ doub Y N 245 TYR CE1 HE1 sing N N 246 TYR CE2 CZ sing Y N 247 TYR CE2 HE2 sing N N 248 TYR CZ OH sing N N 249 TYR OH HH sing N N 250 TYR OXT HXT sing N N 251 VAL N CA sing N N 252 VAL N H sing N N 253 VAL N H2 sing N N 254 VAL CA C sing N N 255 VAL CA CB sing N N 256 VAL CA HA sing N N 257 VAL C O doub N N 258 VAL C OXT sing N N 259 VAL CB CG1 sing N N 260 VAL CB CG2 sing N N 261 VAL CB HB sing N N 262 VAL CG1 HG11 sing N N 263 VAL CG1 HG12 sing N N 264 VAL CG1 HG13 sing N N 265 VAL CG2 HG21 sing N N 266 VAL CG2 HG22 sing N N 267 VAL CG2 HG23 sing N N 268 VAL OXT HXT sing N N 269 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9KFQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #