data_9KFS # _entry.id 9KFS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9KFS pdb_00009kfs 10.2210/pdb9kfs/pdb WWPDB D_1300053474 ? ? BMRB 36707 ? 10.13018/BMR36707 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-11-12 ? 2 'Structure model' 1 1 2026-05-27 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9KFS _pdbx_database_status.recvd_initial_deposition_date 2024-11-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'A multi cyclic peptide binging to 4-1BB protein' _pdbx_database_related.db_id 36707 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email chlwu@xmu.edu.cn _pdbx_contact_author.name_first wu _pdbx_contact_author.name_last chuanliu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2946-7299 # _audit_author.name 'Liu, H.T.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 147 _citation.language ? _citation.page_first 24870 _citation.page_last 24883 _citation.title 'Proline-Mediated Enhancement in Evolvability of Disulfide-Rich Peptides for Discovering Protein Binders.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.5c07075 _citation.pdbx_database_id_PubMed 40601296 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, H.' 1 ? primary 'Song, L.' 2 ? primary 'Meng, X.' 3 ? primary 'Li, J.' 4 ? primary 'Fan, S.' 5 ? primary 'Dong, H.' 6 ? primary 'Wang, X.' 7 ? primary 'Li, M.' 8 ? primary 'Yu, H.' 9 ? primary 'Tsai, Y.H.' 10 0000-0003-0589-5088 primary 'Yin, Y.' 11 0000-0003-2466-2167 primary 'Wu, C.' 12 0000-0003-2946-7299 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description pCB2 _entity.formula_weight 3635.368 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GCKPKGAPCSPLMYPCCTGPCWDLSLDCSFCVFC _entity_poly.pdbx_seq_one_letter_code_can GCKPKGAPCSPLMYPCCTGPCWDLSLDCSFCVFC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 CYS n 1 3 LYS n 1 4 PRO n 1 5 LYS n 1 6 GLY n 1 7 ALA n 1 8 PRO n 1 9 CYS n 1 10 SER n 1 11 PRO n 1 12 LEU n 1 13 MET n 1 14 TYR n 1 15 PRO n 1 16 CYS n 1 17 CYS n 1 18 THR n 1 19 GLY n 1 20 PRO n 1 21 CYS n 1 22 TRP n 1 23 ASP n 1 24 LEU n 1 25 SER n 1 26 LEU n 1 27 ASP n 1 28 CYS n 1 29 SER n 1 30 PHE n 1 31 CYS n 1 32 VAL n 1 33 PHE n 1 34 CYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 34 _pdbx_entity_src_syn.organism_scientific 'Phage #D' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 77920 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 CYS 34 34 34 CYS CYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9KFS _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9KFS _struct.title 'A multi cyclic peptide binging to 4-1BB protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9KFS _struct_keywords.text 'multi cyclic peptide, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9KFS _struct_ref.pdbx_db_accession 9KFS _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9KFS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9KFS _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 34 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 2 A CYS 21 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 9 A CYS 16 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 17 A CYS 28 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf4 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 31 A CYS 34 1_555 ? ? ? ? ? ? ? 2.039 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 2 ? CYS A 21 ? CYS A 2 ? 1_555 CYS A 21 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 9 ? CYS A 16 ? CYS A 9 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 17 ? CYS A 28 ? CYS A 17 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 31 ? CYS A 34 ? CYS A 31 ? 1_555 CYS A 34 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9KFS _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 5 ? ? -150.48 -44.61 2 1 SER A 10 ? ? -48.04 108.42 3 1 MET A 13 ? ? -141.11 -45.00 4 1 THR A 18 ? ? -98.58 38.11 5 1 TRP A 22 ? ? -146.39 -32.34 6 1 ASP A 23 ? ? 80.51 39.93 7 1 SER A 25 ? ? 168.13 -48.00 8 1 PHE A 33 ? ? -49.97 94.73 9 2 CYS A 2 ? ? -159.00 -55.77 10 2 LEU A 12 ? ? -109.85 -63.90 11 2 THR A 18 ? ? -88.70 43.34 12 2 TRP A 22 ? ? -89.09 -86.39 13 2 SER A 29 ? ? -90.49 -159.53 14 2 PHE A 33 ? ? -48.78 103.36 15 3 CYS A 2 ? ? -171.88 -78.55 16 3 LYS A 5 ? ? -157.59 -24.68 17 3 TYR A 14 ? ? -160.65 117.44 18 3 CYS A 16 ? ? -67.63 90.98 19 3 TRP A 22 ? ? -80.96 -157.45 20 3 ASP A 23 ? ? -88.88 -148.19 21 3 PHE A 33 ? ? -48.70 97.14 22 4 CYS A 2 ? ? -171.38 -73.25 23 4 MET A 13 ? ? 54.65 5.87 24 4 TYR A 14 ? ? -159.34 80.88 25 4 TRP A 22 ? ? -90.38 -124.60 26 4 ASP A 23 ? ? -114.43 -128.28 27 4 SER A 25 ? ? -57.75 -77.65 28 4 PHE A 33 ? ? -51.41 99.13 29 5 CYS A 2 ? ? -175.76 -72.01 30 5 LYS A 5 ? ? -150.35 -31.67 31 5 LEU A 12 ? ? -124.78 -94.42 32 5 MET A 13 ? ? -143.14 21.84 33 5 THR A 18 ? ? -78.58 48.46 34 5 TRP A 22 ? ? -141.73 -76.70 35 5 SER A 29 ? ? -90.74 -157.42 36 5 PHE A 33 ? ? -51.61 103.22 37 6 CYS A 2 ? ? -171.73 -75.65 38 6 TRP A 22 ? ? -59.95 -84.03 39 6 ASP A 23 ? ? 179.61 -136.89 40 6 LEU A 24 ? ? -67.11 8.99 41 6 SER A 25 ? ? -65.40 -74.78 42 6 PHE A 33 ? ? -47.81 95.66 43 7 LYS A 5 ? ? -172.73 142.16 44 7 LEU A 12 ? ? -123.51 -94.05 45 7 TRP A 22 ? ? -135.46 -77.06 46 7 ASP A 23 ? ? -174.32 -152.43 47 7 SER A 29 ? ? -94.74 -150.90 48 7 PHE A 33 ? ? -46.62 95.00 49 8 LEU A 12 ? ? -71.55 -94.71 50 8 MET A 13 ? ? -140.80 -12.68 51 8 TYR A 14 ? ? -118.63 79.57 52 8 SER A 25 ? ? 151.48 -29.91 53 8 SER A 29 ? ? -101.49 -155.34 54 8 PHE A 33 ? ? -49.78 99.76 55 9 CYS A 2 ? ? 52.86 17.74 56 9 MET A 13 ? ? 69.75 -62.83 57 9 CYS A 21 ? ? -115.65 66.54 58 9 SER A 25 ? ? 175.59 -37.40 59 9 SER A 29 ? ? -117.93 -142.38 60 9 PHE A 33 ? ? -48.49 95.21 61 10 CYS A 2 ? ? -165.84 -28.99 62 10 LEU A 12 ? ? -123.49 -95.32 63 10 MET A 13 ? ? -144.76 -39.73 64 10 THR A 18 ? ? -81.35 40.71 65 10 ASP A 23 ? ? 78.09 -9.18 66 10 SER A 25 ? ? -166.16 -167.45 67 10 LEU A 26 ? ? 66.24 168.81 68 10 PHE A 30 ? ? -101.27 76.60 69 10 PHE A 33 ? ? -50.32 93.70 70 11 CYS A 2 ? ? 51.61 14.22 71 11 LEU A 12 ? ? -95.75 -80.41 72 11 MET A 13 ? ? -150.39 -36.23 73 11 TRP A 22 ? ? -145.82 -77.79 74 11 ASP A 23 ? ? -171.35 -158.55 75 11 SER A 29 ? ? -103.64 -134.74 76 11 PHE A 30 ? ? -102.07 73.83 77 11 PHE A 33 ? ? -49.50 93.81 78 12 CYS A 2 ? ? 71.34 -76.24 79 12 THR A 18 ? ? -93.47 55.80 80 12 ASP A 23 ? ? -83.79 48.24 81 12 SER A 25 ? ? 158.27 -27.12 82 12 SER A 29 ? ? -121.35 -142.53 83 12 PHE A 33 ? ? -51.46 94.75 84 13 CYS A 2 ? ? 75.58 -18.00 85 13 LYS A 5 ? ? -176.25 134.11 86 13 LEU A 12 ? ? -123.77 -78.99 87 13 MET A 13 ? ? -155.38 10.87 88 13 ASP A 23 ? ? 73.82 -4.75 89 13 SER A 25 ? ? -146.30 -66.16 90 13 PHE A 30 ? ? -101.78 78.42 91 13 PHE A 33 ? ? -49.17 94.88 92 14 CYS A 2 ? ? 47.09 26.10 93 14 LYS A 5 ? ? -150.72 -62.57 94 14 LEU A 12 ? ? -118.17 -74.50 95 14 MET A 13 ? ? -146.75 -50.36 96 14 THR A 18 ? ? -90.47 56.22 97 14 TRP A 22 ? ? -125.86 -111.08 98 14 ASP A 23 ? ? -162.35 31.99 99 14 SER A 25 ? ? 77.98 -9.55 100 14 PHE A 33 ? ? -46.45 97.00 101 15 CYS A 2 ? ? -146.02 -99.45 102 15 MET A 13 ? ? -151.08 -44.22 103 15 THR A 18 ? ? -78.96 46.56 104 15 TRP A 22 ? ? -73.84 -153.78 105 15 ASP A 23 ? ? -154.96 44.06 106 15 SER A 25 ? ? 167.88 -32.73 107 15 PHE A 33 ? ? -49.02 93.00 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER A 29 ? ? PHE A 30 ? ? -149.71 2 10 VAL A 32 ? ? PHE A 33 ? ? -148.60 # _pdbx_nmr_ensemble.entry_id 9KFS _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9KFS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 15 # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM pCB2, acetone' _pdbx_nmr_sample_details.solvent_system acetone _pdbx_nmr_sample_details.label pCB2 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component pCB2 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label pCB2 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 anisotropic 2 1 1 '2D 1H-15N HSQC' 1 anisotropic 3 1 1 '2D 1H-1H COSY' 1 anisotropic 4 1 1 '2D 1H-1H NOESY' 1 anisotropic 5 1 1 '2D 1H-1H TOCSY' 1 anisotropic # _pdbx_nmr_refine.entry_id 9KFS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Liu hongtan' 2 'structure calculation' ARIA2alpha ? 'Liu hongtan' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Liu hongtan' 4 processing NMRPipe ? 'Liu hongtan' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLY N N N N 44 GLY CA C N N 45 GLY C C N N 46 GLY O O N N 47 GLY OXT O N N 48 GLY H H N N 49 GLY H2 H N N 50 GLY HA2 H N N 51 GLY HA3 H N N 52 GLY HXT H N N 53 LEU N N N N 54 LEU CA C N S 55 LEU C C N N 56 LEU O O N N 57 LEU CB C N N 58 LEU CG C N N 59 LEU CD1 C N N 60 LEU CD2 C N N 61 LEU OXT O N N 62 LEU H H N N 63 LEU H2 H N N 64 LEU HA H N N 65 LEU HB2 H N N 66 LEU HB3 H N N 67 LEU HG H N N 68 LEU HD11 H N N 69 LEU HD12 H N N 70 LEU HD13 H N N 71 LEU HD21 H N N 72 LEU HD22 H N N 73 LEU HD23 H N N 74 LEU HXT H N N 75 LYS N N N N 76 LYS CA C N S 77 LYS C C N N 78 LYS O O N N 79 LYS CB C N N 80 LYS CG C N N 81 LYS CD C N N 82 LYS CE C N N 83 LYS NZ N N N 84 LYS OXT O N N 85 LYS H H N N 86 LYS H2 H N N 87 LYS HA H N N 88 LYS HB2 H N N 89 LYS HB3 H N N 90 LYS HG2 H N N 91 LYS HG3 H N N 92 LYS HD2 H N N 93 LYS HD3 H N N 94 LYS HE2 H N N 95 LYS HE3 H N N 96 LYS HZ1 H N N 97 LYS HZ2 H N N 98 LYS HZ3 H N N 99 LYS HXT H N N 100 MET N N N N 101 MET CA C N S 102 MET C C N N 103 MET O O N N 104 MET CB C N N 105 MET CG C N N 106 MET SD S N N 107 MET CE C N N 108 MET OXT O N N 109 MET H H N N 110 MET H2 H N N 111 MET HA H N N 112 MET HB2 H N N 113 MET HB3 H N N 114 MET HG2 H N N 115 MET HG3 H N N 116 MET HE1 H N N 117 MET HE2 H N N 118 MET HE3 H N N 119 MET HXT H N N 120 PHE N N N N 121 PHE CA C N S 122 PHE C C N N 123 PHE O O N N 124 PHE CB C N N 125 PHE CG C Y N 126 PHE CD1 C Y N 127 PHE CD2 C Y N 128 PHE CE1 C Y N 129 PHE CE2 C Y N 130 PHE CZ C Y N 131 PHE OXT O N N 132 PHE H H N N 133 PHE H2 H N N 134 PHE HA H N N 135 PHE HB2 H N N 136 PHE HB3 H N N 137 PHE HD1 H N N 138 PHE HD2 H N N 139 PHE HE1 H N N 140 PHE HE2 H N N 141 PHE HZ H N N 142 PHE HXT H N N 143 PRO N N N N 144 PRO CA C N S 145 PRO C C N N 146 PRO O O N N 147 PRO CB C N N 148 PRO CG C N N 149 PRO CD C N N 150 PRO OXT O N N 151 PRO H H N N 152 PRO HA H N N 153 PRO HB2 H N N 154 PRO HB3 H N N 155 PRO HG2 H N N 156 PRO HG3 H N N 157 PRO HD2 H N N 158 PRO HD3 H N N 159 PRO HXT H N N 160 SER N N N N 161 SER CA C N S 162 SER C C N N 163 SER O O N N 164 SER CB C N N 165 SER OG O N N 166 SER OXT O N N 167 SER H H N N 168 SER H2 H N N 169 SER HA H N N 170 SER HB2 H N N 171 SER HB3 H N N 172 SER HG H N N 173 SER HXT H N N 174 THR N N N N 175 THR CA C N S 176 THR C C N N 177 THR O O N N 178 THR CB C N R 179 THR OG1 O N N 180 THR CG2 C N N 181 THR OXT O N N 182 THR H H N N 183 THR H2 H N N 184 THR HA H N N 185 THR HB H N N 186 THR HG1 H N N 187 THR HG21 H N N 188 THR HG22 H N N 189 THR HG23 H N N 190 THR HXT H N N 191 TRP N N N N 192 TRP CA C N S 193 TRP C C N N 194 TRP O O N N 195 TRP CB C N N 196 TRP CG C Y N 197 TRP CD1 C Y N 198 TRP CD2 C Y N 199 TRP NE1 N Y N 200 TRP CE2 C Y N 201 TRP CE3 C Y N 202 TRP CZ2 C Y N 203 TRP CZ3 C Y N 204 TRP CH2 C Y N 205 TRP OXT O N N 206 TRP H H N N 207 TRP H2 H N N 208 TRP HA H N N 209 TRP HB2 H N N 210 TRP HB3 H N N 211 TRP HD1 H N N 212 TRP HE1 H N N 213 TRP HE3 H N N 214 TRP HZ2 H N N 215 TRP HZ3 H N N 216 TRP HH2 H N N 217 TRP HXT H N N 218 TYR N N N N 219 TYR CA C N S 220 TYR C C N N 221 TYR O O N N 222 TYR CB C N N 223 TYR CG C Y N 224 TYR CD1 C Y N 225 TYR CD2 C Y N 226 TYR CE1 C Y N 227 TYR CE2 C Y N 228 TYR CZ C Y N 229 TYR OH O N N 230 TYR OXT O N N 231 TYR H H N N 232 TYR H2 H N N 233 TYR HA H N N 234 TYR HB2 H N N 235 TYR HB3 H N N 236 TYR HD1 H N N 237 TYR HD2 H N N 238 TYR HE1 H N N 239 TYR HE2 H N N 240 TYR HH H N N 241 TYR HXT H N N 242 VAL N N N N 243 VAL CA C N S 244 VAL C C N N 245 VAL O O N N 246 VAL CB C N N 247 VAL CG1 C N N 248 VAL CG2 C N N 249 VAL OXT O N N 250 VAL H H N N 251 VAL H2 H N N 252 VAL HA H N N 253 VAL HB H N N 254 VAL HG11 H N N 255 VAL HG12 H N N 256 VAL HG13 H N N 257 VAL HG21 H N N 258 VAL HG22 H N N 259 VAL HG23 H N N 260 VAL HXT H N N 261 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLY N CA sing N N 41 GLY N H sing N N 42 GLY N H2 sing N N 43 GLY CA C sing N N 44 GLY CA HA2 sing N N 45 GLY CA HA3 sing N N 46 GLY C O doub N N 47 GLY C OXT sing N N 48 GLY OXT HXT sing N N 49 LEU N CA sing N N 50 LEU N H sing N N 51 LEU N H2 sing N N 52 LEU CA C sing N N 53 LEU CA CB sing N N 54 LEU CA HA sing N N 55 LEU C O doub N N 56 LEU C OXT sing N N 57 LEU CB CG sing N N 58 LEU CB HB2 sing N N 59 LEU CB HB3 sing N N 60 LEU CG CD1 sing N N 61 LEU CG CD2 sing N N 62 LEU CG HG sing N N 63 LEU CD1 HD11 sing N N 64 LEU CD1 HD12 sing N N 65 LEU CD1 HD13 sing N N 66 LEU CD2 HD21 sing N N 67 LEU CD2 HD22 sing N N 68 LEU CD2 HD23 sing N N 69 LEU OXT HXT sing N N 70 LYS N CA sing N N 71 LYS N H sing N N 72 LYS N H2 sing N N 73 LYS CA C sing N N 74 LYS CA CB sing N N 75 LYS CA HA sing N N 76 LYS C O doub N N 77 LYS C OXT sing N N 78 LYS CB CG sing N N 79 LYS CB HB2 sing N N 80 LYS CB HB3 sing N N 81 LYS CG CD sing N N 82 LYS CG HG2 sing N N 83 LYS CG HG3 sing N N 84 LYS CD CE sing N N 85 LYS CD HD2 sing N N 86 LYS CD HD3 sing N N 87 LYS CE NZ sing N N 88 LYS CE HE2 sing N N 89 LYS CE HE3 sing N N 90 LYS NZ HZ1 sing N N 91 LYS NZ HZ2 sing N N 92 LYS NZ HZ3 sing N N 93 LYS OXT HXT sing N N 94 MET N CA sing N N 95 MET N H sing N N 96 MET N H2 sing N N 97 MET CA C sing N N 98 MET CA CB sing N N 99 MET CA HA sing N N 100 MET C O doub N N 101 MET C OXT sing N N 102 MET CB CG sing N N 103 MET CB HB2 sing N N 104 MET CB HB3 sing N N 105 MET CG SD sing N N 106 MET CG HG2 sing N N 107 MET CG HG3 sing N N 108 MET SD CE sing N N 109 MET CE HE1 sing N N 110 MET CE HE2 sing N N 111 MET CE HE3 sing N N 112 MET OXT HXT sing N N 113 PHE N CA sing N N 114 PHE N H sing N N 115 PHE N H2 sing N N 116 PHE CA C sing N N 117 PHE CA CB sing N N 118 PHE CA HA sing N N 119 PHE C O doub N N 120 PHE C OXT sing N N 121 PHE CB CG sing N N 122 PHE CB HB2 sing N N 123 PHE CB HB3 sing N N 124 PHE CG CD1 doub Y N 125 PHE CG CD2 sing Y N 126 PHE CD1 CE1 sing Y N 127 PHE CD1 HD1 sing N N 128 PHE CD2 CE2 doub Y N 129 PHE CD2 HD2 sing N N 130 PHE CE1 CZ doub Y N 131 PHE CE1 HE1 sing N N 132 PHE CE2 CZ sing Y N 133 PHE CE2 HE2 sing N N 134 PHE CZ HZ sing N N 135 PHE OXT HXT sing N N 136 PRO N CA sing N N 137 PRO N CD sing N N 138 PRO N H sing N N 139 PRO CA C sing N N 140 PRO CA CB sing N N 141 PRO CA HA sing N N 142 PRO C O doub N N 143 PRO C OXT sing N N 144 PRO CB CG sing N N 145 PRO CB HB2 sing N N 146 PRO CB HB3 sing N N 147 PRO CG CD sing N N 148 PRO CG HG2 sing N N 149 PRO CG HG3 sing N N 150 PRO CD HD2 sing N N 151 PRO CD HD3 sing N N 152 PRO OXT HXT sing N N 153 SER N CA sing N N 154 SER N H sing N N 155 SER N H2 sing N N 156 SER CA C sing N N 157 SER CA CB sing N N 158 SER CA HA sing N N 159 SER C O doub N N 160 SER C OXT sing N N 161 SER CB OG sing N N 162 SER CB HB2 sing N N 163 SER CB HB3 sing N N 164 SER OG HG sing N N 165 SER OXT HXT sing N N 166 THR N CA sing N N 167 THR N H sing N N 168 THR N H2 sing N N 169 THR CA C sing N N 170 THR CA CB sing N N 171 THR CA HA sing N N 172 THR C O doub N N 173 THR C OXT sing N N 174 THR CB OG1 sing N N 175 THR CB CG2 sing N N 176 THR CB HB sing N N 177 THR OG1 HG1 sing N N 178 THR CG2 HG21 sing N N 179 THR CG2 HG22 sing N N 180 THR CG2 HG23 sing N N 181 THR OXT HXT sing N N 182 TRP N CA sing N N 183 TRP N H sing N N 184 TRP N H2 sing N N 185 TRP CA C sing N N 186 TRP CA CB sing N N 187 TRP CA HA sing N N 188 TRP C O doub N N 189 TRP C OXT sing N N 190 TRP CB CG sing N N 191 TRP CB HB2 sing N N 192 TRP CB HB3 sing N N 193 TRP CG CD1 doub Y N 194 TRP CG CD2 sing Y N 195 TRP CD1 NE1 sing Y N 196 TRP CD1 HD1 sing N N 197 TRP CD2 CE2 doub Y N 198 TRP CD2 CE3 sing Y N 199 TRP NE1 CE2 sing Y N 200 TRP NE1 HE1 sing N N 201 TRP CE2 CZ2 sing Y N 202 TRP CE3 CZ3 doub Y N 203 TRP CE3 HE3 sing N N 204 TRP CZ2 CH2 doub Y N 205 TRP CZ2 HZ2 sing N N 206 TRP CZ3 CH2 sing Y N 207 TRP CZ3 HZ3 sing N N 208 TRP CH2 HH2 sing N N 209 TRP OXT HXT sing N N 210 TYR N CA sing N N 211 TYR N H sing N N 212 TYR N H2 sing N N 213 TYR CA C sing N N 214 TYR CA CB sing N N 215 TYR CA HA sing N N 216 TYR C O doub N N 217 TYR C OXT sing N N 218 TYR CB CG sing N N 219 TYR CB HB2 sing N N 220 TYR CB HB3 sing N N 221 TYR CG CD1 doub Y N 222 TYR CG CD2 sing Y N 223 TYR CD1 CE1 sing Y N 224 TYR CD1 HD1 sing N N 225 TYR CD2 CE2 doub Y N 226 TYR CD2 HD2 sing N N 227 TYR CE1 CZ doub Y N 228 TYR CE1 HE1 sing N N 229 TYR CE2 CZ sing Y N 230 TYR CE2 HE2 sing N N 231 TYR CZ OH sing N N 232 TYR OH HH sing N N 233 TYR OXT HXT sing N N 234 VAL N CA sing N N 235 VAL N H sing N N 236 VAL N H2 sing N N 237 VAL CA C sing N N 238 VAL CA CB sing N N 239 VAL CA HA sing N N 240 VAL C O doub N N 241 VAL C OXT sing N N 242 VAL CB CG1 sing N N 243 VAL CB CG2 sing N N 244 VAL CB HB sing N N 245 VAL CG1 HG11 sing N N 246 VAL CG1 HG12 sing N N 247 VAL CG1 HG13 sing N N 248 VAL CG2 HG21 sing N N 249 VAL CG2 HG22 sing N N 250 VAL CG2 HG23 sing N N 251 VAL OXT HXT sing N N 252 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9KFS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #