data_9KVL # _entry.id 9KVL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9KVL pdb_00009kvl 10.2210/pdb9kvl/pdb WWPDB D_1300054424 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-06-11 ? 2 'Structure model' 1 1 2025-07-02 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation.journal_volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9KVL _pdbx_database_status.recvd_initial_deposition_date 2024-12-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email y_fukuda@phs.osaka-u.ac.jp _pdbx_contact_author.name_first Yohta _pdbx_contact_author.name_last Fukuda _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7386-8201 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fukuda, Y.' 1 0000-0002-7386-8201 'Lintuluoto, M.' 2 ? 'Hirano, Y.' 3 ? 'Kusaka, K.' 4 ? 'Inoue, T.' 5 ? 'Tamada, T.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 301 _citation.language ? _citation.page_first 110290 _citation.page_last 110290 _citation.title 'Structural basis of cuproenzyme nitrite reduction at the level of a single hydrogen atom.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2025.110290 _citation.pdbx_database_id_PubMed 40436316 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fukuda, Y.' 1 ? primary 'Lintuluoto, M.' 2 ? primary 'Hirano, Y.' 3 ? primary 'Kusaka, K.' 4 ? primary 'Inoue, T.' 5 ? primary 'Tamada, T.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Copper-containing nitrite reductase' 33071.500 1 1.7.2.1 C135A ? ? 2 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 3 non-polymer syn '(4R)-2-METHYLPENTANE-2,4-DIOL' 118.174 1 ? ? ? ? 4 non-polymer syn 'NITRITE ION' 46.005 1 ? ? ? ? 5 non-polymer nat 'COPPER (II) ION' 63.546 3 ? ? ? ? 6 water nat water 18.015 336 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPH SMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHAGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQN EWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYL DGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED ; _entity_poly.pdbx_seq_one_letter_code_can ;NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPH SMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHAGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQN EWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYL DGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 3 '(4R)-2-METHYLPENTANE-2,4-DIOL' MRD 4 'NITRITE ION' NO2 5 'COPPER (II) ION' CU 6 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 VAL n 1 3 ILE n 1 4 ALA n 1 5 ALA n 1 6 HIS n 1 7 LYS n 1 8 GLY n 1 9 VAL n 1 10 ASN n 1 11 GLN n 1 12 ALA n 1 13 PRO n 1 14 VAL n 1 15 PRO n 1 16 LEU n 1 17 LYS n 1 18 MET n 1 19 GLU n 1 20 ARG n 1 21 VAL n 1 22 GLY n 1 23 PRO n 1 24 HIS n 1 25 ASP n 1 26 VAL n 1 27 HIS n 1 28 ILE n 1 29 GLU n 1 30 MET n 1 31 THR n 1 32 ALA n 1 33 GLN n 1 34 ILE n 1 35 THR n 1 36 ASP n 1 37 ILE n 1 38 GLU n 1 39 ILE n 1 40 ASP n 1 41 LYS n 1 42 GLY n 1 43 LYS n 1 44 ILE n 1 45 TYR n 1 46 LYS n 1 47 ALA n 1 48 TRP n 1 49 THR n 1 50 PHE n 1 51 ASN n 1 52 GLY n 1 53 GLN n 1 54 ALA n 1 55 PRO n 1 56 GLY n 1 57 PRO n 1 58 LEU n 1 59 VAL n 1 60 VAL n 1 61 VAL n 1 62 ASN n 1 63 GLU n 1 64 GLY n 1 65 ASP n 1 66 THR n 1 67 ILE n 1 68 HIS n 1 69 PHE n 1 70 THR n 1 71 LEU n 1 72 LYS n 1 73 ASN n 1 74 MET n 1 75 ASP n 1 76 PRO n 1 77 VAL n 1 78 VAL n 1 79 PRO n 1 80 HIS n 1 81 SER n 1 82 MET n 1 83 ASP n 1 84 PHE n 1 85 HIS n 1 86 ALA n 1 87 VAL n 1 88 HIS n 1 89 ALA n 1 90 SER n 1 91 PRO n 1 92 SER n 1 93 LYS n 1 94 ASP n 1 95 PHE n 1 96 ILE n 1 97 ASP n 1 98 VAL n 1 99 MET n 1 100 PRO n 1 101 ASN n 1 102 LYS n 1 103 SER n 1 104 GLY n 1 105 THR n 1 106 PHE n 1 107 THR n 1 108 TYR n 1 109 PRO n 1 110 ALA n 1 111 ASN n 1 112 LYS n 1 113 PRO n 1 114 GLY n 1 115 VAL n 1 116 PHE n 1 117 MET n 1 118 TYR n 1 119 HIS n 1 120 ALA n 1 121 GLY n 1 122 THR n 1 123 LYS n 1 124 PRO n 1 125 VAL n 1 126 LEU n 1 127 GLN n 1 128 HIS n 1 129 ILE n 1 130 ALA n 1 131 ASN n 1 132 GLY n 1 133 MET n 1 134 HIS n 1 135 GLY n 1 136 VAL n 1 137 ILE n 1 138 ILE n 1 139 VAL n 1 140 LYS n 1 141 PRO n 1 142 LYS n 1 143 ASN n 1 144 GLY n 1 145 TYR n 1 146 PRO n 1 147 THR n 1 148 ASP n 1 149 LYS n 1 150 GLU n 1 151 VAL n 1 152 ASP n 1 153 ARG n 1 154 GLU n 1 155 TYR n 1 156 VAL n 1 157 LEU n 1 158 ILE n 1 159 GLN n 1 160 ASN n 1 161 GLU n 1 162 TRP n 1 163 TYR n 1 164 LYS n 1 165 TYR n 1 166 ASN n 1 167 ASP n 1 168 MET n 1 169 ASN n 1 170 ASP n 1 171 PHE n 1 172 GLN n 1 173 ASN n 1 174 GLY n 1 175 VAL n 1 176 PRO n 1 177 SER n 1 178 TYR n 1 179 VAL n 1 180 VAL n 1 181 PHE n 1 182 SER n 1 183 SER n 1 184 LYS n 1 185 ALA n 1 186 LEU n 1 187 LYS n 1 188 PRO n 1 189 GLY n 1 190 ASP n 1 191 PRO n 1 192 ASN n 1 193 THR n 1 194 ASN n 1 195 GLY n 1 196 ASP n 1 197 THR n 1 198 PHE n 1 199 THR n 1 200 LEU n 1 201 LYS n 1 202 GLU n 1 203 LYS n 1 204 PRO n 1 205 LEU n 1 206 LEU n 1 207 ALA n 1 208 LYS n 1 209 VAL n 1 210 GLY n 1 211 GLU n 1 212 LYS n 1 213 ILE n 1 214 ARG n 1 215 LEU n 1 216 TYR n 1 217 ILE n 1 218 ASN n 1 219 ASN n 1 220 VAL n 1 221 GLY n 1 222 PRO n 1 223 ASN n 1 224 GLU n 1 225 VAL n 1 226 SER n 1 227 SER n 1 228 PHE n 1 229 HIS n 1 230 VAL n 1 231 VAL n 1 232 GLY n 1 233 THR n 1 234 VAL n 1 235 PHE n 1 236 ASP n 1 237 ASP n 1 238 VAL n 1 239 TYR n 1 240 LEU n 1 241 ASP n 1 242 GLY n 1 243 ASN n 1 244 PRO n 1 245 ASN n 1 246 ASN n 1 247 HIS n 1 248 LEU n 1 249 GLN n 1 250 GLY n 1 251 MET n 1 252 GLN n 1 253 THR n 1 254 VAL n 1 255 MET n 1 256 LEU n 1 257 PRO n 1 258 ALA n 1 259 SER n 1 260 GLY n 1 261 GLY n 1 262 ALA n 1 263 VAL n 1 264 VAL n 1 265 GLU n 1 266 PHE n 1 267 THR n 1 268 VAL n 1 269 THR n 1 270 ARG n 1 271 PRO n 1 272 GLY n 1 273 THR n 1 274 TYR n 1 275 PRO n 1 276 ILE n 1 277 VAL n 1 278 THR n 1 279 HIS n 1 280 GLN n 1 281 PHE n 1 282 ASN n 1 283 HIS n 1 284 ALA n 1 285 GLN n 1 286 LYS n 1 287 GLY n 1 288 ALA n 1 289 VAL n 1 290 ALA n 1 291 MET n 1 292 LEU n 1 293 LYS n 1 294 VAL n 1 295 THR n 1 296 GLU n 1 297 THR n 1 298 GLY n 1 299 GLU n 1 300 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 300 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nirK, GTNG_0650' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus thermodenitrificans NG80-2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 420246 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 MRD non-polymer . '(4R)-2-METHYLPENTANE-2,4-DIOL' ? 'C6 H14 O2' 118.174 NO2 non-polymer . 'NITRITE ION' ? 'N O2 -1' 46.005 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 16 16 ASN ASN A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 ILE 3 18 18 ILE ILE A . n A 1 4 ALA 4 19 19 ALA ALA A . n A 1 5 ALA 5 20 20 ALA ALA A . n A 1 6 HIS 6 21 21 HIS HIS A . n A 1 7 LYS 7 22 22 LYS LYS A . n A 1 8 GLY 8 23 23 GLY GLY A . n A 1 9 VAL 9 24 24 VAL VAL A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 GLN 11 26 26 GLN GLN A . n A 1 12 ALA 12 27 27 ALA ALA A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 VAL 14 29 29 VAL VAL A . n A 1 15 PRO 15 30 30 PRO PRO A . n A 1 16 LEU 16 31 31 LEU LEU A . n A 1 17 LYS 17 32 32 LYS LYS A . n A 1 18 MET 18 33 33 MET MET A . n A 1 19 GLU 19 34 34 GLU GLU A . n A 1 20 ARG 20 35 35 ARG ARG A . n A 1 21 VAL 21 36 36 VAL VAL A . n A 1 22 GLY 22 37 37 GLY GLY A . n A 1 23 PRO 23 38 38 PRO PRO A . n A 1 24 HIS 24 39 39 HIS HIS A . n A 1 25 ASP 25 40 40 ASP ASP A . n A 1 26 VAL 26 41 41 VAL VAL A . n A 1 27 HIS 27 42 42 HIS HIS A . n A 1 28 ILE 28 43 43 ILE ILE A . n A 1 29 GLU 29 44 44 GLU GLU A . n A 1 30 MET 30 45 45 MET MET A . n A 1 31 THR 31 46 46 THR THR A . n A 1 32 ALA 32 47 47 ALA ALA A . n A 1 33 GLN 33 48 48 GLN GLN A . n A 1 34 ILE 34 49 49 ILE ILE A . n A 1 35 THR 35 50 50 THR THR A . n A 1 36 ASP 36 51 51 ASP ASP A . n A 1 37 ILE 37 52 52 ILE ILE A . n A 1 38 GLU 38 53 53 GLU GLU A . n A 1 39 ILE 39 54 54 ILE ILE A . n A 1 40 ASP 40 55 55 ASP ASP A . n A 1 41 LYS 41 56 56 LYS LYS A . n A 1 42 GLY 42 57 57 GLY GLY A . n A 1 43 LYS 43 58 58 LYS LYS A . n A 1 44 ILE 44 59 59 ILE ILE A . n A 1 45 TYR 45 60 60 TYR TYR A . n A 1 46 LYS 46 61 61 LYS LYS A . n A 1 47 ALA 47 62 62 ALA ALA A . n A 1 48 TRP 48 63 63 TRP TRP A . n A 1 49 THR 49 64 64 THR THR A . n A 1 50 PHE 50 65 65 PHE PHE A . n A 1 51 ASN 51 66 66 ASN ASN A . n A 1 52 GLY 52 67 67 GLY GLY A . n A 1 53 GLN 53 68 68 GLN GLN A . n A 1 54 ALA 54 69 69 ALA ALA A . n A 1 55 PRO 55 70 70 PRO PRO A . n A 1 56 GLY 56 71 71 GLY GLY A . n A 1 57 PRO 57 72 72 PRO PRO A . n A 1 58 LEU 58 73 73 LEU LEU A . n A 1 59 VAL 59 74 74 VAL VAL A . n A 1 60 VAL 60 75 75 VAL VAL A . n A 1 61 VAL 61 76 76 VAL VAL A . n A 1 62 ASN 62 77 77 ASN ASN A . n A 1 63 GLU 63 78 78 GLU GLU A . n A 1 64 GLY 64 79 79 GLY GLY A . n A 1 65 ASP 65 80 80 ASP ASP A . n A 1 66 THR 66 81 81 THR THR A . n A 1 67 ILE 67 82 82 ILE ILE A . n A 1 68 HIS 68 83 83 HIS HIS A . n A 1 69 PHE 69 84 84 PHE PHE A . n A 1 70 THR 70 85 85 THR THR A . n A 1 71 LEU 71 86 86 LEU LEU A . n A 1 72 LYS 72 87 87 LYS LYS A . n A 1 73 ASN 73 88 88 ASN ASN A . n A 1 74 MET 74 89 89 MET MET A . n A 1 75 ASP 75 90 90 ASP ASP A . n A 1 76 PRO 76 91 91 PRO PRO A . n A 1 77 VAL 77 92 92 VAL VAL A . n A 1 78 VAL 78 93 93 VAL VAL A . n A 1 79 PRO 79 94 94 PRO PRO A . n A 1 80 HIS 80 95 95 HIS HIS A . n A 1 81 SER 81 96 96 SER SER A . n A 1 82 MET 82 97 97 MET MET A . n A 1 83 ASP 83 98 98 ASP ASP A . n A 1 84 PHE 84 99 99 PHE PHE A . n A 1 85 HIS 85 100 100 HIS HIS A . n A 1 86 ALA 86 101 101 ALA ALA A . n A 1 87 VAL 87 102 102 VAL VAL A . n A 1 88 HIS 88 103 103 HIS HIS A . n A 1 89 ALA 89 104 104 ALA ALA A . n A 1 90 SER 90 105 105 SER SER A . n A 1 91 PRO 91 106 106 PRO PRO A . n A 1 92 SER 92 107 107 SER SER A . n A 1 93 LYS 93 108 108 LYS LYS A . n A 1 94 ASP 94 109 109 ASP ASP A . n A 1 95 PHE 95 110 110 PHE PHE A . n A 1 96 ILE 96 111 111 ILE ILE A . n A 1 97 ASP 97 112 112 ASP ASP A . n A 1 98 VAL 98 113 113 VAL VAL A . n A 1 99 MET 99 114 114 MET MET A . n A 1 100 PRO 100 115 115 PRO PRO A . n A 1 101 ASN 101 116 116 ASN ASN A . n A 1 102 LYS 102 117 117 LYS LYS A . n A 1 103 SER 103 118 118 SER SER A . n A 1 104 GLY 104 119 119 GLY GLY A . n A 1 105 THR 105 120 120 THR THR A . n A 1 106 PHE 106 121 121 PHE PHE A . n A 1 107 THR 107 122 122 THR THR A . n A 1 108 TYR 108 123 123 TYR TYR A . n A 1 109 PRO 109 124 124 PRO PRO A . n A 1 110 ALA 110 125 125 ALA ALA A . n A 1 111 ASN 111 126 126 ASN ASN A . n A 1 112 LYS 112 127 127 LYS LYS A . n A 1 113 PRO 113 128 128 PRO PRO A . n A 1 114 GLY 114 129 129 GLY GLY A . n A 1 115 VAL 115 130 130 VAL VAL A . n A 1 116 PHE 116 131 131 PHE PHE A . n A 1 117 MET 117 132 132 MET MET A . n A 1 118 TYR 118 133 133 TYR TYR A . n A 1 119 HIS 119 134 134 HIS HIS A . n A 1 120 ALA 120 135 135 ALA ALA A . n A 1 121 GLY 121 136 136 GLY GLY A . n A 1 122 THR 122 137 137 THR THR A . n A 1 123 LYS 123 138 138 LYS LYS A . n A 1 124 PRO 124 139 139 PRO PRO A . n A 1 125 VAL 125 140 140 VAL VAL A . n A 1 126 LEU 126 141 141 LEU LEU A . n A 1 127 GLN 127 142 142 GLN GLN A . n A 1 128 HIS 128 143 143 HIS HIS A . n A 1 129 ILE 129 144 144 ILE ILE A . n A 1 130 ALA 130 145 145 ALA ALA A . n A 1 131 ASN 131 146 146 ASN ASN A . n A 1 132 GLY 132 147 147 GLY GLY A . n A 1 133 MET 133 148 148 MET MET A . n A 1 134 HIS 134 149 149 HIS HIS A . n A 1 135 GLY 135 150 150 GLY GLY A . n A 1 136 VAL 136 151 151 VAL VAL A . n A 1 137 ILE 137 152 152 ILE ILE A . n A 1 138 ILE 138 153 153 ILE ILE A . n A 1 139 VAL 139 154 154 VAL VAL A . n A 1 140 LYS 140 155 155 LYS LYS A . n A 1 141 PRO 141 156 156 PRO PRO A . n A 1 142 LYS 142 157 157 LYS LYS A . n A 1 143 ASN 143 158 158 ASN ASN A . n A 1 144 GLY 144 159 159 GLY GLY A . n A 1 145 TYR 145 160 160 TYR TYR A . n A 1 146 PRO 146 161 161 PRO PRO A . n A 1 147 THR 147 162 162 THR THR A . n A 1 148 ASP 148 163 163 ASP ASP A . n A 1 149 LYS 149 164 164 LYS LYS A . n A 1 150 GLU 150 165 165 GLU GLU A . n A 1 151 VAL 151 166 166 VAL VAL A . n A 1 152 ASP 152 167 167 ASP ASP A . n A 1 153 ARG 153 168 168 ARG ARG A . n A 1 154 GLU 154 169 169 GLU GLU A . n A 1 155 TYR 155 170 170 TYR TYR A . n A 1 156 VAL 156 171 171 VAL VAL A . n A 1 157 LEU 157 172 172 LEU LEU A . n A 1 158 ILE 158 173 173 ILE ILE A . n A 1 159 GLN 159 174 174 GLN GLN A . n A 1 160 ASN 160 175 175 ASN ASN A . n A 1 161 GLU 161 176 176 GLU GLU A . n A 1 162 TRP 162 177 177 TRP TRP A . n A 1 163 TYR 163 178 178 TYR TYR A . n A 1 164 LYS 164 179 179 LYS LYS A . n A 1 165 TYR 165 180 180 TYR TYR A . n A 1 166 ASN 166 181 181 ASN ASN A . n A 1 167 ASP 167 182 182 ASP ASP A . n A 1 168 MET 168 183 183 MET MET A . n A 1 169 ASN 169 184 184 ASN ASN A . n A 1 170 ASP 170 185 185 ASP ASP A . n A 1 171 PHE 171 186 186 PHE PHE A . n A 1 172 GLN 172 187 187 GLN GLN A . n A 1 173 ASN 173 188 188 ASN ASN A . n A 1 174 GLY 174 189 189 GLY GLY A . n A 1 175 VAL 175 190 190 VAL VAL A . n A 1 176 PRO 176 191 191 PRO PRO A . n A 1 177 SER 177 192 192 SER SER A . n A 1 178 TYR 178 193 193 TYR TYR A . n A 1 179 VAL 179 194 194 VAL VAL A . n A 1 180 VAL 180 195 195 VAL VAL A . n A 1 181 PHE 181 196 196 PHE PHE A . n A 1 182 SER 182 197 197 SER SER A . n A 1 183 SER 183 198 198 SER SER A . n A 1 184 LYS 184 199 199 LYS LYS A . n A 1 185 ALA 185 200 200 ALA ALA A . n A 1 186 LEU 186 201 201 LEU LEU A . n A 1 187 LYS 187 202 202 LYS LYS A . n A 1 188 PRO 188 203 203 PRO PRO A . n A 1 189 GLY 189 204 204 GLY GLY A . n A 1 190 ASP 190 205 205 ASP ASP A . n A 1 191 PRO 191 206 206 PRO PRO A . n A 1 192 ASN 192 207 207 ASN ASN A . n A 1 193 THR 193 208 208 THR THR A . n A 1 194 ASN 194 209 209 ASN ASN A . n A 1 195 GLY 195 210 210 GLY GLY A . n A 1 196 ASP 196 211 211 ASP ASP A . n A 1 197 THR 197 212 212 THR THR A . n A 1 198 PHE 198 213 213 PHE PHE A . n A 1 199 THR 199 214 214 THR THR A . n A 1 200 LEU 200 215 215 LEU LEU A . n A 1 201 LYS 201 216 216 LYS LYS A . n A 1 202 GLU 202 217 217 GLU GLU A . n A 1 203 LYS 203 218 218 LYS LYS A . n A 1 204 PRO 204 219 219 PRO PRO A . n A 1 205 LEU 205 220 220 LEU LEU A . n A 1 206 LEU 206 221 221 LEU LEU A . n A 1 207 ALA 207 222 222 ALA ALA A . n A 1 208 LYS 208 223 223 LYS LYS A . n A 1 209 VAL 209 224 224 VAL VAL A . n A 1 210 GLY 210 225 225 GLY GLY A . n A 1 211 GLU 211 226 226 GLU GLU A . n A 1 212 LYS 212 227 227 LYS LYS A . n A 1 213 ILE 213 228 228 ILE ILE A . n A 1 214 ARG 214 229 229 ARG ARG A . n A 1 215 LEU 215 230 230 LEU LEU A . n A 1 216 TYR 216 231 231 TYR TYR A . n A 1 217 ILE 217 232 232 ILE ILE A . n A 1 218 ASN 218 233 233 ASN ASN A . n A 1 219 ASN 219 234 234 ASN ASN A . n A 1 220 VAL 220 235 235 VAL VAL A . n A 1 221 GLY 221 236 236 GLY GLY A . n A 1 222 PRO 222 237 237 PRO PRO A . n A 1 223 ASN 223 238 238 ASN ASN A . n A 1 224 GLU 224 239 239 GLU GLU A . n A 1 225 VAL 225 240 240 VAL VAL A . n A 1 226 SER 226 241 241 SER SER A . n A 1 227 SER 227 242 242 SER SER A . n A 1 228 PHE 228 243 243 PHE PHE A . n A 1 229 HIS 229 244 244 HIS HIS A . n A 1 230 VAL 230 245 245 VAL VAL A . n A 1 231 VAL 231 246 246 VAL VAL A . n A 1 232 GLY 232 247 247 GLY GLY A . n A 1 233 THR 233 248 248 THR THR A . n A 1 234 VAL 234 249 249 VAL VAL A . n A 1 235 PHE 235 250 250 PHE PHE A . n A 1 236 ASP 236 251 251 ASP ASP A . n A 1 237 ASP 237 252 252 ASP ASP A . n A 1 238 VAL 238 253 253 VAL VAL A . n A 1 239 TYR 239 254 254 TYR TYR A . n A 1 240 LEU 240 255 255 LEU LEU A . n A 1 241 ASP 241 256 256 ASP ASP A . n A 1 242 GLY 242 257 257 GLY GLY A . n A 1 243 ASN 243 258 258 ASN ASN A . n A 1 244 PRO 244 259 259 PRO PRO A . n A 1 245 ASN 245 260 260 ASN ASN A . n A 1 246 ASN 246 261 261 ASN ASN A . n A 1 247 HIS 247 262 262 HIS HIS A . n A 1 248 LEU 248 263 263 LEU LEU A . n A 1 249 GLN 249 264 264 GLN GLN A . n A 1 250 GLY 250 265 265 GLY GLY A . n A 1 251 MET 251 266 266 MET MET A . n A 1 252 GLN 252 267 267 GLN GLN A . n A 1 253 THR 253 268 268 THR THR A . n A 1 254 VAL 254 269 269 VAL VAL A . n A 1 255 MET 255 270 270 MET MET A . n A 1 256 LEU 256 271 271 LEU LEU A . n A 1 257 PRO 257 272 272 PRO PRO A . n A 1 258 ALA 258 273 273 ALA ALA A . n A 1 259 SER 259 274 274 SER SER A . n A 1 260 GLY 260 275 275 GLY GLY A . n A 1 261 GLY 261 276 276 GLY GLY A . n A 1 262 ALA 262 277 277 ALA ALA A . n A 1 263 VAL 263 278 278 VAL VAL A . n A 1 264 VAL 264 279 279 VAL VAL A . n A 1 265 GLU 265 280 280 GLU GLU A . n A 1 266 PHE 266 281 281 PHE PHE A . n A 1 267 THR 267 282 282 THR THR A . n A 1 268 VAL 268 283 283 VAL VAL A . n A 1 269 THR 269 284 284 THR THR A . n A 1 270 ARG 270 285 285 ARG ARG A . n A 1 271 PRO 271 286 286 PRO PRO A . n A 1 272 GLY 272 287 287 GLY GLY A . n A 1 273 THR 273 288 288 THR THR A . n A 1 274 TYR 274 289 289 TYR TYR A . n A 1 275 PRO 275 290 290 PRO PRO A . n A 1 276 ILE 276 291 291 ILE ILE A . n A 1 277 VAL 277 292 292 VAL VAL A . n A 1 278 THR 278 293 293 THR THR A . n A 1 279 HIS 279 294 294 HIS HIS A . n A 1 280 GLN 280 295 295 GLN GLN A . n A 1 281 PHE 281 296 296 PHE PHE A . n A 1 282 ASN 282 297 297 ASN ASN A . n A 1 283 HIS 283 298 298 HIS HIS A . n A 1 284 ALA 284 299 299 ALA ALA A . n A 1 285 GLN 285 300 300 GLN GLN A . n A 1 286 LYS 286 301 301 LYS LYS A . n A 1 287 GLY 287 302 302 GLY GLY A . n A 1 288 ALA 288 303 303 ALA ALA A . n A 1 289 VAL 289 304 304 VAL VAL A . n A 1 290 ALA 290 305 305 ALA ALA A . n A 1 291 MET 291 306 306 MET MET A . n A 1 292 LEU 292 307 307 LEU LEU A . n A 1 293 LYS 293 308 308 LYS LYS A . n A 1 294 VAL 294 309 309 VAL VAL A . n A 1 295 THR 295 310 310 THR THR A . n A 1 296 GLU 296 311 311 GLU GLU A . n A 1 297 THR 297 312 312 THR THR A . n A 1 298 GLY 298 313 313 GLY GLY A . n A 1 299 GLU 299 314 314 GLU GLU A . n A 1 300 ASP 300 315 315 ASP ASP A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 NO2 ? ? NO2 ? ? 'SUBJECT OF INVESTIGATION' ? 2 CU ? ? CU ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MPD 1 501 501 MPD MPD A . C 3 MRD 1 502 502 MRD MRD A . D 4 NO2 1 503 601 NO2 NO2 A . E 5 CU 1 504 701 CU CU A . F 5 CU 1 505 702 CU CU A . G 5 CU 1 506 703 CU CU A . H 6 DOD 1 601 184 DOD DOD A . H 6 DOD 2 602 284 DOD DOD A . H 6 DOD 3 603 129 DOD DOD A . H 6 DOD 4 604 182 DOD DOD A . H 6 DOD 5 605 162 DOD DOD A . H 6 DOD 6 606 293 DOD DOD A . H 6 DOD 7 607 302 DOD DOD A . H 6 DOD 8 608 207 DOD DOD A . H 6 DOD 9 609 299 DOD DOD A . H 6 DOD 10 610 194 DOD DOD A . H 6 DOD 11 611 303 DOD DOD A . H 6 DOD 12 612 316 DOD DOD A . H 6 DOD 13 613 274 DOD DOD A . H 6 DOD 14 614 190 DOD DOD A . H 6 DOD 15 615 319 DOD DOD A . H 6 DOD 16 616 286 DOD DOD A . H 6 DOD 17 617 185 DOD DOD A . H 6 DOD 18 618 278 DOD DOD A . H 6 DOD 19 619 73 DOD DOD A . H 6 DOD 20 620 320 DOD DOD A . H 6 DOD 21 621 240 DOD DOD A . H 6 DOD 22 622 306 DOD DOD A . H 6 DOD 23 623 150 DOD DOD A . H 6 DOD 24 624 23 DOD DOD A . H 6 DOD 25 625 197 DOD DOD A . H 6 DOD 26 626 171 DOD DOD A . H 6 DOD 27 627 67 DOD DOD A . H 6 DOD 28 628 330 DOD DOD A . H 6 DOD 29 629 173 DOD DOD A . H 6 DOD 30 630 215 DOD DOD A . H 6 DOD 31 631 41 DOD DOD A . H 6 DOD 32 632 13 DOD DOD A . H 6 DOD 33 633 49 DOD DOD A . H 6 DOD 34 634 243 DOD DOD A . H 6 DOD 35 635 318 DOD DOD A . H 6 DOD 36 636 65 DOD DOD A . H 6 DOD 37 637 283 DOD DOD A . H 6 DOD 38 638 3 DOD DOD A . H 6 DOD 39 639 81 DOD DOD A . H 6 DOD 40 640 114 DOD DOD A . H 6 DOD 41 641 43 DOD DOD A . H 6 DOD 42 642 282 DOD DOD A . H 6 DOD 43 643 59 DOD DOD A . H 6 DOD 44 644 287 DOD DOD A . H 6 DOD 45 645 270 DOD DOD A . H 6 DOD 46 646 8 DOD DOD A . H 6 DOD 47 647 159 DOD DOD A . H 6 DOD 48 648 56 DOD DOD A . H 6 DOD 49 649 26 DOD DOD A . H 6 DOD 50 650 289 DOD DOD A . H 6 DOD 51 651 96 DOD DOD A . H 6 DOD 52 652 131 DOD DOD A . H 6 DOD 53 653 139 DOD DOD A . H 6 DOD 54 654 35 DOD DOD A . H 6 DOD 55 655 70 DOD DOD A . H 6 DOD 56 656 155 DOD DOD A . H 6 DOD 57 657 42 DOD DOD A . H 6 DOD 58 658 118 DOD DOD A . H 6 DOD 59 659 275 DOD DOD A . H 6 DOD 60 660 111 DOD DOD A . H 6 DOD 61 661 141 DOD DOD A . H 6 DOD 62 662 244 DOD DOD A . H 6 DOD 63 663 46 DOD DOD A . H 6 DOD 64 664 15 DOD DOD A . H 6 DOD 65 665 2 DOD DOD A . H 6 DOD 66 666 133 DOD DOD A . H 6 DOD 67 667 29 DOD DOD A . H 6 DOD 68 668 246 DOD DOD A . H 6 DOD 69 669 208 DOD DOD A . H 6 DOD 70 670 151 DOD DOD A . H 6 DOD 71 671 267 DOD DOD A . H 6 DOD 72 672 30 DOD DOD A . H 6 DOD 73 673 272 DOD DOD A . H 6 DOD 74 674 31 DOD DOD A . H 6 DOD 75 675 310 DOD DOD A . H 6 DOD 76 676 230 DOD DOD A . H 6 DOD 77 677 223 DOD DOD A . H 6 DOD 78 678 34 DOD DOD A . H 6 DOD 79 679 20 DOD DOD A . H 6 DOD 80 680 83 DOD DOD A . H 6 DOD 81 681 71 DOD DOD A . H 6 DOD 82 682 104 DOD DOD A . H 6 DOD 83 683 11 DOD DOD A . H 6 DOD 84 684 75 DOD DOD A . H 6 DOD 85 685 101 DOD DOD A . H 6 DOD 86 686 92 DOD DOD A . H 6 DOD 87 687 110 DOD DOD A . H 6 DOD 88 688 158 DOD DOD A . H 6 DOD 89 689 290 DOD DOD A . H 6 DOD 90 690 60 DOD DOD A . H 6 DOD 91 691 204 DOD DOD A . H 6 DOD 92 692 156 DOD DOD A . H 6 DOD 93 693 21 DOD DOD A . H 6 DOD 94 694 89 DOD DOD A . H 6 DOD 95 695 126 DOD DOD A . H 6 DOD 96 696 95 DOD DOD A . H 6 DOD 97 697 199 DOD DOD A . H 6 DOD 98 698 334 DOD DOD A . H 6 DOD 99 699 52 DOD DOD A . H 6 DOD 100 700 79 DOD DOD A . H 6 DOD 101 701 17 DOD DOD A . H 6 DOD 102 702 140 DOD DOD A . H 6 DOD 103 703 161 DOD DOD A . H 6 DOD 104 704 97 DOD DOD A . H 6 DOD 105 705 314 DOD DOD A . H 6 DOD 106 706 337 DOD DOD A . H 6 DOD 107 707 7 DOD DOD A . H 6 DOD 108 708 33 DOD DOD A . H 6 DOD 109 709 47 DOD DOD A . H 6 DOD 110 710 136 DOD DOD A . H 6 DOD 111 711 55 DOD DOD A . H 6 DOD 112 712 58 DOD DOD A . H 6 DOD 113 713 87 DOD DOD A . H 6 DOD 114 714 326 DOD DOD A . H 6 DOD 115 715 291 DOD DOD A . H 6 DOD 116 716 22 DOD DOD A . H 6 DOD 117 717 14 DOD DOD A . H 6 DOD 118 718 27 DOD DOD A . H 6 DOD 119 719 264 DOD DOD A . H 6 DOD 120 720 200 DOD DOD A . H 6 DOD 121 721 292 DOD DOD A . H 6 DOD 122 722 85 DOD DOD A . H 6 DOD 123 723 45 DOD DOD A . H 6 DOD 124 724 103 DOD DOD A . H 6 DOD 125 725 169 DOD DOD A . H 6 DOD 126 726 149 DOD DOD A . H 6 DOD 127 727 135 DOD DOD A . H 6 DOD 128 728 9 DOD DOD A . H 6 DOD 129 729 63 DOD DOD A . H 6 DOD 130 730 224 DOD DOD A . H 6 DOD 131 731 39 DOD DOD A . H 6 DOD 132 732 106 DOD DOD A . H 6 DOD 133 733 219 DOD DOD A . H 6 DOD 134 734 54 DOD DOD A . H 6 DOD 135 735 44 DOD DOD A . H 6 DOD 136 736 238 DOD DOD A . H 6 DOD 137 737 113 DOD DOD A . H 6 DOD 138 738 74 DOD DOD A . H 6 DOD 139 739 12 DOD DOD A . H 6 DOD 140 740 115 DOD DOD A . H 6 DOD 141 741 227 DOD DOD A . H 6 DOD 142 742 76 DOD DOD A . H 6 DOD 143 743 249 DOD DOD A . H 6 DOD 144 744 72 DOD DOD A . H 6 DOD 145 745 90 DOD DOD A . H 6 DOD 146 746 305 DOD DOD A . H 6 DOD 147 747 6 DOD DOD A . H 6 DOD 148 748 198 DOD DOD A . H 6 DOD 149 749 170 DOD DOD A . H 6 DOD 150 750 332 DOD DOD A . H 6 DOD 151 751 178 DOD DOD A . H 6 DOD 152 752 16 DOD DOD A . H 6 DOD 153 753 203 DOD DOD A . H 6 DOD 154 754 117 DOD DOD A . H 6 DOD 155 755 279 DOD DOD A . H 6 DOD 156 756 164 DOD DOD A . H 6 DOD 157 757 145 DOD DOD A . H 6 DOD 158 758 245 DOD DOD A . H 6 DOD 159 759 40 DOD DOD A . H 6 DOD 160 760 250 DOD DOD A . H 6 DOD 161 761 268 DOD DOD A . H 6 DOD 162 762 38 DOD DOD A . H 6 DOD 163 763 321 DOD DOD A . H 6 DOD 164 764 152 DOD DOD A . H 6 DOD 165 765 181 DOD DOD A . H 6 DOD 166 766 82 DOD DOD A . H 6 DOD 167 767 32 DOD DOD A . H 6 DOD 168 768 144 DOD DOD A . H 6 DOD 169 769 121 DOD DOD A . H 6 DOD 170 770 109 DOD DOD A . H 6 DOD 171 771 120 DOD DOD A . H 6 DOD 172 772 179 DOD DOD A . H 6 DOD 173 773 86 DOD DOD A . H 6 DOD 174 774 61 DOD DOD A . H 6 DOD 175 775 68 DOD DOD A . H 6 DOD 176 776 294 DOD DOD A . H 6 DOD 177 777 50 DOD DOD A . H 6 DOD 178 778 88 DOD DOD A . H 6 DOD 179 779 124 DOD DOD A . H 6 DOD 180 780 112 DOD DOD A . H 6 DOD 181 781 125 DOD DOD A . H 6 DOD 182 782 62 DOD DOD A . H 6 DOD 183 783 5 DOD DOD A . H 6 DOD 184 784 19 DOD DOD A . H 6 DOD 185 785 242 DOD DOD A . H 6 DOD 186 786 36 DOD DOD A . H 6 DOD 187 787 123 DOD DOD A . H 6 DOD 188 788 4 DOD DOD A . H 6 DOD 189 789 276 DOD DOD A . H 6 DOD 190 790 53 DOD DOD A . H 6 DOD 191 791 66 DOD DOD A . H 6 DOD 192 792 130 DOD DOD A . H 6 DOD 193 793 247 DOD DOD A . H 6 DOD 194 794 28 DOD DOD A . H 6 DOD 195 795 100 DOD DOD A . H 6 DOD 196 796 165 DOD DOD A . H 6 DOD 197 797 266 DOD DOD A . H 6 DOD 198 798 221 DOD DOD A . H 6 DOD 199 799 239 DOD DOD A . H 6 DOD 200 800 177 DOD DOD A . H 6 DOD 201 801 195 DOD DOD A . H 6 DOD 202 802 94 DOD DOD A . H 6 DOD 203 803 80 DOD DOD A . H 6 DOD 204 804 102 DOD DOD A . H 6 DOD 205 805 167 DOD DOD A . H 6 DOD 206 806 269 DOD DOD A . H 6 DOD 207 807 99 DOD DOD A . H 6 DOD 208 808 132 DOD DOD A . H 6 DOD 209 809 24 DOD DOD A . H 6 DOD 210 810 265 DOD DOD A . H 6 DOD 211 811 325 DOD DOD A . H 6 DOD 212 812 107 DOD DOD A . H 6 DOD 213 813 313 DOD DOD A . H 6 DOD 214 814 84 DOD DOD A . H 6 DOD 215 815 93 DOD DOD A . H 6 DOD 216 816 209 DOD DOD A . H 6 DOD 217 817 163 DOD DOD A . H 6 DOD 218 818 37 DOD DOD A . H 6 DOD 219 819 57 DOD DOD A . H 6 DOD 220 820 288 DOD DOD A . H 6 DOD 221 821 18 DOD DOD A . H 6 DOD 222 822 323 DOD DOD A . H 6 DOD 223 823 257 DOD DOD A . H 6 DOD 224 824 312 DOD DOD A . H 6 DOD 225 825 331 DOD DOD A . H 6 DOD 226 826 254 DOD DOD A . H 6 DOD 227 827 77 DOD DOD A . H 6 DOD 228 828 142 DOD DOD A . H 6 DOD 229 829 273 DOD DOD A . H 6 DOD 230 830 134 DOD DOD A . H 6 DOD 231 831 233 DOD DOD A . H 6 DOD 232 832 339 DOD DOD A . H 6 DOD 233 833 277 DOD DOD A . H 6 DOD 234 834 261 DOD DOD A . H 6 DOD 235 835 25 DOD DOD A . H 6 DOD 236 836 10 DOD DOD A . H 6 DOD 237 837 327 DOD DOD A . H 6 DOD 238 838 251 DOD DOD A . H 6 DOD 239 839 258 DOD DOD A . H 6 DOD 240 840 304 DOD DOD A . H 6 DOD 241 841 64 DOD DOD A . H 6 DOD 242 842 214 DOD DOD A . H 6 DOD 243 843 259 DOD DOD A . H 6 DOD 244 844 146 DOD DOD A . H 6 DOD 245 845 340 DOD DOD A . H 6 DOD 246 846 231 DOD DOD A . H 6 DOD 247 847 122 DOD DOD A . H 6 DOD 248 848 193 DOD DOD A . H 6 DOD 249 849 260 DOD DOD A . H 6 DOD 250 850 148 DOD DOD A . H 6 DOD 251 851 166 DOD DOD A . H 6 DOD 252 852 297 DOD DOD A . H 6 DOD 253 853 128 DOD DOD A . H 6 DOD 254 854 248 DOD DOD A . H 6 DOD 255 855 335 DOD DOD A . H 6 DOD 256 856 183 DOD DOD A . H 6 DOD 257 857 298 DOD DOD A . H 6 DOD 258 858 180 DOD DOD A . H 6 DOD 259 859 271 DOD DOD A . H 6 DOD 260 860 201 DOD DOD A . H 6 DOD 261 861 333 DOD DOD A . H 6 DOD 262 862 98 DOD DOD A . H 6 DOD 263 863 256 DOD DOD A . H 6 DOD 264 864 252 DOD DOD A . H 6 DOD 265 865 175 DOD DOD A . H 6 DOD 266 866 51 DOD DOD A . H 6 DOD 267 867 322 DOD DOD A . H 6 DOD 268 868 329 DOD DOD A . H 6 DOD 269 869 78 DOD DOD A . H 6 DOD 270 870 216 DOD DOD A . H 6 DOD 271 871 315 DOD DOD A . H 6 DOD 272 872 174 DOD DOD A . H 6 DOD 273 873 205 DOD DOD A . H 6 DOD 274 874 307 DOD DOD A . H 6 DOD 275 875 241 DOD DOD A . H 6 DOD 276 876 48 DOD DOD A . H 6 DOD 277 877 116 DOD DOD A . H 6 DOD 278 878 211 DOD DOD A . H 6 DOD 279 879 143 DOD DOD A . H 6 DOD 280 880 338 DOD DOD A . H 6 DOD 281 881 188 DOD DOD A . H 6 DOD 282 882 192 DOD DOD A . H 6 DOD 283 883 255 DOD DOD A . H 6 DOD 284 884 119 DOD DOD A . H 6 DOD 285 885 213 DOD DOD A . H 6 DOD 286 886 236 DOD DOD A . H 6 DOD 287 887 105 DOD DOD A . H 6 DOD 288 888 301 DOD DOD A . H 6 DOD 289 889 157 DOD DOD A . H 6 DOD 290 890 154 DOD DOD A . H 6 DOD 291 891 127 DOD DOD A . H 6 DOD 292 892 172 DOD DOD A . H 6 DOD 293 893 137 DOD DOD A . H 6 DOD 294 894 253 DOD DOD A . H 6 DOD 295 895 176 DOD DOD A . H 6 DOD 296 896 235 DOD DOD A . H 6 DOD 297 897 191 DOD DOD A . H 6 DOD 298 898 228 DOD DOD A . H 6 DOD 299 899 186 DOD DOD A . H 6 DOD 300 900 263 DOD DOD A . H 6 DOD 301 901 153 DOD DOD A . H 6 DOD 302 902 280 DOD DOD A . H 6 DOD 303 903 212 DOD DOD A . H 6 DOD 304 904 324 DOD DOD A . H 6 DOD 305 905 168 DOD DOD A . H 6 DOD 306 906 232 DOD DOD A . H 6 DOD 307 907 328 DOD DOD A . H 6 DOD 308 908 196 DOD DOD A . H 6 DOD 309 909 225 DOD DOD A . H 6 DOD 310 910 189 DOD DOD A . H 6 DOD 311 911 220 DOD DOD A . H 6 DOD 312 912 160 DOD DOD A . H 6 DOD 313 913 308 DOD DOD A . H 6 DOD 314 914 317 DOD DOD A . H 6 DOD 315 915 138 DOD DOD A . H 6 DOD 316 916 262 DOD DOD A . H 6 DOD 317 917 300 DOD DOD A . H 6 DOD 318 918 210 DOD DOD A . H 6 DOD 319 919 218 DOD DOD A . H 6 DOD 320 920 222 DOD DOD A . H 6 DOD 321 921 226 DOD DOD A . H 6 DOD 322 922 311 DOD DOD A . H 6 DOD 323 923 69 DOD DOD A . H 6 DOD 324 924 229 DOD DOD A . H 6 DOD 325 925 309 DOD DOD A . H 6 DOD 326 926 237 DOD DOD A . H 6 DOD 327 927 147 DOD DOD A . H 6 DOD 328 928 187 DOD DOD A . H 6 DOD 329 929 217 DOD DOD A . H 6 DOD 330 930 108 DOD DOD A . H 6 DOD 331 931 296 DOD DOD A . H 6 DOD 332 932 295 DOD DOD A . H 6 DOD 333 933 281 DOD DOD A . H 6 DOD 334 934 206 DOD DOD A . H 6 DOD 335 935 234 DOD DOD A . H 6 DOD 336 936 336 DOD DOD A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.dependencies _software.description _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.pdbx_ordinal _software.type _software.version ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? 1 ? 1.19.2_4158 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? STARGazer ? ? 2 ? . ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoXDS ? ? 3 ? . ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? 4 ? . ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? 5 ? . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9KVL _cell.details ? _cell.formula_units_Z ? _cell.length_a 115.060 _cell.length_a_esd ? _cell.length_b 115.060 _cell.length_b_esd ? _cell.length_c 84.483 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9KVL _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 9KVL 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 9KVL ? ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M acetate buffer pH 4.5, 5.5% (w/v) PEG 4000, and 75 mM CuSO4' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency _diffrn_detector.id _diffrn_detector.number_of_axes ? DIFFRACTOMETER 1 iBIX ? ? ? ? 2020-01-28 ? ? ? ? PIXEL 2 'DECTRIS PILATUS3 S 2M' ? ? ? ? 2020-02-18 ? ? ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 L ? ? LAUE ? neutron ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 2.15 1.0 2 4.89 1.0 3 0.8 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? 'SPALLATION SOURCE' ? 'J-PARC MLF BEAMLINE BL-03' ? ? 2.15-4.89 ? BL-03 'JPARC MLF' ? ? 2 ? ? SYNCHROTRON ? 'PHOTON FACTORY BEAMLINE AR-NW12A' ? ? 0.8 ? AR-NW12A 'Photon Factory' # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_CC_star _reflns.pdbx_R_split _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_CC_split_method _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] _reflns.pdbx_aniso_diffraction_limit_1 _reflns.pdbx_aniso_diffraction_limit_2 _reflns.pdbx_aniso_diffraction_limit_3 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvalue_1 _reflns.pdbx_aniso_B_tensor_eigenvalue_2 _reflns.pdbx_aniso_B_tensor_eigenvalue_3 _reflns.pdbx_orthogonalization_convention _reflns.pdbx_percent_possible_ellipsoidal _reflns.pdbx_percent_possible_spherical _reflns.pdbx_percent_possible_ellipsoidal_anomalous _reflns.pdbx_percent_possible_spherical_anomalous _reflns.pdbx_redundancy_anomalous _reflns.pdbx_CC_half_anomalous _reflns.pdbx_absDiff_over_sigma_anomalous _reflns.pdbx_percent_possible_anomalous _reflns.pdbx_observed_signal_threshold _reflns.pdbx_signal_type _reflns.pdbx_signal_details _reflns.pdbx_signal_software_id 6.43 9KVL ? ? 1.7 20 ? ? ? ? ? ? ? ? 43445 ? ? ? ? ? ? ? 94.6 ? ? ? ? ? ? 7.3 ? 8.8 ? ? ? ? ? ? ? ? ? 0.096 ? ? 1 1 0.973 ? ? 0.247 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6.43 9KVL ? ? 1.00 42.92 ? ? ? ? ? ? ? ? 225316 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 5.1 ? 13.3 ? ? ? ? ? ? ? ? ? 0.037 ? ? 2 2 0.996 ? ? 0.076 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.70 1.79 ? 3.0 ? ? ? ? 5851 ? ? ? ? ? ? ? ? ? ? ? 5.8 ? ? ? ? 0.243 ? 1 1 0.778 ? ? 87.1 ? 0.565 ? ? ? ? ? ? ? ? ? 1.00 1.02 ? 4.6 ? ? ? ? 11171 ? ? ? ? ? ? ? ? ? ? ? 5.1 ? ? ? ? 0.162 ? 2 2 0.940 ? ? 100 ? 0.33 ? ? ? ? ? ? ? ? ? # loop_ _refine.aniso_B[1][1] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][2] _refine.aniso_B[2][3] _refine.aniso_B[3][3] _refine.B_iso_max _refine.B_iso_mean _refine.B_iso_min _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.details _refine.diff_density_max _refine.diff_density_max_esd _refine.diff_density_min _refine.diff_density_min_esd _refine.diff_density_rms _refine.diff_density_rms_esd _refine.entry_id _refine.pdbx_refine_id _refine.ls_abs_structure_details _refine.ls_abs_structure_Flack _refine.ls_abs_structure_Flack_esd _refine.ls_abs_structure_Rogers _refine.ls_abs_structure_Rogers_esd _refine.ls_d_res_high _refine.ls_d_res_low _refine.ls_extinction_coef _refine.ls_extinction_coef_esd _refine.ls_extinction_expression _refine.ls_extinction_method _refine.ls_goodness_of_fit_all _refine.ls_goodness_of_fit_all_esd _refine.ls_goodness_of_fit_obs _refine.ls_goodness_of_fit_obs_esd _refine.ls_hydrogen_treatment _refine.ls_matrix_type _refine.ls_number_constraints _refine.ls_number_parameters _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_free _refine.ls_number_reflns_R_work _refine.ls_number_restraints _refine.ls_percent_reflns_obs _refine.ls_percent_reflns_R_free _refine.ls_R_factor_all _refine.ls_R_factor_obs _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_R_factor_R_work _refine.ls_R_Fsqd_factor_obs _refine.ls_R_I_factor_obs _refine.ls_redundancy_reflns_all _refine.ls_redundancy_reflns_obs _refine.ls_restrained_S_all _refine.ls_restrained_S_obs _refine.ls_shift_over_esd_max _refine.ls_shift_over_esd_mean _refine.ls_structure_factor_coef _refine.ls_weighting_details _refine.ls_weighting_scheme _refine.ls_wR_factor_all _refine.ls_wR_factor_obs _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.occupancy_max _refine.occupancy_min _refine.solvent_model_details _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.pdbx_R_complete _refine.ls_R_factor_gt _refine.ls_goodness_of_fit_gt _refine.ls_goodness_of_fit_ref _refine.ls_shift_over_su_max _refine.ls_shift_over_su_max_lt _refine.ls_shift_over_su_mean _refine.ls_shift_over_su_mean_lt _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_ls_sigma_Fsqd _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_isotropic_thermal_model _refine.pdbx_ls_cross_valid_method _refine.pdbx_method_to_determine_struct _refine.pdbx_starting_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_R_Free_selection_details _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_real_space_R _refine.pdbx_density_correlation _refine.pdbx_pd_number_of_powder_patterns _refine.pdbx_pd_number_of_points _refine.pdbx_pd_meas_number_of_points _refine.pdbx_pd_proc_ls_prof_R_factor _refine.pdbx_pd_proc_ls_prof_wR_factor _refine.pdbx_pd_Marquardt_correlation_coeff _refine.pdbx_pd_Fsqrd_R_factor _refine.pdbx_pd_ls_matrix_band_width _refine.pdbx_overall_phase_error _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_diffrn_id _refine.overall_SU_B _refine.overall_SU_ML _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_average_fsc_overall _refine.pdbx_average_fsc_work _refine.pdbx_average_fsc_free ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9KVL 'NEUTRON DIFFRACTION' ? ? ? ? ? 1.70 13.20 ? ? ? ? ? ? ? ? ? ? ? ? ? 43442 2003 ? ? 94.84 4.61 ? 0.1564 0.1718 ? ? 0.1556 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FLAT BULK SOLVENT MODEL' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 4YSO ML ? ? ? ? 1.11 ? 0.90 ? ? ? ? ? ? ? ? ? ? 15.33 ? ? ? ? 1 ? 0.11 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9KVL 'X-RAY DIFFRACTION' ? ? ? ? ? 1.30 28.16 ? ? ? ? ? ? ? ? ? ? ? ? ? 102513 ? ? ? 99.92 ? ? ? 0.1316 ? ? 0.1144 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FLAT BULK SOLVENT MODEL' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 4YSO ML ? ? ? ? 1.11 ? 0.90 ? ? ? ? ? ? ? ? ? ? 15.33 ? ? ? ? 2 ? 0.11 ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 13.20 _refine_hist.number_atoms_solvent 336 _refine_hist.number_atoms_total 2686 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2328 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 ? 5837 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.134 ? 9808 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.335 ? 1508 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.088 ? 401 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 927 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.30 1.32 . . 120 3400 100.00 . . . . 0.1063 . . . . . . . . . . . 0.1429 'X-RAY DIFFRACTION' 1.32 1.33 . . 118 3405 100.00 . . . . 0.1003 . . . . . . . . . . . 0.1154 'X-RAY DIFFRACTION' 1.33 1.35 . . 120 3426 100.00 . . . . 0.0947 . . . . . . . . . . . 0.1175 'X-RAY DIFFRACTION' 1.35 1.37 . . 118 3435 100.00 . . . . 0.0929 . . . . . . . . . . . 0.1373 'X-RAY DIFFRACTION' 1.37 1.38 . . 123 3426 100.00 . . . . 0.0903 . . . . . . . . . . . 0.1154 'X-RAY DIFFRACTION' 1.38 1.40 . . 119 3418 100.00 . . . . 0.0888 . . . . . . . . . . . 0.1219 'X-RAY DIFFRACTION' 1.40 1.43 . . 118 3390 100.00 . . . . 0.0907 . . . . . . . . . . . 0.1202 'X-RAY DIFFRACTION' 1.43 1.45 . . 119 3388 100.00 . . . . 0.0922 . . . . . . . . . . . 0.1024 'X-RAY DIFFRACTION' 1.45 1.47 . . 122 3472 100.00 . . . . 0.0939 . . . . . . . . . . . 0.1063 'X-RAY DIFFRACTION' 1.47 1.50 . . 121 3387 100.00 . . . . 0.0947 . . . . . . . . . . . 0.1182 'X-RAY DIFFRACTION' 1.50 1.52 . . 118 3418 100.00 . . . . 0.0962 . . . . . . . . . . . 0.1097 'X-RAY DIFFRACTION' 1.52 1.55 . . 121 3434 100.00 . . . . 0.0992 . . . . . . . . . . . 0.1233 'X-RAY DIFFRACTION' 1.55 1.58 . . 117 3417 100.00 . . . . 0.1019 . . . . . . . . . . . 0.1194 'X-RAY DIFFRACTION' 1.59 1.62 . . 124 3430 100.00 . . . . 0.1004 . . . . . . . . . . . 0.1329 'X-RAY DIFFRACTION' 1.62 1.66 . . 119 3372 100.00 . . . . 0.1007 . . . . . . . . . . . 0.1183 'X-RAY DIFFRACTION' 1.66 1.70 . . 119 3435 100.00 . . . . 0.1038 . . . . . . . . . . . 0.1142 'X-RAY DIFFRACTION' 1.70 1.74 . . 154 3399 100.00 . . . . 0.1051 . . . . . . . . . . . 0.1252 'X-RAY DIFFRACTION' 1.74 1.80 . . 152 3357 100.00 . . . . 0.1115 . . . . . . . . . . . 0.1178 'X-RAY DIFFRACTION' 1.80 1.85 . . 155 3412 100.00 . . . . 0.1127 . . . . . . . . . . . 0.1364 'X-RAY DIFFRACTION' 1.85 1.92 . . 159 3340 100.00 . . . . 0.1193 . . . . . . . . . . . 0.1247 'X-RAY DIFFRACTION' 1.92 2.00 . . 164 3350 100.00 . . . . 0.1336 . . . . . . . . . . . 0.1565 'X-RAY DIFFRACTION' 2.00 2.09 . . 157 3384 100.00 . . . . 0.1279 . . . . . . . . . . . 0.1484 'X-RAY DIFFRACTION' 2.09 2.20 . . 168 3393 100.00 . . . . 0.1202 . . . . . . . . . . . 0.1271 'X-RAY DIFFRACTION' 2.20 2.34 . . 164 3375 100.00 . . . . 0.1145 . . . . . . . . . . . 0.1166 'X-RAY DIFFRACTION' 2.34 2.52 . . 157 3369 100.00 . . . . 0.1131 . . . . . . . . . . . 0.1390 'X-RAY DIFFRACTION' 2.52 2.77 . . 165 3361 100.00 . . . . 0.1178 . . . . . . . . . . . 0.1267 'X-RAY DIFFRACTION' 2.77 3.17 . . 162 3391 100.00 . . . . 0.1236 . . . . . . . . . . . 0.1460 'X-RAY DIFFRACTION' 3.17 3.99 . . 160 3375 100.00 . . . . 0.1372 . . . . . . . . . . . 0.1440 'X-RAY DIFFRACTION' 3.99 28.16 . . 164 3357 100.00 . . . . 0.1323 . . . . . . . . . . . 0.1397 'NEUTRON DIFFRACTION' 1.70 1.74 . . 128 2725 86.00 . . . . 0.1943 . . . . . . . . . . . 0.2267 'NEUTRON DIFFRACTION' 1.74 1.79 . . 129 2733 88.00 . . . . 0.1835 . . . . . . . . . . . 0.2193 'NEUTRON DIFFRACTION' 1.79 1.84 . . 132 2778 89.00 . . . . 0.1747 . . . . . . . . . . . 0.1947 'NEUTRON DIFFRACTION' 1.84 1.90 . . 138 2830 90.00 . . . . 0.1705 . . . . . . . . . . . 0.1833 'NEUTRON DIFFRACTION' 1.90 1.97 . . 139 2824 91.00 . . . . 0.1547 . . . . . . . . . . . 0.1783 'NEUTRON DIFFRACTION' 1.97 2.05 . . 138 2885 93.00 . . . . 0.1518 . . . . . . . . . . . 0.1667 'NEUTRON DIFFRACTION' 2.05 2.14 . . 148 2979 96.00 . . . . 0.1480 . . . . . . . . . . . 0.1713 'NEUTRON DIFFRACTION' 2.14 2.25 . . 156 3141 99.00 . . . . 0.1378 . . . . . . . . . . . 0.1569 'NEUTRON DIFFRACTION' 2.25 2.39 . . 148 3088 100.00 . . . . 0.1334 . . . . . . . . . . . 0.1565 'NEUTRON DIFFRACTION' 2.39 2.58 . . 149 3139 100.00 . . . . 0.1369 . . . . . . . . . . . 0.1423 'NEUTRON DIFFRACTION' 2.58 2.83 . . 151 3101 100.00 . . . . 0.1506 . . . . . . . . . . . 0.1759 'NEUTRON DIFFRACTION' 2.83 3.24 . . 149 3139 100.00 . . . . 0.1596 . . . . . . . . . . . 0.1810 'NEUTRON DIFFRACTION' 3.24 4.06 . . 148 3098 100.00 . . . . 0.1587 . . . . . . . . . . . 0.1583 'NEUTRON DIFFRACTION' 4.06 13.20 . . 150 2979 95.00 . . . . 0.1472 . . . . . . . . . . . 0.1482 # _struct.entry_id 9KVL _struct.title 'Neutron and X-ray joint refined structure of a copper-containing nitrite reductase (C135A mutant) in complex with nitrite' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9KVL _struct_keywords.text 'copper, denitrification, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 5 ? H N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4IL26_GEOTN _struct_ref.pdbx_db_accession A4IL26 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPH SMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQN EWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYL DGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED ; _struct_ref.pdbx_align_begin 45 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9KVL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 300 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A4IL26 _struct_ref_seq.db_align_beg 45 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 344 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 315 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9KVL _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 120 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A4IL26 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 164 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 135 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12540 ? 1 MORE -119 ? 1 'SSA (A^2)' 28250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 3 ? LYS A 7 ? ILE A 18 LYS A 22 5 ? 5 HELX_P HELX_P2 AA2 SER A 90 ? PHE A 95 ? SER A 105 PHE A 110 1 ? 6 HELX_P HELX_P3 AA3 PRO A 124 ? ASN A 131 ? PRO A 139 ASN A 146 1 ? 8 HELX_P HELX_P4 AA4 THR A 147 ? VAL A 151 ? THR A 162 VAL A 166 5 ? 5 HELX_P HELX_P5 AA5 ASP A 167 ? GLY A 174 ? ASP A 182 GLY A 189 1 ? 8 HELX_P HELX_P6 AA6 PHE A 198 ? LYS A 203 ? PHE A 213 LYS A 218 1 ? 6 HELX_P HELX_P7 AA7 GLN A 280 ? LYS A 286 ? GLN A 295 LYS A 301 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 G CU . CU ? ? A HIS 42 A CU 506 1_555 ? ? ? ? ? ? ? 2.013 ? ? metalc2 metalc ? ? A GLU 38 OE1 ? ? ? 1_555 G CU . CU ? ? A GLU 53 A CU 506 8_444 ? ? ? ? ? ? ? 2.618 ? ? metalc3 metalc ? ? A GLU 38 OE2 ? ? ? 1_555 G CU . CU ? ? A GLU 53 A CU 506 8_444 ? ? ? ? ? ? ? 1.991 ? ? metalc4 metalc ? ? A HIS 68 ND1 ? ? ? 1_555 G CU . CU ? ? A HIS 83 A CU 506 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc5 metalc ? ? A HIS 80 ND1 ? ? ? 1_555 E CU . CU ? ? A HIS 95 A CU 504 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc6 metalc ? ? A HIS 85 NE2 ? ? ? 1_555 F CU . CU ? ? A HIS 100 A CU 505 1_555 ? ? ? ? ? ? ? 2.024 ? ? metalc7 metalc ? ? A HIS 119 NE2 ? ? ? 1_555 F CU . CU ? ? A HIS 134 A CU 505 1_555 ? ? ? ? ? ? ? 2.022 ? ? metalc8 metalc ? ? A HIS 128 ND1 ? ? ? 1_555 E CU . CU ? ? A HIS 143 A CU 504 1_555 ? ? ? ? ? ? ? 1.973 ? ? metalc9 metalc ? ? A MET 133 SD ? ? ? 1_555 E CU . CU ? ? A MET 148 A CU 504 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc10 metalc ? ? A HIS 279 NE2 ? ? ? 1_555 F CU . CU ? ? A HIS 294 A CU 505 3_555 ? ? ? ? ? ? ? 2.007 ? ? metalc11 metalc ? ? D NO2 . N A ? ? 1_555 F CU . CU ? ? A NO2 503 A CU 505 1_555 ? ? ? ? ? ? ? 2.681 ? ? metalc12 metalc ? ? D NO2 . O1 A ? ? 1_555 F CU . CU ? ? A NO2 503 A CU 505 1_555 ? ? ? ? ? ? ? 2.671 ? ? metalc13 metalc ? ? D NO2 . O2 A ? ? 1_555 F CU . CU ? ? A NO2 503 A CU 505 1_555 ? ? ? ? ? ? ? 1.767 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 27 ? A HIS 42 ? 1_555 CU ? G CU . ? A CU 506 ? 1_555 OE1 ? A GLU 38 ? A GLU 53 ? 1_555 36.1 ? 2 NE2 ? A HIS 27 ? A HIS 42 ? 1_555 CU ? G CU . ? A CU 506 ? 1_555 OE2 ? A GLU 38 ? A GLU 53 ? 1_555 38.2 ? 3 OE1 ? A GLU 38 ? A GLU 53 ? 1_555 CU ? G CU . ? A CU 506 ? 1_555 OE2 ? A GLU 38 ? A GLU 53 ? 1_555 2.3 ? 4 NE2 ? A HIS 27 ? A HIS 42 ? 1_555 CU ? G CU . ? A CU 506 ? 1_555 ND1 ? A HIS 68 ? A HIS 83 ? 1_555 95.0 ? 5 OE1 ? A GLU 38 ? A GLU 53 ? 1_555 CU ? G CU . ? A CU 506 ? 1_555 ND1 ? A HIS 68 ? A HIS 83 ? 1_555 75.5 ? 6 OE2 ? A GLU 38 ? A GLU 53 ? 1_555 CU ? G CU . ? A CU 506 ? 1_555 ND1 ? A HIS 68 ? A HIS 83 ? 1_555 75.2 ? 7 ND1 ? A HIS 80 ? A HIS 95 ? 1_555 CU ? E CU . ? A CU 504 ? 1_555 ND1 ? A HIS 128 ? A HIS 143 ? 1_555 104.8 ? 8 ND1 ? A HIS 80 ? A HIS 95 ? 1_555 CU ? E CU . ? A CU 504 ? 1_555 SD ? A MET 133 ? A MET 148 ? 1_555 100.0 ? 9 ND1 ? A HIS 128 ? A HIS 143 ? 1_555 CU ? E CU . ? A CU 504 ? 1_555 SD ? A MET 133 ? A MET 148 ? 1_555 155.1 ? 10 NE2 ? A HIS 85 ? A HIS 100 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 NE2 ? A HIS 119 ? A HIS 134 ? 1_555 109.5 ? 11 NE2 ? A HIS 85 ? A HIS 100 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 NE2 ? A HIS 279 ? A HIS 294 ? 1_555 69.3 ? 12 NE2 ? A HIS 119 ? A HIS 134 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 NE2 ? A HIS 279 ? A HIS 294 ? 1_555 101.0 ? 13 NE2 ? A HIS 85 ? A HIS 100 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 N A D NO2 . ? A NO2 503 ? 1_555 135.4 ? 14 NE2 ? A HIS 119 ? A HIS 134 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 N A D NO2 . ? A NO2 503 ? 1_555 108.6 ? 15 NE2 ? A HIS 279 ? A HIS 294 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 N A D NO2 . ? A NO2 503 ? 1_555 124.0 ? 16 NE2 ? A HIS 85 ? A HIS 100 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O1 A D NO2 . ? A NO2 503 ? 1_555 165.9 ? 17 NE2 ? A HIS 119 ? A HIS 134 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O1 A D NO2 . ? A NO2 503 ? 1_555 81.9 ? 18 NE2 ? A HIS 279 ? A HIS 294 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O1 A D NO2 . ? A NO2 503 ? 1_555 117.8 ? 19 N A D NO2 . ? A NO2 503 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O1 A D NO2 . ? A NO2 503 ? 1_555 30.5 ? 20 NE2 ? A HIS 85 ? A HIS 100 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O2 A D NO2 . ? A NO2 503 ? 1_555 108.4 ? 21 NE2 ? A HIS 119 ? A HIS 134 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O2 A D NO2 . ? A NO2 503 ? 1_555 120.9 ? 22 NE2 ? A HIS 279 ? A HIS 294 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O2 A D NO2 . ? A NO2 503 ? 1_555 134.4 ? 23 N A D NO2 . ? A NO2 503 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O2 A D NO2 . ? A NO2 503 ? 1_555 29.3 ? 24 O1 A D NO2 . ? A NO2 503 ? 1_555 CU ? F CU . ? A CU 505 ? 1_555 O2 A D NO2 . ? A NO2 503 ? 1_555 57.6 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 54 A . ? ALA 69 A PRO 55 A ? PRO 70 A 1 -9.64 2 LYS 123 A . ? LYS 138 A PRO 124 A ? PRO 139 A 1 -7.24 3 LYS 123 A . ? LYS 138 A PRO 124 A ? PRO 139 A 1 -3.38 4 GLY 221 A . ? GLY 236 A PRO 222 A ? PRO 237 A 1 19.63 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 6 ? AA5 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 17 ? GLY A 22 ? LYS A 32 GLY A 37 AA1 2 ASP A 25 ? ASP A 40 ? ASP A 40 ASP A 55 AA1 3 LYS A 43 ? PHE A 50 ? LYS A 58 PHE A 65 AA2 1 LYS A 17 ? GLY A 22 ? LYS A 32 GLY A 37 AA2 2 ASP A 25 ? ASP A 40 ? ASP A 40 ASP A 55 AA2 3 ASP A 65 ? ASN A 73 ? ASP A 80 ASN A 88 AA2 4 SER A 103 ? ALA A 110 ? SER A 118 ALA A 125 AA3 1 VAL A 59 ? ASN A 62 ? VAL A 74 ASN A 77 AA3 2 HIS A 134 ? LYS A 140 ? HIS A 149 LYS A 155 AA3 3 GLY A 114 ? HIS A 119 ? GLY A 129 HIS A 134 AA3 4 ASP A 83 ? PHE A 84 ? ASP A 98 PHE A 99 AA4 1 TYR A 178 ? LYS A 184 ? TYR A 193 LYS A 199 AA4 2 ARG A 153 ? TRP A 162 ? ARG A 168 TRP A 177 AA4 3 LYS A 212 ? GLY A 221 ? LYS A 227 GLY A 236 AA4 4 GLY A 261 ? THR A 267 ? GLY A 276 THR A 282 AA4 5 PHE A 235 ? LEU A 240 ? PHE A 250 LEU A 255 AA4 6 HIS A 247 ? MET A 251 ? HIS A 262 MET A 266 AA5 1 LEU A 205 ? LYS A 208 ? LEU A 220 LYS A 223 AA5 2 VAL A 289 ? THR A 295 ? VAL A 304 THR A 310 AA5 3 GLY A 272 ? THR A 278 ? GLY A 287 THR A 293 AA5 4 SER A 226 ? VAL A 230 ? SER A 241 VAL A 245 AA5 5 VAL A 254 ? LEU A 256 ? VAL A 269 LEU A 271 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 19 ? N GLU A 34 O HIS A 27 ? O HIS A 42 AA1 2 3 N ILE A 37 ? N ILE A 52 O TYR A 45 ? O TYR A 60 AA2 1 2 N GLU A 19 ? N GLU A 34 O HIS A 27 ? O HIS A 42 AA2 2 3 N ILE A 28 ? N ILE A 43 O THR A 70 ? O THR A 85 AA2 3 4 N PHE A 69 ? N PHE A 84 O PHE A 106 ? O PHE A 121 AA3 1 2 N VAL A 59 ? N VAL A 74 O ILE A 138 ? O ILE A 153 AA3 2 3 O VAL A 139 ? O VAL A 154 N GLY A 114 ? N GLY A 129 AA3 3 4 O HIS A 119 ? O HIS A 134 N ASP A 83 ? N ASP A 98 AA4 1 2 O VAL A 180 ? O VAL A 195 N ASN A 160 ? N ASN A 175 AA4 2 3 N ARG A 153 ? N ARG A 168 O ARG A 214 ? O ARG A 229 AA4 3 4 N ILE A 213 ? N ILE A 228 O PHE A 266 ? O PHE A 281 AA4 4 5 O VAL A 263 ? O VAL A 278 N TYR A 239 ? N TYR A 254 AA4 5 6 N PHE A 235 ? N PHE A 250 O MET A 251 ? O MET A 266 AA5 1 2 N LEU A 205 ? N LEU A 220 O LYS A 293 ? O LYS A 308 AA5 2 3 O VAL A 294 ? O VAL A 309 N GLY A 272 ? N GLY A 287 AA5 3 4 O VAL A 277 ? O VAL A 292 N HIS A 229 ? N HIS A 244 AA5 4 5 N SER A 226 ? N SER A 241 O LEU A 256 ? O LEU A 271 # _pdbx_entry_details.entry_id 9KVL _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 44 ? B D1 A DOD 603 ? ? 1.49 2 1 OE2 A GLU 169 ? B DH A TYR 231 ? ? 1.57 3 1 DE2 A HIS 39 ? ? O A DOD 609 ? ? 1.58 4 1 O A DOD 834 ? ? O A DOD 849 ? ? 2.10 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 DE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 34 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 51 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_445 _pdbx_validate_symm_contact.dist 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 242 ? ? -112.33 78.37 2 1 ASP A 256 ? ? 57.27 12.51 3 1 SER A 274 ? ? 80.45 2.68 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 VAL _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 292 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 THR _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 293 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 145.55 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id DOD _pdbx_struct_special_symmetry.auth_seq_id 903 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id H _pdbx_struct_special_symmetry.label_comp_id DOD _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x+1/3,y+2/3,z+2/3 5 -y+1/3,x-y+2/3,z+2/3 6 -x+y+1/3,-x+2/3,z+2/3 7 x+2/3,y+1/3,z+1/3 8 -y+2/3,x-y+1/3,z+1/3 9 -x+y+2/3,-x+1/3,z+1/3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DOD O O N N 89 DOD D1 D N N 90 DOD D2 D N N 91 GLN N N N N 92 GLN CA C N S 93 GLN C C N N 94 GLN O O N N 95 GLN CB C N N 96 GLN CG C N N 97 GLN CD C N N 98 GLN OE1 O N N 99 GLN NE2 N N N 100 GLN OXT O N N 101 GLN H H N N 102 GLN H2 H N N 103 GLN HA H N N 104 GLN HB2 H N N 105 GLN HB3 H N N 106 GLN HG2 H N N 107 GLN HG3 H N N 108 GLN HE21 H N N 109 GLN HE22 H N N 110 GLN HXT H N N 111 GLU N N N N 112 GLU CA C N S 113 GLU C C N N 114 GLU O O N N 115 GLU CB C N N 116 GLU CG C N N 117 GLU CD C N N 118 GLU OE1 O N N 119 GLU OE2 O N N 120 GLU OXT O N N 121 GLU H H N N 122 GLU H2 H N N 123 GLU HA H N N 124 GLU HB2 H N N 125 GLU HB3 H N N 126 GLU HG2 H N N 127 GLU HG3 H N N 128 GLU HE2 H N N 129 GLU HXT H N N 130 GLY N N N N 131 GLY CA C N N 132 GLY C C N N 133 GLY O O N N 134 GLY OXT O N N 135 GLY H H N N 136 GLY H2 H N N 137 GLY HA2 H N N 138 GLY HA3 H N N 139 GLY HXT H N N 140 HIS N N N N 141 HIS CA C N S 142 HIS C C N N 143 HIS O O N N 144 HIS CB C N N 145 HIS CG C Y N 146 HIS ND1 N Y N 147 HIS CD2 C Y N 148 HIS CE1 C Y N 149 HIS NE2 N Y N 150 HIS OXT O N N 151 HIS H H N N 152 HIS H2 H N N 153 HIS HA H N N 154 HIS HB2 H N N 155 HIS HB3 H N N 156 HIS HD1 H N N 157 HIS HD2 H N N 158 HIS HE1 H N N 159 HIS HE2 H N N 160 HIS HXT H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MPD C1 C N N 251 MPD C2 C N N 252 MPD O2 O N N 253 MPD CM C N N 254 MPD C3 C N N 255 MPD C4 C N S 256 MPD O4 O N N 257 MPD C5 C N N 258 MPD H11 H N N 259 MPD H12 H N N 260 MPD H13 H N N 261 MPD HO2 H N N 262 MPD HM1 H N N 263 MPD HM2 H N N 264 MPD HM3 H N N 265 MPD H31 H N N 266 MPD H32 H N N 267 MPD H4 H N N 268 MPD HO4 H N N 269 MPD H51 H N N 270 MPD H52 H N N 271 MPD H53 H N N 272 MRD C1 C N N 273 MRD C2 C N N 274 MRD O2 O N N 275 MRD CM C N N 276 MRD C3 C N N 277 MRD C4 C N R 278 MRD O4 O N N 279 MRD C5 C N N 280 MRD H1C1 H N N 281 MRD H1C2 H N N 282 MRD H1C3 H N N 283 MRD H2 H N N 284 MRD HMC1 H N N 285 MRD HMC2 H N N 286 MRD HMC3 H N N 287 MRD H3C1 H N N 288 MRD H3C2 H N N 289 MRD H4 H N N 290 MRD HA H N N 291 MRD H5C1 H N N 292 MRD H5C2 H N N 293 MRD H5C3 H N N 294 NO2 N N N N 295 NO2 O1 O N N 296 NO2 O2 O N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TRP N N N N 369 TRP CA C N S 370 TRP C C N N 371 TRP O O N N 372 TRP CB C N N 373 TRP CG C Y N 374 TRP CD1 C Y N 375 TRP CD2 C Y N 376 TRP NE1 N Y N 377 TRP CE2 C Y N 378 TRP CE3 C Y N 379 TRP CZ2 C Y N 380 TRP CZ3 C Y N 381 TRP CH2 C Y N 382 TRP OXT O N N 383 TRP H H N N 384 TRP H2 H N N 385 TRP HA H N N 386 TRP HB2 H N N 387 TRP HB3 H N N 388 TRP HD1 H N N 389 TRP HE1 H N N 390 TRP HE3 H N N 391 TRP HZ2 H N N 392 TRP HZ3 H N N 393 TRP HH2 H N N 394 TRP HXT H N N 395 TYR N N N N 396 TYR CA C N S 397 TYR C C N N 398 TYR O O N N 399 TYR CB C N N 400 TYR CG C Y N 401 TYR CD1 C Y N 402 TYR CD2 C Y N 403 TYR CE1 C Y N 404 TYR CE2 C Y N 405 TYR CZ C Y N 406 TYR OH O N N 407 TYR OXT O N N 408 TYR H H N N 409 TYR H2 H N N 410 TYR HA H N N 411 TYR HB2 H N N 412 TYR HB3 H N N 413 TYR HD1 H N N 414 TYR HD2 H N N 415 TYR HE1 H N N 416 TYR HE2 H N N 417 TYR HH H N N 418 TYR HXT H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DOD O D1 sing N N 83 DOD O D2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLU N CA sing N N 104 GLU N H sing N N 105 GLU N H2 sing N N 106 GLU CA C sing N N 107 GLU CA CB sing N N 108 GLU CA HA sing N N 109 GLU C O doub N N 110 GLU C OXT sing N N 111 GLU CB CG sing N N 112 GLU CB HB2 sing N N 113 GLU CB HB3 sing N N 114 GLU CG CD sing N N 115 GLU CG HG2 sing N N 116 GLU CG HG3 sing N N 117 GLU CD OE1 doub N N 118 GLU CD OE2 sing N N 119 GLU OE2 HE2 sing N N 120 GLU OXT HXT sing N N 121 GLY N CA sing N N 122 GLY N H sing N N 123 GLY N H2 sing N N 124 GLY CA C sing N N 125 GLY CA HA2 sing N N 126 GLY CA HA3 sing N N 127 GLY C O doub N N 128 GLY C OXT sing N N 129 GLY OXT HXT sing N N 130 HIS N CA sing N N 131 HIS N H sing N N 132 HIS N H2 sing N N 133 HIS CA C sing N N 134 HIS CA CB sing N N 135 HIS CA HA sing N N 136 HIS C O doub N N 137 HIS C OXT sing N N 138 HIS CB CG sing N N 139 HIS CB HB2 sing N N 140 HIS CB HB3 sing N N 141 HIS CG ND1 sing Y N 142 HIS CG CD2 doub Y N 143 HIS ND1 CE1 doub Y N 144 HIS ND1 HD1 sing N N 145 HIS CD2 NE2 sing Y N 146 HIS CD2 HD2 sing N N 147 HIS CE1 NE2 sing Y N 148 HIS CE1 HE1 sing N N 149 HIS NE2 HE2 sing N N 150 HIS OXT HXT sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MPD C1 C2 sing N N 237 MPD C1 H11 sing N N 238 MPD C1 H12 sing N N 239 MPD C1 H13 sing N N 240 MPD C2 O2 sing N N 241 MPD C2 CM sing N N 242 MPD C2 C3 sing N N 243 MPD O2 HO2 sing N N 244 MPD CM HM1 sing N N 245 MPD CM HM2 sing N N 246 MPD CM HM3 sing N N 247 MPD C3 C4 sing N N 248 MPD C3 H31 sing N N 249 MPD C3 H32 sing N N 250 MPD C4 O4 sing N N 251 MPD C4 C5 sing N N 252 MPD C4 H4 sing N N 253 MPD O4 HO4 sing N N 254 MPD C5 H51 sing N N 255 MPD C5 H52 sing N N 256 MPD C5 H53 sing N N 257 MRD C1 C2 sing N N 258 MRD C1 H1C1 sing N N 259 MRD C1 H1C2 sing N N 260 MRD C1 H1C3 sing N N 261 MRD C2 O2 sing N N 262 MRD C2 CM sing N N 263 MRD C2 C3 sing N N 264 MRD O2 H2 sing N N 265 MRD CM HMC1 sing N N 266 MRD CM HMC2 sing N N 267 MRD CM HMC3 sing N N 268 MRD C3 C4 sing N N 269 MRD C3 H3C1 sing N N 270 MRD C3 H3C2 sing N N 271 MRD C4 O4 sing N N 272 MRD C4 C5 sing N N 273 MRD C4 H4 sing N N 274 MRD O4 HA sing N N 275 MRD C5 H5C1 sing N N 276 MRD C5 H5C2 sing N N 277 MRD C5 H5C3 sing N N 278 NO2 N O1 doub N N 279 NO2 N O2 sing N N 280 PHE N CA sing N N 281 PHE N H sing N N 282 PHE N H2 sing N N 283 PHE CA C sing N N 284 PHE CA CB sing N N 285 PHE CA HA sing N N 286 PHE C O doub N N 287 PHE C OXT sing N N 288 PHE CB CG sing N N 289 PHE CB HB2 sing N N 290 PHE CB HB3 sing N N 291 PHE CG CD1 doub Y N 292 PHE CG CD2 sing Y N 293 PHE CD1 CE1 sing Y N 294 PHE CD1 HD1 sing N N 295 PHE CD2 CE2 doub Y N 296 PHE CD2 HD2 sing N N 297 PHE CE1 CZ doub Y N 298 PHE CE1 HE1 sing N N 299 PHE CE2 CZ sing Y N 300 PHE CE2 HE2 sing N N 301 PHE CZ HZ sing N N 302 PHE OXT HXT sing N N 303 PRO N CA sing N N 304 PRO N CD sing N N 305 PRO N H sing N N 306 PRO CA C sing N N 307 PRO CA CB sing N N 308 PRO CA HA sing N N 309 PRO C O doub N N 310 PRO C OXT sing N N 311 PRO CB CG sing N N 312 PRO CB HB2 sing N N 313 PRO CB HB3 sing N N 314 PRO CG CD sing N N 315 PRO CG HG2 sing N N 316 PRO CG HG3 sing N N 317 PRO CD HD2 sing N N 318 PRO CD HD3 sing N N 319 PRO OXT HXT sing N N 320 SER N CA sing N N 321 SER N H sing N N 322 SER N H2 sing N N 323 SER CA C sing N N 324 SER CA CB sing N N 325 SER CA HA sing N N 326 SER C O doub N N 327 SER C OXT sing N N 328 SER CB OG sing N N 329 SER CB HB2 sing N N 330 SER CB HB3 sing N N 331 SER OG HG sing N N 332 SER OXT HXT sing N N 333 THR N CA sing N N 334 THR N H sing N N 335 THR N H2 sing N N 336 THR CA C sing N N 337 THR CA CB sing N N 338 THR CA HA sing N N 339 THR C O doub N N 340 THR C OXT sing N N 341 THR CB OG1 sing N N 342 THR CB CG2 sing N N 343 THR CB HB sing N N 344 THR OG1 HG1 sing N N 345 THR CG2 HG21 sing N N 346 THR CG2 HG22 sing N N 347 THR CG2 HG23 sing N N 348 THR OXT HXT sing N N 349 TRP N CA sing N N 350 TRP N H sing N N 351 TRP N H2 sing N N 352 TRP CA C sing N N 353 TRP CA CB sing N N 354 TRP CA HA sing N N 355 TRP C O doub N N 356 TRP C OXT sing N N 357 TRP CB CG sing N N 358 TRP CB HB2 sing N N 359 TRP CB HB3 sing N N 360 TRP CG CD1 doub Y N 361 TRP CG CD2 sing Y N 362 TRP CD1 NE1 sing Y N 363 TRP CD1 HD1 sing N N 364 TRP CD2 CE2 doub Y N 365 TRP CD2 CE3 sing Y N 366 TRP NE1 CE2 sing Y N 367 TRP NE1 HE1 sing N N 368 TRP CE2 CZ2 sing Y N 369 TRP CE3 CZ3 doub Y N 370 TRP CE3 HE3 sing N N 371 TRP CZ2 CH2 doub Y N 372 TRP CZ2 HZ2 sing N N 373 TRP CZ3 CH2 sing Y N 374 TRP CZ3 HZ3 sing N N 375 TRP CH2 HH2 sing N N 376 TRP OXT HXT sing N N 377 TYR N CA sing N N 378 TYR N H sing N N 379 TYR N H2 sing N N 380 TYR CA C sing N N 381 TYR CA CB sing N N 382 TYR CA HA sing N N 383 TYR C O doub N N 384 TYR C OXT sing N N 385 TYR CB CG sing N N 386 TYR CB HB2 sing N N 387 TYR CB HB3 sing N N 388 TYR CG CD1 doub Y N 389 TYR CG CD2 sing Y N 390 TYR CD1 CE1 sing Y N 391 TYR CD1 HD1 sing N N 392 TYR CD2 CE2 doub Y N 393 TYR CD2 HD2 sing N N 394 TYR CE1 CZ doub Y N 395 TYR CE1 HE1 sing N N 396 TYR CE2 CZ sing Y N 397 TYR CE2 HE2 sing N N 398 TYR CZ OH sing N N 399 TYR OH HH sing N N 400 TYR OXT HXT sing N N 401 VAL N CA sing N N 402 VAL N H sing N N 403 VAL N H2 sing N N 404 VAL CA C sing N N 405 VAL CA CB sing N N 406 VAL CA HA sing N N 407 VAL C O doub N N 408 VAL C OXT sing N N 409 VAL CB CG1 sing N N 410 VAL CB CG2 sing N N 411 VAL CB HB sing N N 412 VAL CG1 HG11 sing N N 413 VAL CG1 HG12 sing N N 414 VAL CG1 HG13 sing N N 415 VAL CG2 HG21 sing N N 416 VAL CG2 HG22 sing N N 417 VAL CG2 HG23 sing N N 418 VAL OXT HXT sing N N 419 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4YSO _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'R 3 :H' _space_group.name_Hall 'R 3' _space_group.IT_number 146 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9KVL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008691 _atom_sites.fract_transf_matrix[1][2] 0.005018 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010036 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011837 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? ? ? ? ? ? ? ? ? 6.64599990845 'Custom 0-Gaussian' ? CU ? ? ? ? ? ? ? ? ? ? 7.71799993515 'Custom 0-Gaussian' ? D ? ? ? ? ? ? ? ? ? ? 6.67100000381 'Custom 0-Gaussian' ? H ? ? ? ? ? ? ? ? ? ? -3.73900008202 'Custom 0-Gaussian' ? N ? ? ? ? ? ? ? ? ? ? 9.35999965668 'Custom 0-Gaussian' ? O ? ? ? ? ? ? ? ? ? ? 5.8029999733 'Custom 0-Gaussian' ? S ? ? ? ? ? ? ? ? ? ? 2.84699988365 'Custom 0-Gaussian' ? # loop_ # loop_ #