data_9LD9 # _entry.id 9LD9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9LD9 pdb_00009ld9 10.2210/pdb9ld9/pdb WWPDB D_1300054908 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-22 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9LD9 _pdbx_database_status.recvd_initial_deposition_date 2025-01-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 eriko.nango.c4@tohoku.ac.jp Eriko Nango ? 'principal investigator/group leader' 0000-0001-9851-7355 4 hideaki.mizuno@kuleuven.be Hideaki Mizuno ? 'principal investigator/group leader' 0000-0002-6983-5255 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'De Zitter, E.' 1 0000-0001-6325-7354 'Luo, F.' 2 0000-0003-0631-6236 'Nango, E.' 3 0000-0001-9851-7355 'Mizuno, H.' 4 0000-0002-6983-5255 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Phys Chem Au' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Decarboxylation via a Higher Electronic Excited State Drives LSSmOrange Photoconversion' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsphyschemau.6c00009 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Seol, H.S.' 1 ? primary 'Luo, F.' 2 ? primary 'De Zitter, E.' 3 ? primary 'Nuemket, N.' 4 ? primary 'Fron, E.' 5 ? primary 'McFarlane, N.R.' 6 ? primary 'De Vrieze, L.' 7 ? primary 'Civic, J.' 8 ? primary 'Postelmans, M.' 9 ? primary 'Van Bel, S.' 10 ? primary 'Owada, S.' 11 ? primary 'Tono, K.' 12 ? primary 'Tanaka, T.' 13 ? primary 'Arima, T.' 14 ? primary 'Noguchi, H.' 15 ? primary 'Bui, T.Y.H.' 16 ? primary 'Tanaka, R.' 17 ? primary 'Hasegawa, K.' 18 ? primary 'Hirata, K.' 19 ? primary 'Im, D.' 20 ? primary 'Araya, T.' 21 ? primary 'Kimura, T.' 22 ? primary 'Van Meervelt, L.' 23 ? primary 'Weik, M.' 24 ? primary 'Harvey, J.N.' 25 ? primary 'Colletier, J.P.' 26 ? primary 'Iwata, S.' 27 ? primary 'Nango, E.' 28 ? primary 'Mizuno, H.' 29 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man mOrange 27805.410 1 ? ? ? ? 2 water nat water 18.015 79 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTVKLKVTKGGPLPFAWDILSPQ(OFM)SKAYVK HPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGMEASSERMYPED GALKGEDKLRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKLEH HHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTVKLKVTKGGPLPFAWDILSPQXSKAYVKHPAD IPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGMEASSERMYPEDGALK GEDKLRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKLEHHHHH H ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LYS n 1 5 GLY n 1 6 GLU n 1 7 GLU n 1 8 ASN n 1 9 ASN n 1 10 MET n 1 11 ALA n 1 12 ILE n 1 13 ILE n 1 14 LYS n 1 15 GLU n 1 16 PHE n 1 17 MET n 1 18 ARG n 1 19 PHE n 1 20 LYS n 1 21 VAL n 1 22 ARG n 1 23 MET n 1 24 GLU n 1 25 GLY n 1 26 SER n 1 27 VAL n 1 28 ASN n 1 29 GLY n 1 30 HIS n 1 31 GLU n 1 32 PHE n 1 33 GLU n 1 34 ILE n 1 35 GLU n 1 36 GLY n 1 37 GLU n 1 38 GLY n 1 39 GLU n 1 40 GLY n 1 41 ARG n 1 42 PRO n 1 43 TYR n 1 44 GLU n 1 45 GLY n 1 46 PHE n 1 47 GLN n 1 48 THR n 1 49 VAL n 1 50 LYS n 1 51 LEU n 1 52 LYS n 1 53 VAL n 1 54 THR n 1 55 LYS n 1 56 GLY n 1 57 GLY n 1 58 PRO n 1 59 LEU n 1 60 PRO n 1 61 PHE n 1 62 ALA n 1 63 TRP n 1 64 ASP n 1 65 ILE n 1 66 LEU n 1 67 SER n 1 68 PRO n 1 69 GLN n 1 70 OFM n 1 71 SER n 1 72 LYS n 1 73 ALA n 1 74 TYR n 1 75 VAL n 1 76 LYS n 1 77 HIS n 1 78 PRO n 1 79 ALA n 1 80 ASP n 1 81 ILE n 1 82 PRO n 1 83 ASP n 1 84 TYR n 1 85 LEU n 1 86 LYS n 1 87 LEU n 1 88 SER n 1 89 PHE n 1 90 PRO n 1 91 GLU n 1 92 GLY n 1 93 PHE n 1 94 LYS n 1 95 TRP n 1 96 GLU n 1 97 ARG n 1 98 VAL n 1 99 MET n 1 100 ASN n 1 101 PHE n 1 102 GLU n 1 103 ASP n 1 104 GLY n 1 105 GLY n 1 106 VAL n 1 107 VAL n 1 108 THR n 1 109 VAL n 1 110 THR n 1 111 GLN n 1 112 ASP n 1 113 SER n 1 114 SER n 1 115 LEU n 1 116 GLN n 1 117 ASP n 1 118 GLY n 1 119 GLU n 1 120 PHE n 1 121 ILE n 1 122 TYR n 1 123 LYS n 1 124 VAL n 1 125 LYS n 1 126 LEU n 1 127 ARG n 1 128 GLY n 1 129 THR n 1 130 ASN n 1 131 PHE n 1 132 PRO n 1 133 SER n 1 134 ASP n 1 135 GLY n 1 136 PRO n 1 137 VAL n 1 138 MET n 1 139 GLN n 1 140 LYS n 1 141 LYS n 1 142 THR n 1 143 MET n 1 144 GLY n 1 145 MET n 1 146 GLU n 1 147 ALA n 1 148 SER n 1 149 SER n 1 150 GLU n 1 151 ARG n 1 152 MET n 1 153 TYR n 1 154 PRO n 1 155 GLU n 1 156 ASP n 1 157 GLY n 1 158 ALA n 1 159 LEU n 1 160 LYS n 1 161 GLY n 1 162 GLU n 1 163 ASP n 1 164 LYS n 1 165 LEU n 1 166 ARG n 1 167 LEU n 1 168 LYS n 1 169 LEU n 1 170 LYS n 1 171 ASP n 1 172 GLY n 1 173 GLY n 1 174 HIS n 1 175 TYR n 1 176 THR n 1 177 SER n 1 178 GLU n 1 179 VAL n 1 180 LYS n 1 181 THR n 1 182 THR n 1 183 TYR n 1 184 LYS n 1 185 ALA n 1 186 LYS n 1 187 LYS n 1 188 PRO n 1 189 VAL n 1 190 GLN n 1 191 LEU n 1 192 PRO n 1 193 GLY n 1 194 ALA n 1 195 TYR n 1 196 ILE n 1 197 VAL n 1 198 ASP n 1 199 ILE n 1 200 LYS n 1 201 LEU n 1 202 ASP n 1 203 ILE n 1 204 THR n 1 205 SER n 1 206 HIS n 1 207 ASN n 1 208 GLU n 1 209 ASP n 1 210 TYR n 1 211 THR n 1 212 ILE n 1 213 VAL n 1 214 GLU n 1 215 GLN n 1 216 TYR n 1 217 GLU n 1 218 ARG n 1 219 ALA n 1 220 GLU n 1 221 GLY n 1 222 ARG n 1 223 HIS n 1 224 SER n 1 225 THR n 1 226 GLY n 1 227 GLY n 1 228 MET n 1 229 ASP n 1 230 GLU n 1 231 LEU n 1 232 TYR n 1 233 LYS n 1 234 LEU n 1 235 GLU n 1 236 HIS n 1 237 HIS n 1 238 HIS n 1 239 HIS n 1 240 HIS n 1 241 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 241 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Discosoma sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 86600 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OFM 'L-peptide linking' n ;[(4Z)-2-{(2R,5R)-2-[(1S)-1-amino-2-phenylethyl]-2-hydroxy-5-methyl-2,5-dihydro-1,3-oxazol-4-yl}-4-(4-hydroxybenzylidene )-5-oxo-4,5-dihydro-1H-imidazol-1-yl]acetic acid ; 'PEPTIDE DERIVED CHROMOPHORE' 'C24 H24 N4 O6' 464.471 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -4 ? ? ? A . n A 1 2 VAL 2 -3 ? ? ? A . n A 1 3 SER 3 -2 ? ? ? A . n A 1 4 LYS 4 -1 ? ? ? A . n A 1 5 GLY 5 0 ? ? ? A . n A 1 6 GLU 6 1 ? ? ? A . n A 1 7 GLU 7 2 ? ? ? A . n A 1 8 ASN 8 3 ? ? ? A . n A 1 9 ASN 9 4 ? ? ? A . n A 1 10 MET 10 5 ? ? ? A . n A 1 11 ALA 11 6 6 ALA ALA A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 ILE 13 8 8 ILE ILE A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 GLU 15 10 10 GLU GLU A . n A 1 16 PHE 16 11 11 PHE PHE A . n A 1 17 MET 17 12 12 MET MET A . n A 1 18 ARG 18 13 13 ARG ARG A . n A 1 19 PHE 19 14 14 PHE PHE A . n A 1 20 LYS 20 15 15 LYS LYS A . n A 1 21 VAL 21 16 16 VAL VAL A . n A 1 22 ARG 22 17 17 ARG ARG A . n A 1 23 MET 23 18 18 MET MET A . n A 1 24 GLU 24 19 19 GLU GLU A . n A 1 25 GLY 25 20 20 GLY GLY A . n A 1 26 SER 26 21 21 SER SER A . n A 1 27 VAL 27 22 22 VAL VAL A . n A 1 28 ASN 28 23 23 ASN ASN A . n A 1 29 GLY 29 24 24 GLY GLY A . n A 1 30 HIS 30 25 25 HIS HIS A . n A 1 31 GLU 31 26 26 GLU GLU A . n A 1 32 PHE 32 27 27 PHE PHE A . n A 1 33 GLU 33 28 28 GLU GLU A . n A 1 34 ILE 34 29 29 ILE ILE A . n A 1 35 GLU 35 30 30 GLU GLU A . n A 1 36 GLY 36 31 31 GLY GLY A . n A 1 37 GLU 37 32 32 GLU GLU A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLY 40 35 35 GLY GLY A . n A 1 41 ARG 41 36 36 ARG ARG A . n A 1 42 PRO 42 37 37 PRO PRO A . n A 1 43 TYR 43 38 38 TYR TYR A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLY 45 40 40 GLY GLY A . n A 1 46 PHE 46 41 41 PHE PHE A . n A 1 47 GLN 47 42 42 GLN GLN A . n A 1 48 THR 48 43 43 THR THR A . n A 1 49 VAL 49 44 44 VAL VAL A . n A 1 50 LYS 50 45 45 LYS LYS A . n A 1 51 LEU 51 46 46 LEU LEU A . n A 1 52 LYS 52 47 47 LYS LYS A . n A 1 53 VAL 53 48 48 VAL VAL A . n A 1 54 THR 54 49 49 THR THR A . n A 1 55 LYS 55 50 50 LYS LYS A . n A 1 56 GLY 56 51 51 GLY GLY A . n A 1 57 GLY 57 52 52 GLY GLY A . n A 1 58 PRO 58 53 53 PRO PRO A . n A 1 59 LEU 59 54 54 LEU LEU A . n A 1 60 PRO 60 55 55 PRO PRO A . n A 1 61 PHE 61 56 56 PHE PHE A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 TRP 63 58 58 TRP TRP A . n A 1 64 ASP 64 59 59 ASP ASP A . n A 1 65 ILE 65 60 60 ILE ILE A . n A 1 66 LEU 66 61 61 LEU LEU A . n A 1 67 SER 67 62 62 SER SER A . n A 1 68 PRO 68 63 63 PRO PRO A . n A 1 69 GLN 69 64 64 GLN GLN A . n A 1 70 OFM 70 66 66 OFM OFM A . n A 1 71 SER 71 69 69 SER SER A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 TYR 74 72 72 TYR TYR A . n A 1 75 VAL 75 73 73 VAL VAL A . n A 1 76 LYS 76 74 74 LYS LYS A . n A 1 77 HIS 77 75 75 HIS HIS A . n A 1 78 PRO 78 76 76 PRO PRO A . n A 1 79 ALA 79 77 77 ALA ALA A . n A 1 80 ASP 80 78 78 ASP ASP A . n A 1 81 ILE 81 79 79 ILE ILE A . n A 1 82 PRO 82 80 80 PRO PRO A . n A 1 83 ASP 83 81 81 ASP ASP A . n A 1 84 TYR 84 82 82 TYR TYR A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 LYS 86 84 84 LYS LYS A . n A 1 87 LEU 87 85 85 LEU LEU A . n A 1 88 SER 88 86 86 SER SER A . n A 1 89 PHE 89 87 87 PHE PHE A . n A 1 90 PRO 90 88 88 PRO PRO A . n A 1 91 GLU 91 89 89 GLU GLU A . n A 1 92 GLY 92 90 90 GLY GLY A . n A 1 93 PHE 93 91 91 PHE PHE A . n A 1 94 LYS 94 92 92 LYS LYS A . n A 1 95 TRP 95 93 93 TRP TRP A . n A 1 96 GLU 96 94 94 GLU GLU A . n A 1 97 ARG 97 95 95 ARG ARG A . n A 1 98 VAL 98 96 96 VAL VAL A . n A 1 99 MET 99 97 97 MET MET A . n A 1 100 ASN 100 98 98 ASN ASN A . n A 1 101 PHE 101 99 99 PHE PHE A . n A 1 102 GLU 102 100 100 GLU GLU A . n A 1 103 ASP 103 101 101 ASP ASP A . n A 1 104 GLY 104 102 102 GLY GLY A . n A 1 105 GLY 105 103 103 GLY GLY A . n A 1 106 VAL 106 104 104 VAL VAL A . n A 1 107 VAL 107 105 105 VAL VAL A . n A 1 108 THR 108 106 106 THR THR A . n A 1 109 VAL 109 107 107 VAL VAL A . n A 1 110 THR 110 108 108 THR THR A . n A 1 111 GLN 111 109 109 GLN GLN A . n A 1 112 ASP 112 110 110 ASP ASP A . n A 1 113 SER 113 111 111 SER SER A . n A 1 114 SER 114 112 112 SER SER A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 GLN 116 114 114 GLN GLN A . n A 1 117 ASP 117 115 115 ASP ASP A . n A 1 118 GLY 118 116 116 GLY GLY A . n A 1 119 GLU 119 117 117 GLU GLU A . n A 1 120 PHE 120 118 118 PHE PHE A . n A 1 121 ILE 121 119 119 ILE ILE A . n A 1 122 TYR 122 120 120 TYR TYR A . n A 1 123 LYS 123 121 121 LYS LYS A . n A 1 124 VAL 124 122 122 VAL VAL A . n A 1 125 LYS 125 123 123 LYS LYS A . n A 1 126 LEU 126 124 124 LEU LEU A . n A 1 127 ARG 127 125 125 ARG ARG A . n A 1 128 GLY 128 126 126 GLY GLY A . n A 1 129 THR 129 127 127 THR THR A . n A 1 130 ASN 130 128 128 ASN ASN A . n A 1 131 PHE 131 129 129 PHE PHE A . n A 1 132 PRO 132 130 130 PRO PRO A . n A 1 133 SER 133 131 131 SER SER A . n A 1 134 ASP 134 132 132 ASP ASP A . n A 1 135 GLY 135 133 133 GLY GLY A . n A 1 136 PRO 136 134 134 PRO PRO A . n A 1 137 VAL 137 135 135 VAL VAL A . n A 1 138 MET 138 136 136 MET MET A . n A 1 139 GLN 139 137 137 GLN GLN A . n A 1 140 LYS 140 138 138 LYS LYS A . n A 1 141 LYS 141 139 139 LYS LYS A . n A 1 142 THR 142 140 140 THR THR A . n A 1 143 MET 143 141 141 MET MET A . n A 1 144 GLY 144 142 142 GLY GLY A . n A 1 145 MET 145 143 143 MET MET A . n A 1 146 GLU 146 144 144 GLU GLU A . n A 1 147 ALA 147 145 145 ALA ALA A . n A 1 148 SER 148 146 146 SER SER A . n A 1 149 SER 149 147 147 SER SER A . n A 1 150 GLU 150 148 148 GLU GLU A . n A 1 151 ARG 151 149 149 ARG ARG A . n A 1 152 MET 152 150 150 MET MET A . n A 1 153 TYR 153 151 151 TYR TYR A . n A 1 154 PRO 154 152 152 PRO PRO A . n A 1 155 GLU 155 153 153 GLU GLU A . n A 1 156 ASP 156 154 154 ASP ASP A . n A 1 157 GLY 157 155 155 GLY GLY A . n A 1 158 ALA 158 156 156 ALA ALA A . n A 1 159 LEU 159 157 157 LEU LEU A . n A 1 160 LYS 160 158 158 LYS LYS A . n A 1 161 GLY 161 159 159 GLY GLY A . n A 1 162 GLU 162 160 160 GLU GLU A . n A 1 163 ASP 163 161 161 ASP ASP A . n A 1 164 LYS 164 162 162 LYS LYS A . n A 1 165 LEU 165 163 163 LEU LEU A . n A 1 166 ARG 166 164 164 ARG ARG A . n A 1 167 LEU 167 165 165 LEU LEU A . n A 1 168 LYS 168 166 166 LYS LYS A . n A 1 169 LEU 169 167 167 LEU LEU A . n A 1 170 LYS 170 168 168 LYS LYS A . n A 1 171 ASP 171 169 169 ASP ASP A . n A 1 172 GLY 172 170 170 GLY GLY A . n A 1 173 GLY 173 171 171 GLY GLY A . n A 1 174 HIS 174 172 172 HIS HIS A . n A 1 175 TYR 175 173 173 TYR TYR A . n A 1 176 THR 176 174 174 THR THR A . n A 1 177 SER 177 175 175 SER SER A . n A 1 178 GLU 178 176 176 GLU GLU A . n A 1 179 VAL 179 177 177 VAL VAL A . n A 1 180 LYS 180 178 178 LYS LYS A . n A 1 181 THR 181 179 179 THR THR A . n A 1 182 THR 182 180 180 THR THR A . n A 1 183 TYR 183 181 181 TYR TYR A . n A 1 184 LYS 184 182 182 LYS LYS A . n A 1 185 ALA 185 183 183 ALA ALA A . n A 1 186 LYS 186 184 184 LYS LYS A . n A 1 187 LYS 187 185 185 LYS LYS A . n A 1 188 PRO 188 186 186 PRO PRO A . n A 1 189 VAL 189 187 187 VAL VAL A . n A 1 190 GLN 190 188 188 GLN GLN A . n A 1 191 LEU 191 189 189 LEU LEU A . n A 1 192 PRO 192 190 190 PRO PRO A . n A 1 193 GLY 193 191 191 GLY GLY A . n A 1 194 ALA 194 192 192 ALA ALA A . n A 1 195 TYR 195 193 193 TYR TYR A . n A 1 196 ILE 196 194 194 ILE ILE A . n A 1 197 VAL 197 195 195 VAL VAL A . n A 1 198 ASP 198 196 196 ASP ASP A . n A 1 199 ILE 199 197 197 ILE ILE A . n A 1 200 LYS 200 198 198 LYS LYS A . n A 1 201 LEU 201 199 199 LEU LEU A . n A 1 202 ASP 202 200 200 ASP ASP A . n A 1 203 ILE 203 201 201 ILE ILE A . n A 1 204 THR 204 202 202 THR THR A . n A 1 205 SER 205 203 203 SER SER A . n A 1 206 HIS 206 204 204 HIS HIS A . n A 1 207 ASN 207 205 205 ASN ASN A . n A 1 208 GLU 208 206 206 GLU GLU A . n A 1 209 ASP 209 207 207 ASP ASP A . n A 1 210 TYR 210 208 208 TYR TYR A . n A 1 211 THR 211 209 209 THR THR A . n A 1 212 ILE 212 210 210 ILE ILE A . n A 1 213 VAL 213 211 211 VAL VAL A . n A 1 214 GLU 214 212 212 GLU GLU A . n A 1 215 GLN 215 213 213 GLN GLN A . n A 1 216 TYR 216 214 214 TYR TYR A . n A 1 217 GLU 217 215 215 GLU GLU A . n A 1 218 ARG 218 216 216 ARG ARG A . n A 1 219 ALA 219 217 217 ALA ALA A . n A 1 220 GLU 220 218 218 GLU GLU A . n A 1 221 GLY 221 219 219 GLY GLY A . n A 1 222 ARG 222 220 220 ARG ARG A . n A 1 223 HIS 223 221 221 HIS HIS A . n A 1 224 SER 224 222 222 SER SER A . n A 1 225 THR 225 223 223 THR THR A . n A 1 226 GLY 226 224 ? ? ? A . n A 1 227 GLY 227 225 ? ? ? A . n A 1 228 MET 228 226 ? ? ? A . n A 1 229 ASP 229 227 227 ASP ASP A . n A 1 230 GLU 230 228 228 GLU GLU A . n A 1 231 LEU 231 229 229 LEU LEU A . n A 1 232 TYR 232 230 230 TYR TYR A . n A 1 233 LYS 233 231 231 LYS LYS A . n A 1 234 LEU 234 232 232 LEU LEU A . n A 1 235 GLU 235 233 233 GLU GLU A . n A 1 236 HIS 236 234 234 HIS HIS A . n A 1 237 HIS 237 235 235 HIS HIS A . n A 1 238 HIS 238 236 236 HIS HIS A . n A 1 239 HIS 239 237 237 HIS HIS A . n A 1 240 HIS 240 238 238 HIS HIS A . n A 1 241 HIS 241 239 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id OFM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id OFM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 50 HOH HOH A . B 2 HOH 2 302 70 HOH HOH A . B 2 HOH 3 303 24 HOH HOH A . B 2 HOH 4 304 51 HOH HOH A . B 2 HOH 5 305 4 HOH HOH A . B 2 HOH 6 306 12 HOH HOH A . B 2 HOH 7 307 32 HOH HOH A . B 2 HOH 8 308 60 HOH HOH A . B 2 HOH 9 309 37 HOH HOH A . B 2 HOH 10 310 79 HOH HOH A . B 2 HOH 11 311 87 HOH HOH A . B 2 HOH 12 312 104 HOH HOH A . B 2 HOH 13 313 52 HOH HOH A . B 2 HOH 14 314 53 HOH HOH A . B 2 HOH 15 315 15 HOH HOH A . B 2 HOH 16 316 98 HOH HOH A . B 2 HOH 17 317 48 HOH HOH A . B 2 HOH 18 318 76 HOH HOH A . B 2 HOH 19 319 1 HOH HOH A . B 2 HOH 20 320 13 HOH HOH A . B 2 HOH 21 321 66 HOH HOH A . B 2 HOH 22 322 82 HOH HOH A . B 2 HOH 23 323 85 HOH HOH A . B 2 HOH 24 324 64 HOH HOH A . B 2 HOH 25 325 10 HOH HOH A . B 2 HOH 26 326 96 HOH HOH A . B 2 HOH 27 327 47 HOH HOH A . B 2 HOH 28 328 5 HOH HOH A . B 2 HOH 29 329 14 HOH HOH A . B 2 HOH 30 330 101 HOH HOH A . B 2 HOH 31 331 80 HOH HOH A . B 2 HOH 32 332 88 HOH HOH A . B 2 HOH 33 333 57 HOH HOH A . B 2 HOH 34 334 86 HOH HOH A . B 2 HOH 35 335 46 HOH HOH A . B 2 HOH 36 336 99 HOH HOH A . B 2 HOH 37 337 16 HOH HOH A . B 2 HOH 38 338 7 HOH HOH A . B 2 HOH 39 339 94 HOH HOH A . B 2 HOH 40 340 100 HOH HOH A . B 2 HOH 41 341 89 HOH HOH A . B 2 HOH 42 342 23 HOH HOH A . B 2 HOH 43 343 34 HOH HOH A . B 2 HOH 44 344 56 HOH HOH A . B 2 HOH 45 345 97 HOH HOH A . B 2 HOH 46 346 90 HOH HOH A . B 2 HOH 47 347 33 HOH HOH A . B 2 HOH 48 348 17 HOH HOH A . B 2 HOH 49 349 11 HOH HOH A . B 2 HOH 50 350 26 HOH HOH A . B 2 HOH 51 351 43 HOH HOH A . B 2 HOH 52 352 18 HOH HOH A . B 2 HOH 53 353 41 HOH HOH A . B 2 HOH 54 354 3 HOH HOH A . B 2 HOH 55 355 2 HOH HOH A . B 2 HOH 56 356 49 HOH HOH A . B 2 HOH 57 357 103 HOH HOH A . B 2 HOH 58 358 31 HOH HOH A . B 2 HOH 59 359 111 HOH HOH A . B 2 HOH 60 360 93 HOH HOH A . B 2 HOH 61 361 9 HOH HOH A . B 2 HOH 62 362 105 HOH HOH A . B 2 HOH 63 363 20 HOH HOH A . B 2 HOH 64 364 83 HOH HOH A . B 2 HOH 65 365 84 HOH HOH A . B 2 HOH 66 366 55 HOH HOH A . B 2 HOH 67 367 109 HOH HOH A . B 2 HOH 68 368 61 HOH HOH A . B 2 HOH 69 369 102 HOH HOH A . B 2 HOH 70 370 91 HOH HOH A . B 2 HOH 71 371 22 HOH HOH A . B 2 HOH 72 372 106 HOH HOH A . B 2 HOH 73 373 78 HOH HOH A . B 2 HOH 74 374 108 HOH HOH A . B 2 HOH 75 375 45 HOH HOH A . B 2 HOH 76 376 69 HOH HOH A . B 2 HOH 77 377 92 HOH HOH A . B 2 HOH 78 378 112 HOH HOH A . B 2 HOH 79 379 110 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 47 ? CG ? A LYS 52 CG 2 1 Y 1 A LYS 47 ? CD ? A LYS 52 CD 3 1 Y 1 A LYS 47 ? CE ? A LYS 52 CE 4 1 Y 1 A LYS 47 ? NZ ? A LYS 52 NZ 5 1 Y 1 A LYS 50 ? CG ? A LYS 55 CG 6 1 Y 1 A LYS 50 ? CD ? A LYS 55 CD 7 1 Y 1 A LYS 50 ? CE ? A LYS 55 CE 8 1 Y 1 A LYS 50 ? NZ ? A LYS 55 NZ 9 1 Y 1 A GLN 114 ? CG ? A GLN 116 CG 10 1 Y 1 A GLN 114 ? CD ? A GLN 116 CD 11 1 Y 1 A GLN 114 ? OE1 ? A GLN 116 OE1 12 1 Y 1 A GLN 114 ? NE2 ? A GLN 116 NE2 13 1 Y 1 A LYS 123 ? CE ? A LYS 125 CE 14 1 Y 1 A LYS 123 ? NZ ? A LYS 125 NZ 15 1 Y 1 A GLU 176 ? CD ? A GLU 178 CD 16 1 Y 1 A GLU 176 ? OE1 ? A GLU 178 OE1 17 1 Y 1 A GLU 176 ? OE2 ? A GLU 178 OE2 18 1 Y 1 A LYS 178 ? CD ? A LYS 180 CD 19 1 Y 1 A LYS 178 ? CE ? A LYS 180 CE 20 1 Y 1 A LYS 178 ? NZ ? A LYS 180 NZ 21 1 Y 1 A LYS 182 ? CD ? A LYS 184 CD 22 1 Y 1 A LYS 182 ? CE ? A LYS 184 CE 23 1 Y 1 A LYS 182 ? NZ ? A LYS 184 NZ 24 1 Y 1 A LYS 198 ? CE ? A LYS 200 CE 25 1 Y 1 A LYS 198 ? NZ ? A LYS 200 NZ 26 1 Y 1 A GLU 206 ? CG ? A GLU 208 CG 27 1 Y 1 A GLU 206 ? CD ? A GLU 208 CD 28 1 Y 1 A GLU 206 ? OE1 ? A GLU 208 OE1 29 1 Y 1 A GLU 206 ? OE2 ? A GLU 208 OE2 30 1 Y 1 A THR 223 ? OG1 ? A THR 225 OG1 31 1 Y 1 A THR 223 ? CG2 ? A THR 225 CG2 32 1 Y 1 A GLU 228 ? CG ? A GLU 230 CG 33 1 Y 1 A GLU 228 ? CD ? A GLU 230 CD 34 1 Y 1 A GLU 228 ? OE1 ? A GLU 230 OE1 35 1 Y 1 A GLU 228 ? OE2 ? A GLU 230 OE2 36 1 Y 1 A LYS 231 ? CG ? A LYS 233 CG 37 1 Y 1 A LYS 231 ? CD ? A LYS 233 CD 38 1 Y 1 A LYS 231 ? CE ? A LYS 233 CE 39 1 Y 1 A LYS 231 ? NZ ? A LYS 233 NZ 40 1 Y 1 A HIS 238 ? CG ? A HIS 240 CG 41 1 Y 1 A HIS 238 ? ND1 ? A HIS 240 ND1 42 1 Y 1 A HIS 238 ? CD2 ? A HIS 240 CD2 43 1 Y 1 A HIS 238 ? CE1 ? A HIS 240 CE1 44 1 Y 1 A HIS 238 ? NE2 ? A HIS 240 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20_4459: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Xtrapol8 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 110.80 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9LD9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.500 _cell.length_a_esd ? _cell.length_b 85.900 _cell.length_b_esd ? _cell.length_c 40.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9LD9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9LD9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris-HCl pH 8.0, 28% (w/v) PEG 3350, 0.6 M NaCl' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type MPCCD _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.23 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'FREE ELECTRON LASER' _diffrn_source.target ? _diffrn_source.type 'SACLA BEAMLINE BL3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.23 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL3 _diffrn_source.pdbx_synchrotron_site SACLA # _reflns.B_iso_Wilson_estimate 35.96 _reflns.entry_id 9LD9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 33.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16473 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 537.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.25 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split 0.084 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.69 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 799 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.842 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split 0.39 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9LD9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 32.28 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16435 _refine.ls_number_reflns_R_free 824 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.90 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3043 _refine.ls_R_factor_R_free 0.3783 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3003 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4Q7R _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 44.29 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.38 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1809 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 1888 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 32.28 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1919 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.651 ? 2606 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.955 ? 715 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 267 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 343 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.13 . . 133 2584 100.00 . . . . 0.3696 . . . . . . . . . . . 0.4592 'X-RAY DIFFRACTION' 2.13 2.29 . . 145 2589 100.00 . . . . 0.3647 . . . . . . . . . . . 0.4285 'X-RAY DIFFRACTION' 2.29 2.52 . . 138 2587 100.00 . . . . 0.3448 . . . . . . . . . . . 0.4281 'X-RAY DIFFRACTION' 2.52 2.88 . . 131 2610 100.00 . . . . 0.3712 . . . . . . . . . . . 0.4502 'X-RAY DIFFRACTION' 2.88 3.63 . . 141 2613 100.00 . . . . 0.2937 . . . . . . . . . . . 0.4006 'X-RAY DIFFRACTION' 3.63 32.28 . . 136 2628 100.00 . . . . 0.2047 . . . . . . . . . . . 0.2556 # _struct.entry_id 9LD9 _struct.title ;Crystal structure of LSSmOrange under room temperature at pH 8.0, 250ps after pump laser, refined against 8.33 times extrapolated structure factor ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9LD9 _struct_keywords.text 'Fluorescent Protein, Neutral pH, TR-SFX, room temperature' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D0VWW2_DISSP _struct_ref.pdbx_db_accession D0VWW2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTAKLKVTKGGPLPFAWDILSPQFGYGSKAYVKH PADIPDYFKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDG ALKGEIKMRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9LD9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 233 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D0VWW2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 236 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -4 _struct_ref_seq.pdbx_auth_seq_align_end 231 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9LD9 VAL A 49 ? UNP D0VWW2 ALA 49 'engineered mutation' 44 1 1 9LD9 OFM A 70 ? UNP D0VWW2 PHE 70 chromophore 66 2 1 9LD9 OFM A 70 ? UNP D0VWW2 GLY 71 chromophore 66 3 1 9LD9 OFM A 70 ? UNP D0VWW2 TYR 72 chromophore 66 4 1 9LD9 LEU A 85 ? UNP D0VWW2 PHE 88 'engineered mutation' 83 5 1 9LD9 MET A 145 ? UNP D0VWW2 TRP 148 'engineered mutation' 143 6 1 9LD9 ASP A 163 ? UNP D0VWW2 ILE 166 'engineered mutation' 161 7 1 9LD9 LEU A 165 ? UNP D0VWW2 MET 168 'engineered mutation' 163 8 1 9LD9 ASP A 198 ? UNP D0VWW2 GLY 201 'engineered mutation' 196 9 1 9LD9 LEU A 234 ? UNP D0VWW2 ? ? 'expression tag' 232 10 1 9LD9 GLU A 235 ? UNP D0VWW2 ? ? 'expression tag' 233 11 1 9LD9 HIS A 236 ? UNP D0VWW2 ? ? 'expression tag' 234 12 1 9LD9 HIS A 237 ? UNP D0VWW2 ? ? 'expression tag' 235 13 1 9LD9 HIS A 238 ? UNP D0VWW2 ? ? 'expression tag' 236 14 1 9LD9 HIS A 239 ? UNP D0VWW2 ? ? 'expression tag' 237 15 1 9LD9 HIS A 240 ? UNP D0VWW2 ? ? 'expression tag' 238 16 1 9LD9 HIS A 241 ? UNP D0VWW2 ? ? 'expression tag' 239 17 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 62 ? LEU A 66 ? ALA A 57 LEU A 61 5 ? 5 HELX_P HELX_P2 AA2 SER A 71 ? VAL A 75 ? SER A 69 VAL A 73 5 ? 5 HELX_P HELX_P3 AA3 ASP A 83 ? SER A 88 ? ASP A 81 SER A 86 1 ? 6 HELX_P HELX_P4 AA4 ASP A 229 ? HIS A 239 ? ASP A 227 HIS A 237 5 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLN 69 C ? ? ? 1_555 A OFM 70 N0 ? ? A GLN 64 A OFM 66 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A OFM 70 C3 ? ? ? 1_555 A SER 71 N ? ? A OFM 66 A SER 69 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id OFM _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 70 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id OFM _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 66 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id 'PHE, THR, TYR, GLY' _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id OFM _pdbx_modification_feature.type None _pdbx_modification_feature.category Chromophore/chromophore-like # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 57 A . ? GLY 52 A PRO 58 A ? PRO 53 A 1 0.41 2 PHE 89 A . ? PHE 87 A PRO 90 A ? PRO 88 A 1 7.29 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 13 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 142 ? MET A 145 ? THR A 140 MET A 143 AA1 2 LEU A 159 ? LEU A 169 ? LEU A 157 LEU A 167 AA1 3 HIS A 174 ? ALA A 185 ? HIS A 172 ALA A 183 AA1 4 PHE A 93 ? PHE A 101 ? PHE A 91 PHE A 99 AA1 5 VAL A 106 ? GLN A 116 ? VAL A 104 GLN A 114 AA1 6 GLU A 119 ? THR A 129 ? GLU A 117 THR A 127 AA1 7 MET A 17 ? VAL A 27 ? MET A 12 VAL A 22 AA1 8 HIS A 30 ? GLY A 40 ? HIS A 25 GLY A 35 AA1 9 PHE A 46 ? LYS A 55 ? PHE A 41 LYS A 50 AA1 10 ILE A 212 ? HIS A 223 ? ILE A 210 HIS A 221 AA1 11 TYR A 195 ? HIS A 206 ? TYR A 193 HIS A 204 AA1 12 SER A 148 ? PRO A 154 ? SER A 146 PRO A 152 AA1 13 LEU A 159 ? LEU A 169 ? LEU A 157 LEU A 167 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 144 ? N GLY A 142 O LYS A 168 ? O LYS A 166 AA1 2 3 N LEU A 159 ? N LEU A 157 O TYR A 183 ? O TYR A 181 AA1 3 4 O GLU A 178 ? O GLU A 176 N ASN A 100 ? N ASN A 98 AA1 4 5 N MET A 99 ? N MET A 97 O VAL A 107 ? O VAL A 105 AA1 5 6 N GLN A 116 ? N GLN A 114 O GLU A 119 ? O GLU A 117 AA1 6 7 O TYR A 122 ? O TYR A 120 N LYS A 20 ? N LYS A 15 AA1 7 8 N MET A 23 ? N MET A 18 O ILE A 34 ? O ILE A 29 AA1 8 9 N GLU A 37 ? N GLU A 32 O LYS A 50 ? O LYS A 45 AA1 9 10 N LEU A 51 ? N LEU A 46 O VAL A 213 ? O VAL A 211 AA1 10 11 O TYR A 216 ? O TYR A 214 N ASP A 202 ? N ASP A 200 AA1 11 12 O ILE A 199 ? O ILE A 197 N SER A 148 ? N SER A 146 AA1 12 13 N TYR A 153 ? N TYR A 151 O LYS A 160 ? O LYS A 158 # _pdbx_entry_details.entry_id 9LD9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 153 ? ? -165.46 119.64 2 1 HIS A 204 ? ? -176.54 147.63 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A OFM 70 A OFM 66 ? PHE chromophore 2 A OFM 70 A OFM 66 ? GLY chromophore 3 A OFM 70 A OFM 66 ? TYR chromophore # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -4 ? A MET 1 2 1 Y 1 A VAL -3 ? A VAL 2 3 1 Y 1 A SER -2 ? A SER 3 4 1 Y 1 A LYS -1 ? A LYS 4 5 1 Y 1 A GLY 0 ? A GLY 5 6 1 Y 1 A GLU 1 ? A GLU 6 7 1 Y 1 A GLU 2 ? A GLU 7 8 1 Y 1 A ASN 3 ? A ASN 8 9 1 Y 1 A ASN 4 ? A ASN 9 10 1 Y 1 A MET 5 ? A MET 10 11 1 Y 1 A GLY 224 ? A GLY 226 12 1 Y 1 A GLY 225 ? A GLY 227 13 1 Y 1 A MET 226 ? A MET 228 14 1 Y 1 A HIS 239 ? A HIS 241 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 OFM N0 N N N 236 OFM CA0 C N S 237 OFM C0 C N R 238 OFM O0 O N N 239 OFM CB0 C N N 240 OFM CG0 C Y N 241 OFM CDX C Y N 242 OFM CDY C Y N 243 OFM CEX C Y N 244 OFM CEY C Y N 245 OFM CZ0 C Y N 246 OFM N1 N N N 247 OFM CA1 C N N 248 OFM CB1 C N R 249 OFM CG1 C N N 250 OFM OG1 O N N 251 OFM C1 C N N 252 OFM N2 N N N 253 OFM N3 N N N 254 OFM C2 C N N 255 OFM O2 O N N 256 OFM CA2 C N N 257 OFM CA3 C N N 258 OFM C3 C N N 259 OFM O3 O N N 260 OFM CB2 C N N 261 OFM CG2 C Y N 262 OFM CD1 C Y N 263 OFM CD2 C Y N 264 OFM CE1 C Y N 265 OFM CE2 C Y N 266 OFM CZ C Y N 267 OFM OH O N N 268 OFM H H N N 269 OFM H2 H N N 270 OFM H4 H N N 271 OFM H5 H N N 272 OFM H6 H N N 273 OFM H7 H N N 274 OFM H8 H N N 275 OFM H9 H N N 276 OFM H10 H N N 277 OFM H11 H N N 278 OFM H12 H N N 279 OFM H13 H N N 280 OFM H14 H N N 281 OFM H15 H N N 282 OFM H16 H N N 283 OFM HA31 H N N 284 OFM HA32 H N N 285 OFM H20 H N N 286 OFM H21 H N N 287 OFM H22 H N N 288 OFM H23 H N N 289 OFM H24 H N N 290 OFM H25 H N N 291 OFM OXT O N N 292 OFM HXT H N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 OFM OH CZ sing N N 224 OFM CZ CE2 doub Y N 225 OFM CZ CE1 sing Y N 226 OFM CE2 CD2 sing Y N 227 OFM CE1 CD1 doub Y N 228 OFM CD2 CG2 doub Y N 229 OFM CD1 CG2 sing Y N 230 OFM CG2 CB2 sing N N 231 OFM CB2 CA2 doub N Z 232 OFM CA2 N2 sing N N 233 OFM CA2 C2 sing N N 234 OFM N2 C1 doub N N 235 OFM CG1 CB1 sing N N 236 OFM C2 O2 doub N N 237 OFM C2 N3 sing N N 238 OFM C1 N3 sing N N 239 OFM C1 CA1 sing N N 240 OFM CB1 CA1 sing N N 241 OFM CB1 OG1 sing N N 242 OFM N3 CA3 sing N N 243 OFM CA1 N1 doub N N 244 OFM OG1 C0 sing N N 245 OFM CA3 C3 sing N N 246 OFM N1 C0 sing N N 247 OFM C0 O0 sing N N 248 OFM C0 CA0 sing N N 249 OFM N0 CA0 sing N N 250 OFM C3 O3 doub N N 251 OFM CA0 CB0 sing N N 252 OFM CB0 CG0 sing N N 253 OFM CDX CG0 doub Y N 254 OFM CDX CEX sing Y N 255 OFM CG0 CDY sing Y N 256 OFM CEX CZ0 doub Y N 257 OFM CDY CEY doub Y N 258 OFM CZ0 CEY sing Y N 259 OFM N0 H sing N N 260 OFM N0 H2 sing N N 261 OFM CA0 H4 sing N N 262 OFM O0 H5 sing N N 263 OFM CB0 H6 sing N N 264 OFM CB0 H7 sing N N 265 OFM CDX H8 sing N N 266 OFM CDY H9 sing N N 267 OFM CEX H10 sing N N 268 OFM CEY H11 sing N N 269 OFM CZ0 H12 sing N N 270 OFM CB1 H13 sing N N 271 OFM CG1 H14 sing N N 272 OFM CG1 H15 sing N N 273 OFM CG1 H16 sing N N 274 OFM CA3 HA31 sing N N 275 OFM CA3 HA32 sing N N 276 OFM CB2 H20 sing N N 277 OFM CD1 H21 sing N N 278 OFM CD2 H22 sing N N 279 OFM CE1 H23 sing N N 280 OFM CE2 H24 sing N N 281 OFM OH H25 sing N N 282 OFM C3 OXT sing N N 283 OFM OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'KU Leuven' Belgium C14/16/053 1 'Japan Agency for Medical Research and Development (AMED)' Japan JP23ama121001 2 'Japan Society for the Promotion of Science (JSPS)' Japan 24H02262 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4q7r _pdbx_initial_refinement_model.details ? # _pdbx_serial_crystallography_data_reduction.diffrn_id 1 _pdbx_serial_crystallography_data_reduction.frames_total ? _pdbx_serial_crystallography_data_reduction.xfel_pulse_events ? _pdbx_serial_crystallography_data_reduction.frame_hits 40831 _pdbx_serial_crystallography_data_reduction.crystal_hits ? _pdbx_serial_crystallography_data_reduction.droplet_hits ? _pdbx_serial_crystallography_data_reduction.frames_failed_index ? _pdbx_serial_crystallography_data_reduction.frames_indexed 37331 _pdbx_serial_crystallography_data_reduction.lattices_indexed ? _pdbx_serial_crystallography_data_reduction.xfel_run_numbers ? _pdbx_serial_crystallography_data_reduction.lattices_merged ? # _pdbx_serial_crystallography_measurement.diffrn_id 1 _pdbx_serial_crystallography_measurement.pulse_energy ? _pdbx_serial_crystallography_measurement.pulse_duration 12 _pdbx_serial_crystallography_measurement.xfel_pulse_repetition_rate 30 _pdbx_serial_crystallography_measurement.pulse_photon_energy 10 _pdbx_serial_crystallography_measurement.photons_per_pulse ? _pdbx_serial_crystallography_measurement.source_size ? _pdbx_serial_crystallography_measurement.source_distance ? _pdbx_serial_crystallography_measurement.focal_spot_size ? _pdbx_serial_crystallography_measurement.collimation ? _pdbx_serial_crystallography_measurement.collection_time_total ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method injection # _pdbx_serial_crystallography_sample_delivery_injection.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery_injection.description 'High viscocity' _pdbx_serial_crystallography_sample_delivery_injection.injector_diameter ? _pdbx_serial_crystallography_sample_delivery_injection.injector_temperature 293 _pdbx_serial_crystallography_sample_delivery_injection.injector_pressure ? _pdbx_serial_crystallography_sample_delivery_injection.flow_rate ? _pdbx_serial_crystallography_sample_delivery_injection.carrier_solvent ? _pdbx_serial_crystallography_sample_delivery_injection.crystal_concentration ? _pdbx_serial_crystallography_sample_delivery_injection.preparation ? _pdbx_serial_crystallography_sample_delivery_injection.power_by HPLC _pdbx_serial_crystallography_sample_delivery_injection.injector_nozzle gas _pdbx_serial_crystallography_sample_delivery_injection.jet_diameter ? _pdbx_serial_crystallography_sample_delivery_injection.filter_size ? # _atom_sites.entry_id 9LD9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.025974 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009867 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011641 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026743 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #