data_9LLW # _entry.id 9LLW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9LLW pdb_00009llw 10.2210/pdb9llw/pdb WWPDB D_1300055873 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-07-16 ? 2 'Structure model' 1 1 2025-11-19 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9LLW _pdbx_database_status.recvd_initial_deposition_date 2025-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details '9LKS contains the same proteins but lacks 2 residues at N-terminal and seven residues at the C-terminal' _pdbx_database_related.db_id 9LKS _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email kvengadesan@rcb.res.in _pdbx_contact_author.name_first Vengadesan _pdbx_contact_author.name_last Krishnan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8083-0121 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sharma, V.' 1 0009-0002-6234-4223 'Krishnan, V.' 2 0000-0002-8083-0121 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 292 _citation.language ? _citation.page_first 5723 _citation.page_last 5749 _citation.title 'Structural basis of Ebp pilus shaft formation and anchoring in vancomycin-resistant Enterococci.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.70173 _citation.pdbx_database_id_PubMed 40608565 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sharma, V.' 1 ? primary 'Krishnan, V.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isopeptide-forming domain-containing fimbrial protein' 20740.203 1 ? ? ? 'A truncated form of Shaft pilin EbpC, refers to database WP_002388874.1' 2 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMNGESAQLVIHKKKMTDLPDPLIQNSGKEMSEFDKYQGLADVTFSIYNVTSEFYEQRAAG ASVDAAKQAVQSLTPGKPVAQGTTDANGNVTVQLPKKQNGKDAVYTIKEEPKEGVVAATNMVVAFPVYEMIKQADGSYKY GTEELAVVHIYPKNVVANDGSLHVLEHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMNGESAQLVIHKKKMTDLPDPLIQNSGKEMSEFDKYQGLADVTFSIYNVTSEFYEQRAAG ASVDAAKQAVQSLTPGKPVAQGTTDANGNVTVQLPKKQNGKDAVYTIKEEPKEGVVAATNMVVAFPVYEMIKQADGSYKY GTEELAVVHIYPKNVVANDGSLHVLEHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ASN n 1 23 GLY n 1 24 GLU n 1 25 SER n 1 26 ALA n 1 27 GLN n 1 28 LEU n 1 29 VAL n 1 30 ILE n 1 31 HIS n 1 32 LYS n 1 33 LYS n 1 34 LYS n 1 35 MET n 1 36 THR n 1 37 ASP n 1 38 LEU n 1 39 PRO n 1 40 ASP n 1 41 PRO n 1 42 LEU n 1 43 ILE n 1 44 GLN n 1 45 ASN n 1 46 SER n 1 47 GLY n 1 48 LYS n 1 49 GLU n 1 50 MET n 1 51 SER n 1 52 GLU n 1 53 PHE n 1 54 ASP n 1 55 LYS n 1 56 TYR n 1 57 GLN n 1 58 GLY n 1 59 LEU n 1 60 ALA n 1 61 ASP n 1 62 VAL n 1 63 THR n 1 64 PHE n 1 65 SER n 1 66 ILE n 1 67 TYR n 1 68 ASN n 1 69 VAL n 1 70 THR n 1 71 SER n 1 72 GLU n 1 73 PHE n 1 74 TYR n 1 75 GLU n 1 76 GLN n 1 77 ARG n 1 78 ALA n 1 79 ALA n 1 80 GLY n 1 81 ALA n 1 82 SER n 1 83 VAL n 1 84 ASP n 1 85 ALA n 1 86 ALA n 1 87 LYS n 1 88 GLN n 1 89 ALA n 1 90 VAL n 1 91 GLN n 1 92 SER n 1 93 LEU n 1 94 THR n 1 95 PRO n 1 96 GLY n 1 97 LYS n 1 98 PRO n 1 99 VAL n 1 100 ALA n 1 101 GLN n 1 102 GLY n 1 103 THR n 1 104 THR n 1 105 ASP n 1 106 ALA n 1 107 ASN n 1 108 GLY n 1 109 ASN n 1 110 VAL n 1 111 THR n 1 112 VAL n 1 113 GLN n 1 114 LEU n 1 115 PRO n 1 116 LYS n 1 117 LYS n 1 118 GLN n 1 119 ASN n 1 120 GLY n 1 121 LYS n 1 122 ASP n 1 123 ALA n 1 124 VAL n 1 125 TYR n 1 126 THR n 1 127 ILE n 1 128 LYS n 1 129 GLU n 1 130 GLU n 1 131 PRO n 1 132 LYS n 1 133 GLU n 1 134 GLY n 1 135 VAL n 1 136 VAL n 1 137 ALA n 1 138 ALA n 1 139 THR n 1 140 ASN n 1 141 MET n 1 142 VAL n 1 143 VAL n 1 144 ALA n 1 145 PHE n 1 146 PRO n 1 147 VAL n 1 148 TYR n 1 149 GLU n 1 150 MET n 1 151 ILE n 1 152 LYS n 1 153 GLN n 1 154 ALA n 1 155 ASP n 1 156 GLY n 1 157 SER n 1 158 TYR n 1 159 LYS n 1 160 TYR n 1 161 GLY n 1 162 THR n 1 163 GLU n 1 164 GLU n 1 165 LEU n 1 166 ALA n 1 167 VAL n 1 168 VAL n 1 169 HIS n 1 170 ILE n 1 171 TYR n 1 172 PRO n 1 173 LYS n 1 174 ASN n 1 175 VAL n 1 176 VAL n 1 177 ALA n 1 178 ASN n 1 179 ASP n 1 180 GLY n 1 181 SER n 1 182 LEU n 1 183 HIS n 1 184 VAL n 1 185 LEU n 1 186 GLU n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 190 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EbpC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecalis OG1RF' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 474186 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 14 ? ? ? A . n A 1 2 GLY 2 15 ? ? ? A . n A 1 3 SER 3 16 ? ? ? A . n A 1 4 SER 4 17 ? ? ? A . n A 1 5 HIS 5 18 ? ? ? A . n A 1 6 HIS 6 19 ? ? ? A . n A 1 7 HIS 7 20 ? ? ? A . n A 1 8 HIS 8 21 ? ? ? A . n A 1 9 HIS 9 22 ? ? ? A . n A 1 10 HIS 10 23 ? ? ? A . n A 1 11 SER 11 24 ? ? ? A . n A 1 12 SER 12 25 ? ? ? A . n A 1 13 GLY 13 26 ? ? ? A . n A 1 14 LEU 14 27 ? ? ? A . n A 1 15 VAL 15 28 ? ? ? A . n A 1 16 PRO 16 29 ? ? ? A . n A 1 17 ARG 17 30 ? ? ? A . n A 1 18 GLY 18 31 ? ? ? A . n A 1 19 SER 19 32 ? ? ? A . n A 1 20 HIS 20 33 ? ? ? A . n A 1 21 MET 21 34 ? ? ? A . n A 1 22 ASN 22 35 ? ? ? A . n A 1 23 GLY 23 36 ? ? ? A . n A 1 24 GLU 24 37 37 GLU GLU A . n A 1 25 SER 25 38 38 SER SER A . n A 1 26 ALA 26 39 39 ALA ALA A . n A 1 27 GLN 27 40 40 GLN GLN A . n A 1 28 LEU 28 41 41 LEU LEU A . n A 1 29 VAL 29 42 42 VAL VAL A . n A 1 30 ILE 30 43 43 ILE ILE A . n A 1 31 HIS 31 44 44 HIS HIS A . n A 1 32 LYS 32 45 45 LYS LYS A . n A 1 33 LYS 33 46 46 LYS LYS A . n A 1 34 LYS 34 47 47 LYS LYS A . n A 1 35 MET 35 48 48 MET MET A . n A 1 36 THR 36 49 ? ? ? A . n A 1 37 ASP 37 50 ? ? ? A . n A 1 38 LEU 38 51 ? ? ? A . n A 1 39 PRO 39 52 ? ? ? A . n A 1 40 ASP 40 53 ? ? ? A . n A 1 41 PRO 41 54 ? ? ? A . n A 1 42 LEU 42 55 ? ? ? A . n A 1 43 ILE 43 56 ? ? ? A . n A 1 44 GLN 44 57 ? ? ? A . n A 1 45 ASN 45 58 ? ? ? A . n A 1 46 SER 46 59 ? ? ? A . n A 1 47 GLY 47 60 60 GLY GLY A . n A 1 48 LYS 48 61 61 LYS LYS A . n A 1 49 GLU 49 62 62 GLU GLU A . n A 1 50 MET 50 63 63 MET MET A . n A 1 51 SER 51 64 64 SER SER A . n A 1 52 GLU 52 65 65 GLU GLU A . n A 1 53 PHE 53 66 66 PHE PHE A . n A 1 54 ASP 54 67 67 ASP ASP A . n A 1 55 LYS 55 68 68 LYS LYS A . n A 1 56 TYR 56 69 69 TYR TYR A . n A 1 57 GLN 57 70 70 GLN GLN A . n A 1 58 GLY 58 71 71 GLY GLY A . n A 1 59 LEU 59 72 72 LEU LEU A . n A 1 60 ALA 60 73 73 ALA ALA A . n A 1 61 ASP 61 74 74 ASP ASP A . n A 1 62 VAL 62 75 75 VAL VAL A . n A 1 63 THR 63 76 76 THR THR A . n A 1 64 PHE 64 77 77 PHE PHE A . n A 1 65 SER 65 78 78 SER SER A . n A 1 66 ILE 66 79 79 ILE ILE A . n A 1 67 TYR 67 80 80 TYR TYR A . n A 1 68 ASN 68 81 81 ASN ASN A . n A 1 69 VAL 69 82 82 VAL VAL A . n A 1 70 THR 70 83 83 THR THR A . n A 1 71 SER 71 84 84 SER SER A . n A 1 72 GLU 72 85 85 GLU GLU A . n A 1 73 PHE 73 86 86 PHE PHE A . n A 1 74 TYR 74 87 87 TYR TYR A . n A 1 75 GLU 75 88 88 GLU GLU A . n A 1 76 GLN 76 89 89 GLN GLN A . n A 1 77 ARG 77 90 90 ARG ARG A . n A 1 78 ALA 78 91 91 ALA ALA A . n A 1 79 ALA 79 92 92 ALA ALA A . n A 1 80 GLY 80 93 93 GLY GLY A . n A 1 81 ALA 81 94 94 ALA ALA A . n A 1 82 SER 82 95 95 SER SER A . n A 1 83 VAL 83 96 96 VAL VAL A . n A 1 84 ASP 84 97 97 ASP ASP A . n A 1 85 ALA 85 98 98 ALA ALA A . n A 1 86 ALA 86 99 99 ALA ALA A . n A 1 87 LYS 87 100 100 LYS LYS A . n A 1 88 GLN 88 101 101 GLN GLN A . n A 1 89 ALA 89 102 102 ALA ALA A . n A 1 90 VAL 90 103 103 VAL VAL A . n A 1 91 GLN 91 104 104 GLN GLN A . n A 1 92 SER 92 105 105 SER SER A . n A 1 93 LEU 93 106 106 LEU LEU A . n A 1 94 THR 94 107 107 THR THR A . n A 1 95 PRO 95 108 108 PRO PRO A . n A 1 96 GLY 96 109 109 GLY GLY A . n A 1 97 LYS 97 110 110 LYS LYS A . n A 1 98 PRO 98 111 111 PRO PRO A . n A 1 99 VAL 99 112 112 VAL VAL A . n A 1 100 ALA 100 113 113 ALA ALA A . n A 1 101 GLN 101 114 114 GLN GLN A . n A 1 102 GLY 102 115 115 GLY GLY A . n A 1 103 THR 103 116 116 THR THR A . n A 1 104 THR 104 117 117 THR THR A . n A 1 105 ASP 105 118 118 ASP ASP A . n A 1 106 ALA 106 119 119 ALA ALA A . n A 1 107 ASN 107 120 120 ASN ASN A . n A 1 108 GLY 108 121 121 GLY GLY A . n A 1 109 ASN 109 122 122 ASN ASN A . n A 1 110 VAL 110 123 123 VAL VAL A . n A 1 111 THR 111 124 124 THR THR A . n A 1 112 VAL 112 125 125 VAL VAL A . n A 1 113 GLN 113 126 126 GLN GLN A . n A 1 114 LEU 114 127 127 LEU LEU A . n A 1 115 PRO 115 128 128 PRO PRO A . n A 1 116 LYS 116 129 129 LYS LYS A . n A 1 117 LYS 117 130 130 LYS LYS A . n A 1 118 GLN 118 131 131 GLN GLN A . n A 1 119 ASN 119 132 132 ASN ASN A . n A 1 120 GLY 120 133 133 GLY GLY A . n A 1 121 LYS 121 134 134 LYS LYS A . n A 1 122 ASP 122 135 135 ASP ASP A . n A 1 123 ALA 123 136 136 ALA ALA A . n A 1 124 VAL 124 137 137 VAL VAL A . n A 1 125 TYR 125 138 138 TYR TYR A . n A 1 126 THR 126 139 139 THR THR A . n A 1 127 ILE 127 140 140 ILE ILE A . n A 1 128 LYS 128 141 141 LYS LYS A . n A 1 129 GLU 129 142 142 GLU GLU A . n A 1 130 GLU 130 143 143 GLU GLU A . n A 1 131 PRO 131 144 144 PRO PRO A . n A 1 132 LYS 132 145 145 LYS LYS A . n A 1 133 GLU 133 146 146 GLU GLU A . n A 1 134 GLY 134 147 147 GLY GLY A . n A 1 135 VAL 135 148 148 VAL VAL A . n A 1 136 VAL 136 149 149 VAL VAL A . n A 1 137 ALA 137 150 150 ALA ALA A . n A 1 138 ALA 138 151 151 ALA ALA A . n A 1 139 THR 139 152 152 THR THR A . n A 1 140 ASN 140 153 153 ASN ASN A . n A 1 141 MET 141 154 154 MET MET A . n A 1 142 VAL 142 155 155 VAL VAL A . n A 1 143 VAL 143 156 156 VAL VAL A . n A 1 144 ALA 144 157 157 ALA ALA A . n A 1 145 PHE 145 158 158 PHE PHE A . n A 1 146 PRO 146 159 159 PRO PRO A . n A 1 147 VAL 147 160 160 VAL VAL A . n A 1 148 TYR 148 161 161 TYR TYR A . n A 1 149 GLU 149 162 162 GLU GLU A . n A 1 150 MET 150 163 163 MET MET A . n A 1 151 ILE 151 164 164 ILE ILE A . n A 1 152 LYS 152 165 165 LYS LYS A . n A 1 153 GLN 153 166 166 GLN GLN A . n A 1 154 ALA 154 167 167 ALA ALA A . n A 1 155 ASP 155 168 168 ASP ASP A . n A 1 156 GLY 156 169 169 GLY GLY A . n A 1 157 SER 157 170 170 SER SER A . n A 1 158 TYR 158 171 171 TYR TYR A . n A 1 159 LYS 159 172 172 LYS LYS A . n A 1 160 TYR 160 173 173 TYR TYR A . n A 1 161 GLY 161 174 174 GLY GLY A . n A 1 162 THR 162 175 175 THR THR A . n A 1 163 GLU 163 176 176 GLU GLU A . n A 1 164 GLU 164 177 177 GLU GLU A . n A 1 165 LEU 165 178 178 LEU LEU A . n A 1 166 ALA 166 179 179 ALA ALA A . n A 1 167 VAL 167 180 180 VAL VAL A . n A 1 168 VAL 168 181 181 VAL VAL A . n A 1 169 HIS 169 182 182 HIS HIS A . n A 1 170 ILE 170 183 183 ILE ILE A . n A 1 171 TYR 171 184 184 TYR TYR A . n A 1 172 PRO 172 185 185 PRO PRO A . n A 1 173 LYS 173 186 186 LYS LYS A . n A 1 174 ASN 174 187 187 ASN ASN A . n A 1 175 VAL 175 188 ? ? ? A . n A 1 176 VAL 176 189 ? ? ? A . n A 1 177 ALA 177 190 ? ? ? A . n A 1 178 ASN 178 191 ? ? ? A . n A 1 179 ASP 179 192 ? ? ? A . n A 1 180 GLY 180 193 ? ? ? A . n A 1 181 SER 181 194 ? ? ? A . n A 1 182 LEU 182 195 ? ? ? A . n A 1 183 HIS 183 196 ? ? ? A . n A 1 184 VAL 184 197 ? ? ? A . n A 1 185 LEU 185 198 ? ? ? A . n A 1 186 GLU 186 199 ? ? ? A . n A 1 187 HIS 187 200 ? ? ? A . n A 1 188 HIS 188 201 ? ? ? A . n A 1 189 HIS 189 202 ? ? ? A . n A 1 190 HIS 190 203 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 34 HOH HOH A . B 2 HOH 2 302 17 HOH HOH A . B 2 HOH 3 303 12 HOH HOH A . B 2 HOH 4 304 14 HOH HOH A . B 2 HOH 5 305 18 HOH HOH A . B 2 HOH 6 306 27 HOH HOH A . B 2 HOH 7 307 6 HOH HOH A . B 2 HOH 8 308 16 HOH HOH A . B 2 HOH 9 309 7 HOH HOH A . B 2 HOH 10 310 24 HOH HOH A . B 2 HOH 11 311 19 HOH HOH A . B 2 HOH 12 312 5 HOH HOH A . B 2 HOH 13 313 33 HOH HOH A . B 2 HOH 14 314 21 HOH HOH A . B 2 HOH 15 315 10 HOH HOH A . B 2 HOH 16 316 2 HOH HOH A . B 2 HOH 17 317 11 HOH HOH A . B 2 HOH 18 318 9 HOH HOH A . B 2 HOH 19 319 28 HOH HOH A . B 2 HOH 20 320 23 HOH HOH A . B 2 HOH 21 321 15 HOH HOH A . B 2 HOH 22 322 35 HOH HOH A . B 2 HOH 23 323 29 HOH HOH A . B 2 HOH 24 324 3 HOH HOH A . B 2 HOH 25 325 31 HOH HOH A . B 2 HOH 26 326 4 HOH HOH A . B 2 HOH 27 327 13 HOH HOH A . B 2 HOH 28 328 30 HOH HOH A . B 2 HOH 29 329 8 HOH HOH A . B 2 HOH 30 330 25 HOH HOH A . B 2 HOH 31 331 36 HOH HOH A . B 2 HOH 32 332 26 HOH HOH A . B 2 HOH 33 333 20 HOH HOH A . B 2 HOH 34 334 32 HOH HOH A . B 2 HOH 35 335 1 HOH HOH A . B 2 HOH 36 336 22 HOH HOH A . B 2 HOH 37 337 38 HOH HOH A . B 2 HOH 38 338 37 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 47 ? CG ? A LYS 34 CG 2 1 Y 1 A LYS 47 ? CD ? A LYS 34 CD 3 1 Y 1 A LYS 47 ? CE ? A LYS 34 CE 4 1 Y 1 A LYS 47 ? NZ ? A LYS 34 NZ 5 1 Y 1 A MET 48 ? CG ? A MET 35 CG 6 1 Y 1 A MET 48 ? SD ? A MET 35 SD 7 1 Y 1 A MET 48 ? CE ? A MET 35 CE 8 1 Y 1 A LYS 68 ? CG ? A LYS 55 CG 9 1 Y 1 A LYS 68 ? CD ? A LYS 55 CD 10 1 Y 1 A LYS 68 ? CE ? A LYS 55 CE 11 1 Y 1 A LYS 68 ? NZ ? A LYS 55 NZ 12 1 Y 1 A ASP 97 ? CG ? A ASP 84 CG 13 1 Y 1 A ASP 97 ? OD1 ? A ASP 84 OD1 14 1 Y 1 A ASP 97 ? OD2 ? A ASP 84 OD2 15 1 Y 1 A ASN 132 ? CG ? A ASN 119 CG 16 1 Y 1 A ASN 132 ? OD1 ? A ASN 119 OD1 17 1 Y 1 A ASN 132 ? ND2 ? A ASN 119 ND2 18 1 Y 1 A MET 163 ? CG ? A MET 150 CG 19 1 Y 1 A MET 163 ? SD ? A MET 150 SD 20 1 Y 1 A MET 163 ? CE ? A MET 150 CE 21 1 Y 1 A ILE 164 ? CG1 ? A ILE 151 CG1 22 1 Y 1 A ILE 164 ? CG2 ? A ILE 151 CG2 23 1 Y 1 A ILE 164 ? CD1 ? A ILE 151 CD1 24 1 Y 1 A ASP 168 ? CG ? A ASP 155 CG 25 1 Y 1 A ASP 168 ? OD1 ? A ASP 155 OD1 26 1 Y 1 A ASP 168 ? OD2 ? A ASP 155 OD2 27 1 Y 1 A SER 170 ? OG ? A SER 157 OG 28 1 Y 1 A TYR 171 ? CG ? A TYR 158 CG 29 1 Y 1 A TYR 171 ? CD1 ? A TYR 158 CD1 30 1 Y 1 A TYR 171 ? CD2 ? A TYR 158 CD2 31 1 Y 1 A TYR 171 ? CE1 ? A TYR 158 CE1 32 1 Y 1 A TYR 171 ? CE2 ? A TYR 158 CE2 33 1 Y 1 A TYR 171 ? CZ ? A TYR 158 CZ 34 1 Y 1 A TYR 171 ? OH ? A TYR 158 OH 35 1 Y 1 A THR 175 ? OG1 ? A THR 162 OG1 36 1 Y 1 A THR 175 ? CG2 ? A THR 162 CG2 37 1 Y 1 A GLU 176 ? CG ? A GLU 163 CG 38 1 Y 1 A GLU 176 ? CD ? A GLU 163 CD 39 1 Y 1 A GLU 176 ? OE1 ? A GLU 163 OE1 40 1 Y 1 A GLU 176 ? OE2 ? A GLU 163 OE2 41 1 Y 1 A ASN 187 ? CG ? A ASN 174 CG 42 1 Y 1 A ASN 187 ? OD1 ? A ASN 174 OD1 43 1 Y 1 A ASN 187 ? ND2 ? A ASN 174 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9LLW _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.296 _cell.length_a_esd ? _cell.length_b 67.296 _cell.length_b_esd ? _cell.length_c 108.300 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9LLW _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9LLW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 27.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM CHES-NaOH, pH 9.5 30% (w/v) PEG 3000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 295 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-11-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ELETTRA BEAMLINE 11.2C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 11.2C _diffrn_source.pdbx_synchrotron_site ELETTRA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9LLW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.99 _reflns.d_resolution_low 51.37 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9867 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 34.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.073 _reflns.pdbx_Rpim_I_all 0.012 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half .99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.99 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 493 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 32.5 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all .61 _reflns_shell.pdbx_Rpim_I_all .10 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half .94 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.60 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.87 _refine.aniso_B[1][2] 0.44 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.87 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -2.83 _refine.B_iso_max ? _refine.B_iso_mean 39.633 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9LLW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.99 _refine.ls_d_res_low 51.37 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9365 _refine.ls_number_reflns_R_free 502 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.36 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18636 _refine.ls_R_factor_R_free 0.24192 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18340 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.169 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 10.345 _refine.overall_SU_ML 0.129 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.99 _refine_hist.d_res_low 51.37 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1068 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1030 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.012 1050 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 992 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.518 1.831 1423 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.515 1.757 2284 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.107 5.000 138 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 6.328 5.000 1 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.702 10.000 170 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.068 0.200 164 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1210 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 214 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 10.209 4.125 558 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 10.147 4.124 558 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 15.004 7.385 694 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 15.007 7.386 695 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 10.628 4.436 492 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 10.620 4.440 493 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 15.861 7.922 730 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 23.300 48.61 4164 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 23.277 48.60 4153 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 3.592 3.000 2042 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.994 _refine_ls_shell.d_res_low 2.046 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 715 _refine_ls_shell.percent_reflns_obs 99.34 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.182 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.239 # _struct.entry_id 9LLW _struct.title 'Crystal Structure of N-terminal flexible domain of the Shaft pilin EbpC from Enterococcus faecalis.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9LLW _struct_keywords.text 'Shaft Pilin, Isopeptide bond, Ebp pili, CAUTI, Pathogenic Bacteria., CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9LLW _struct_ref.pdbx_db_accession 9LLW _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9LLW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 190 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9LLW _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 203 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 14 _struct_ref_seq.pdbx_auth_seq_align_end 203 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein elutes as a Monomer in the Gel Filtration.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 50 ? TYR A 56 ? MET A 63 TYR A 69 5 ? 7 HELX_P HELX_P2 AA2 VAL A 69 ? ALA A 79 ? VAL A 82 ALA A 92 1 ? 11 HELX_P HELX_P3 AA3 SER A 82 ? GLN A 91 ? SER A 95 GLN A 104 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 145 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 146 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.39 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 109 ? PRO A 115 ? ASN A 122 PRO A 128 AA1 2 SER A 25 ? HIS A 31 ? SER A 38 HIS A 44 AA1 3 VAL A 167 ? ILE A 170 ? VAL A 180 ILE A 183 AA2 1 ALA A 100 ? THR A 103 ? ALA A 113 THR A 116 AA2 2 THR A 63 ? ASN A 68 ? THR A 76 ASN A 81 AA2 3 VAL A 124 ? GLU A 129 ? VAL A 137 GLU A 142 AA2 4 MET A 141 ? ALA A 144 ? MET A 154 ALA A 157 AA3 1 LYS A 117 ? GLN A 118 ? LYS A 130 GLN A 131 AA3 2 LYS A 121 ? ASP A 122 ? LYS A 134 ASP A 135 AA4 1 MET A 150 ? LYS A 152 ? MET A 163 LYS A 165 AA4 2 TYR A 158 ? TYR A 160 ? TYR A 171 TYR A 173 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 110 ? O VAL A 123 N ILE A 30 ? N ILE A 43 AA1 2 3 N GLN A 27 ? N GLN A 40 O VAL A 168 ? O VAL A 181 AA2 1 2 O GLY A 102 ? O GLY A 115 N PHE A 64 ? N PHE A 77 AA2 2 3 N SER A 65 ? N SER A 78 O LYS A 128 ? O LYS A 141 AA2 3 4 N ILE A 127 ? N ILE A 140 O MET A 141 ? O MET A 154 AA3 1 2 N GLN A 118 ? N GLN A 131 O LYS A 121 ? O LYS A 134 AA4 1 2 N ILE A 151 ? N ILE A 164 O LYS A 159 ? O LYS A 172 # _pdbx_entry_details.entry_id 9LLW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 167 ? ? -58.94 106.44 2 1 ASP A 168 ? ? 39.79 58.94 3 1 SER A 170 ? ? 49.89 -153.62 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 14 ? A MET 1 2 1 Y 1 A GLY 15 ? A GLY 2 3 1 Y 1 A SER 16 ? A SER 3 4 1 Y 1 A SER 17 ? A SER 4 5 1 Y 1 A HIS 18 ? A HIS 5 6 1 Y 1 A HIS 19 ? A HIS 6 7 1 Y 1 A HIS 20 ? A HIS 7 8 1 Y 1 A HIS 21 ? A HIS 8 9 1 Y 1 A HIS 22 ? A HIS 9 10 1 Y 1 A HIS 23 ? A HIS 10 11 1 Y 1 A SER 24 ? A SER 11 12 1 Y 1 A SER 25 ? A SER 12 13 1 Y 1 A GLY 26 ? A GLY 13 14 1 Y 1 A LEU 27 ? A LEU 14 15 1 Y 1 A VAL 28 ? A VAL 15 16 1 Y 1 A PRO 29 ? A PRO 16 17 1 Y 1 A ARG 30 ? A ARG 17 18 1 Y 1 A GLY 31 ? A GLY 18 19 1 Y 1 A SER 32 ? A SER 19 20 1 Y 1 A HIS 33 ? A HIS 20 21 1 Y 1 A MET 34 ? A MET 21 22 1 Y 1 A ASN 35 ? A ASN 22 23 1 Y 1 A GLY 36 ? A GLY 23 24 1 Y 1 A THR 49 ? A THR 36 25 1 Y 1 A ASP 50 ? A ASP 37 26 1 Y 1 A LEU 51 ? A LEU 38 27 1 Y 1 A PRO 52 ? A PRO 39 28 1 Y 1 A ASP 53 ? A ASP 40 29 1 Y 1 A PRO 54 ? A PRO 41 30 1 Y 1 A LEU 55 ? A LEU 42 31 1 Y 1 A ILE 56 ? A ILE 43 32 1 Y 1 A GLN 57 ? A GLN 44 33 1 Y 1 A ASN 58 ? A ASN 45 34 1 Y 1 A SER 59 ? A SER 46 35 1 Y 1 A VAL 188 ? A VAL 175 36 1 Y 1 A VAL 189 ? A VAL 176 37 1 Y 1 A ALA 190 ? A ALA 177 38 1 Y 1 A ASN 191 ? A ASN 178 39 1 Y 1 A ASP 192 ? A ASP 179 40 1 Y 1 A GLY 193 ? A GLY 180 41 1 Y 1 A SER 194 ? A SER 181 42 1 Y 1 A LEU 195 ? A LEU 182 43 1 Y 1 A HIS 196 ? A HIS 183 44 1 Y 1 A VAL 197 ? A VAL 184 45 1 Y 1 A LEU 198 ? A LEU 185 46 1 Y 1 A GLU 199 ? A GLU 186 47 1 Y 1 A HIS 200 ? A HIS 187 48 1 Y 1 A HIS 201 ? A HIS 188 49 1 Y 1 A HIS 202 ? A HIS 189 50 1 Y 1 A HIS 203 ? A HIS 190 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number BT/PR44816/MED/29/1598/2022 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9LKS _pdbx_initial_refinement_model.details 'N-terminal domain of Endocarditis and biofilm-associated pilus major subunit EbpC' # _atom_sites.entry_id 9LLW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014860 _atom_sites.fract_transf_matrix[1][2] 0.008579 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017159 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009234 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #