data_9M1Y # _entry.id 9M1Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9M1Y pdb_00009m1y 10.2210/pdb9m1y/pdb WWPDB D_1300056842 ? ? BMRB 36731 ? 10.13018/BMR36731 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-09-03 ? 2 'Structure model' 2 0 2025-09-10 ? 3 'Structure model' 2 1 2026-03-18 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Structure summary' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_poly_seq_scheme 3 2 'Structure model' pdbx_validate_torsion 4 2 'Structure model' struct_ref_seq 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' citation 7 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.auth_seq_id' 2 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_seq_num' 3 2 'Structure model' '_pdbx_validate_torsion.auth_seq_id' 4 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 5 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 6 2 'Structure model' '_struct_ref_seq_dif.pdbx_auth_seq_num' 7 3 'Structure model' '_citation.journal_abbrev' 8 3 'Structure model' '_citation.journal_id_CSD' 9 3 'Structure model' '_citation.journal_id_ISSN' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.pdbx_database_id_DOI' 14 3 'Structure model' '_citation.pdbx_database_id_PubMed' 15 3 'Structure model' '_citation.title' 16 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9M1Y _pdbx_database_status.recvd_initial_deposition_date 2025-02-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR Structure of Mouse Keratin 17 Tail Domain (G390 - R433) in solution' _pdbx_database_related.db_id 36731 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 4 leech@dgist.ac.kr Chang-Hun Lee ? 'principal investigator/group leader' 0000-0002-3806-1170 5 jinhaekim@dgist.ac.kr 'Jin Hae' Kim ? 'principal investigator/group leader' 0000-0002-6776-2451 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yeom, J.' 1 0009-0003-3189-7690 'Lee, C.H.' 2 0000-0002-3806-1170 'Kim, J.H.' 3 0000-0002-6776-2451 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Eur J Cell Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1618-1298 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 104 _citation.language ? _citation.page_first 151519 _citation.page_last 151519 _citation.title 'Structure and function of the keratin 17 tail domain associated with keratin intermediate filament organization.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ejcb.2025.151519 _citation.pdbx_database_id_PubMed 41043210 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yeom, J.' 1 ? primary 'Lee, S.' 2 ? primary 'Ko, Y.H.' 3 ? primary 'Hong, E.' 4 ? primary 'Kim, J.H.' 5 ? primary 'Coulombe, P.A.' 6 ? primary 'Lee, C.H.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Keratin, type I cytoskeletal 17' _entity.formula_weight 5329.866 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Cytokeratin-17,CK-17,Keratin-17,K17 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSTGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR _entity_poly.pdbx_seq_one_letter_code_can GSTGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 GLY n 1 5 GLU n 1 6 ASP n 1 7 ALA n 1 8 HIS n 1 9 LEU n 1 10 THR n 1 11 GLN n 1 12 TYR n 1 13 LYS n 1 14 PRO n 1 15 LYS n 1 16 GLU n 1 17 PRO n 1 18 VAL n 1 19 THR n 1 20 THR n 1 21 ARG n 1 22 GLN n 1 23 VAL n 1 24 ARG n 1 25 THR n 1 26 ILE n 1 27 VAL n 1 28 GLU n 1 29 GLU n 1 30 VAL n 1 31 GLN n 1 32 ASP n 1 33 GLY n 1 34 LYS n 1 35 VAL n 1 36 ILE n 1 37 SER n 1 38 SER n 1 39 ARG n 1 40 GLU n 1 41 GLN n 1 42 VAL n 1 43 HIS n 1 44 GLN n 1 45 THR n 1 46 THR n 1 47 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 47 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Krt17, Krt1-17' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 387 1 GLY GLY A . n A 1 2 SER 2 388 2 SER SER A . n A 1 3 THR 3 389 3 THR THR A . n A 1 4 GLY 4 390 4 GLY GLY A . n A 1 5 GLU 5 391 5 GLU GLU A . n A 1 6 ASP 6 392 6 ASP ASP A . n A 1 7 ALA 7 393 7 ALA ALA A . n A 1 8 HIS 8 394 8 HIS HIS A . n A 1 9 LEU 9 395 9 LEU LEU A . n A 1 10 THR 10 396 10 THR THR A . n A 1 11 GLN 11 397 11 GLN GLN A . n A 1 12 TYR 12 398 12 TYR TYR A . n A 1 13 LYS 13 399 13 LYS LYS A . n A 1 14 PRO 14 400 14 PRO PRO A . n A 1 15 LYS 15 401 15 LYS LYS A . n A 1 16 GLU 16 402 16 GLU GLU A . n A 1 17 PRO 17 403 17 PRO PRO A . n A 1 18 VAL 18 404 18 VAL VAL A . n A 1 19 THR 19 405 19 THR THR A . n A 1 20 THR 20 406 20 THR THR A . n A 1 21 ARG 21 407 21 ARG ARG A . n A 1 22 GLN 22 408 22 GLN GLN A . n A 1 23 VAL 23 409 23 VAL VAL A . n A 1 24 ARG 24 410 24 ARG ARG A . n A 1 25 THR 25 411 25 THR THR A . n A 1 26 ILE 26 412 26 ILE ILE A . n A 1 27 VAL 27 413 27 VAL VAL A . n A 1 28 GLU 28 414 28 GLU GLU A . n A 1 29 GLU 29 415 29 GLU GLU A . n A 1 30 VAL 30 416 30 VAL VAL A . n A 1 31 GLN 31 417 31 GLN GLN A . n A 1 32 ASP 32 418 32 ASP ASP A . n A 1 33 GLY 33 419 33 GLY GLY A . n A 1 34 LYS 34 420 34 LYS LYS A . n A 1 35 VAL 35 421 35 VAL VAL A . n A 1 36 ILE 36 422 36 ILE ILE A . n A 1 37 SER 37 423 37 SER SER A . n A 1 38 SER 38 424 38 SER SER A . n A 1 39 ARG 39 425 39 ARG ARG A . n A 1 40 GLU 40 426 40 GLU GLU A . n A 1 41 GLN 41 427 41 GLN GLN A . n A 1 42 VAL 42 428 42 VAL VAL A . n A 1 43 HIS 43 429 43 HIS HIS A . n A 1 44 GLN 44 430 44 GLN GLN A . n A 1 45 THR 45 431 45 THR THR A . n A 1 46 THR 46 432 46 THR THR A . n A 1 47 ARG 47 433 47 ARG ARG A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9M1Y _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9M1Y _struct.title 'NMR Structure of Mouse Keratin 17 Tail Domain (G390 - R433) in solution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9M1Y _struct_keywords.text 'K17, IDR, Cytosolic protein, Keratin, Intermediate filament' _struct_keywords.pdbx_keywords 'CYTOSOLIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code K1C17_MOUSE _struct_ref.pdbx_db_accession Q9QWL7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR _struct_ref.pdbx_align_begin 390 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9M1Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9QWL7 _struct_ref_seq.db_align_beg 390 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 433 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 390 _struct_ref_seq.pdbx_auth_seq_align_end 433 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9M1Y GLY A 1 ? UNP Q9QWL7 ? ? 'expression tag' 387 1 1 9M1Y SER A 2 ? UNP Q9QWL7 ? ? 'expression tag' 388 2 1 9M1Y THR A 3 ? UNP Q9QWL7 ? ? 'expression tag' 389 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _pdbx_entry_details.entry_id 9M1Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 414 ? ? -165.17 94.77 2 1 VAL A 421 ? ? 63.65 78.58 3 1 SER A 423 ? ? -149.89 -36.67 4 2 GLU A 414 ? ? -165.79 92.35 5 3 VAL A 409 ? ? -68.07 88.94 6 3 GLU A 414 ? ? -163.50 104.95 7 3 SER A 423 ? ? -151.48 86.34 8 4 GLU A 414 ? ? -151.28 -70.40 9 4 ARG A 425 ? ? -145.40 -35.24 10 5 GLU A 414 ? ? -160.82 32.53 11 5 SER A 423 ? ? -152.54 10.36 12 5 SER A 424 ? ? 65.13 -80.37 13 6 VAL A 404 ? ? -159.69 -50.76 14 6 GLU A 414 ? ? -140.10 -60.44 15 6 GLU A 415 ? ? 55.81 82.62 16 6 SER A 423 ? ? 55.94 99.12 17 6 ARG A 425 ? ? -130.77 -40.87 18 7 ILE A 412 ? ? 66.23 -76.54 19 7 GLU A 414 ? ? -164.31 103.33 20 8 GLN A 408 ? ? 61.40 152.56 21 8 GLU A 414 ? ? -157.62 -62.67 22 8 GLU A 415 ? ? 58.15 98.82 23 8 SER A 423 ? ? -164.98 -42.38 24 9 ALA A 393 ? ? 63.30 70.40 25 9 VAL A 409 ? ? 62.72 89.49 26 9 GLU A 414 ? ? -146.17 12.69 27 9 SER A 424 ? ? 61.22 171.81 28 9 VAL A 428 ? ? 62.59 89.64 29 10 THR A 406 ? ? 72.75 -3.42 30 10 ARG A 410 ? ? 60.28 -177.54 31 10 GLU A 414 ? ? -164.84 95.41 32 10 VAL A 421 ? ? 45.01 81.66 33 10 SER A 424 ? ? 58.19 165.30 34 11 VAL A 404 ? ? -139.05 -35.75 35 11 GLU A 414 ? ? -164.38 93.75 36 11 VAL A 421 ? ? 62.43 79.32 37 11 SER A 423 ? ? -173.40 36.61 38 12 ARG A 410 ? ? 59.72 -177.55 39 12 THR A 411 ? ? 61.12 87.76 40 12 GLU A 414 ? ? -163.96 96.42 41 13 VAL A 404 ? ? -135.29 -39.89 42 13 LYS A 420 ? ? 60.64 91.65 43 13 GLU A 426 ? ? 61.09 -178.55 44 13 VAL A 428 ? ? -146.99 -40.08 45 14 THR A 406 ? ? 61.44 158.57 46 14 VAL A 409 ? ? 59.63 82.45 47 14 GLU A 414 ? ? -159.99 35.29 48 14 VAL A 421 ? ? 62.41 111.28 49 15 LEU A 395 ? ? 61.76 94.97 50 15 GLN A 408 ? ? 58.66 -177.46 51 15 VAL A 409 ? ? 61.48 90.71 52 15 GLU A 414 ? ? -170.39 26.22 53 15 GLN A 427 ? ? 59.05 -176.66 54 16 VAL A 413 ? ? 62.76 147.72 55 16 GLU A 414 ? ? -167.47 46.43 56 17 VAL A 409 ? ? -67.76 89.68 57 17 GLU A 414 ? ? -164.66 92.94 58 17 VAL A 421 ? ? 73.22 91.60 59 17 ARG A 425 ? ? -170.29 67.26 60 17 GLU A 426 ? ? 63.59 -78.24 # _pdbx_nmr_ensemble.entry_id 9M1Y _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 17 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9M1Y _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.34 mg/mL [U-13C; U-15N] Keratin 17 (G390-R433), 50 mM sodium phosphate, 7 % [U-2H] D2O, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Keratin 17 (G390-R433)' 0.34 ? mg/mL '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 D2O 7 ? % '[U-2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 283 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label pH _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCA' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '2D 1H-13C HSQC' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic 8 1 1 '3D 1H-15N NOESY' 1 isotropic 7 1 1 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 9M1Y _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 4 'peak picking' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 PRO N N N N 196 PRO CA C N S 197 PRO C C N N 198 PRO O O N N 199 PRO CB C N N 200 PRO CG C N N 201 PRO CD C N N 202 PRO OXT O N N 203 PRO H H N N 204 PRO HA H N N 205 PRO HB2 H N N 206 PRO HB3 H N N 207 PRO HG2 H N N 208 PRO HG3 H N N 209 PRO HD2 H N N 210 PRO HD3 H N N 211 PRO HXT H N N 212 SER N N N N 213 SER CA C N S 214 SER C C N N 215 SER O O N N 216 SER CB C N N 217 SER OG O N N 218 SER OXT O N N 219 SER H H N N 220 SER H2 H N N 221 SER HA H N N 222 SER HB2 H N N 223 SER HB3 H N N 224 SER HG H N N 225 SER HXT H N N 226 THR N N N N 227 THR CA C N S 228 THR C C N N 229 THR O O N N 230 THR CB C N R 231 THR OG1 O N N 232 THR CG2 C N N 233 THR OXT O N N 234 THR H H N N 235 THR H2 H N N 236 THR HA H N N 237 THR HB H N N 238 THR HG1 H N N 239 THR HG21 H N N 240 THR HG22 H N N 241 THR HG23 H N N 242 THR HXT H N N 243 TYR N N N N 244 TYR CA C N S 245 TYR C C N N 246 TYR O O N N 247 TYR CB C N N 248 TYR CG C Y N 249 TYR CD1 C Y N 250 TYR CD2 C Y N 251 TYR CE1 C Y N 252 TYR CE2 C Y N 253 TYR CZ C Y N 254 TYR OH O N N 255 TYR OXT O N N 256 TYR H H N N 257 TYR H2 H N N 258 TYR HA H N N 259 TYR HB2 H N N 260 TYR HB3 H N N 261 TYR HD1 H N N 262 TYR HD2 H N N 263 TYR HE1 H N N 264 TYR HE2 H N N 265 TYR HH H N N 266 TYR HXT H N N 267 VAL N N N N 268 VAL CA C N S 269 VAL C C N N 270 VAL O O N N 271 VAL CB C N N 272 VAL CG1 C N N 273 VAL CG2 C N N 274 VAL OXT O N N 275 VAL H H N N 276 VAL H2 H N N 277 VAL HA H N N 278 VAL HB H N N 279 VAL HG11 H N N 280 VAL HG12 H N N 281 VAL HG13 H N N 282 VAL HG21 H N N 283 VAL HG22 H N N 284 VAL HG23 H N N 285 VAL HXT H N N 286 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 PRO N CA sing N N 187 PRO N CD sing N N 188 PRO N H sing N N 189 PRO CA C sing N N 190 PRO CA CB sing N N 191 PRO CA HA sing N N 192 PRO C O doub N N 193 PRO C OXT sing N N 194 PRO CB CG sing N N 195 PRO CB HB2 sing N N 196 PRO CB HB3 sing N N 197 PRO CG CD sing N N 198 PRO CG HG2 sing N N 199 PRO CG HG3 sing N N 200 PRO CD HD2 sing N N 201 PRO CD HD3 sing N N 202 PRO OXT HXT sing N N 203 SER N CA sing N N 204 SER N H sing N N 205 SER N H2 sing N N 206 SER CA C sing N N 207 SER CA CB sing N N 208 SER CA HA sing N N 209 SER C O doub N N 210 SER C OXT sing N N 211 SER CB OG sing N N 212 SER CB HB2 sing N N 213 SER CB HB3 sing N N 214 SER OG HG sing N N 215 SER OXT HXT sing N N 216 THR N CA sing N N 217 THR N H sing N N 218 THR N H2 sing N N 219 THR CA C sing N N 220 THR CA CB sing N N 221 THR CA HA sing N N 222 THR C O doub N N 223 THR C OXT sing N N 224 THR CB OG1 sing N N 225 THR CB CG2 sing N N 226 THR CB HB sing N N 227 THR OG1 HG1 sing N N 228 THR CG2 HG21 sing N N 229 THR CG2 HG22 sing N N 230 THR CG2 HG23 sing N N 231 THR OXT HXT sing N N 232 TYR N CA sing N N 233 TYR N H sing N N 234 TYR N H2 sing N N 235 TYR CA C sing N N 236 TYR CA CB sing N N 237 TYR CA HA sing N N 238 TYR C O doub N N 239 TYR C OXT sing N N 240 TYR CB CG sing N N 241 TYR CB HB2 sing N N 242 TYR CB HB3 sing N N 243 TYR CG CD1 doub Y N 244 TYR CG CD2 sing Y N 245 TYR CD1 CE1 sing Y N 246 TYR CD1 HD1 sing N N 247 TYR CD2 CE2 doub Y N 248 TYR CD2 HD2 sing N N 249 TYR CE1 CZ doub Y N 250 TYR CE1 HE1 sing N N 251 TYR CE2 CZ sing Y N 252 TYR CE2 HE2 sing N N 253 TYR CZ OH sing N N 254 TYR OH HH sing N N 255 TYR OXT HXT sing N N 256 VAL N CA sing N N 257 VAL N H sing N N 258 VAL N H2 sing N N 259 VAL CA C sing N N 260 VAL CA CB sing N N 261 VAL CA HA sing N N 262 VAL C O doub N N 263 VAL C OXT sing N N 264 VAL CB CG1 sing N N 265 VAL CB CG2 sing N N 266 VAL CB HB sing N N 267 VAL CG1 HG11 sing N N 268 VAL CG1 HG12 sing N N 269 VAL CG1 HG13 sing N N 270 VAL CG2 HG21 sing N N 271 VAL CG2 HG22 sing N N 272 VAL CG2 HG23 sing N N 273 VAL OXT HXT sing N N 274 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' 2020R1A2C1099696 1 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' 2020R1I1A2074335 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9M1Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ #