data_9M85 # _entry.id 9M85 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9M85 pdb_00009m85 10.2210/pdb9m85/pdb WWPDB D_1300057278 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-03-18 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9M85 _pdbx_database_status.recvd_initial_deposition_date 2025-03-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email bbiswal@nii.ac.in _pdbx_contact_author.name_first Bichitra _pdbx_contact_author.name_last Biswal _pdbx_contact_author.name_mi Kumar _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5927-3244 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Singla, M.' 1 ? 'Goyal, S.' 2 ? 'Kumar, V.' 3 ? 'Kumar, V.' 4 ? 'Kar, D.' 5 ? 'Aneja, S.' 6 ? 'Pal, R.K.' 7 ? 'Biswal, B.k.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of Mutant R121K HisB from Mycobacterium tuberculosis' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singla, M.' 1 ? primary 'Goyal, S.' 2 ? primary 'Kumar, V.' 3 ? primary 'Kumar, V.' 4 ? primary 'Kar, D.' 5 ? primary 'Aneja, S.' 6 ? primary 'Ahangar, M.S.' 7 ? primary 'Pal, R.K.' 8 ? primary 'Biswal, B.k.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Imidazoleglycerol-phosphate dehydratase' 23736.699 1 4.2.1.19 R121K ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 168 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IGPD # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHMTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAH HTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGKPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHV FESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHMTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAH HTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGKPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHV FESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 1,2-ETHANEDIOL EDO 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 THR n 1 10 THR n 1 11 THR n 1 12 GLN n 1 13 THR n 1 14 ALA n 1 15 LYS n 1 16 ALA n 1 17 SER n 1 18 ARG n 1 19 ARG n 1 20 ALA n 1 21 ARG n 1 22 ILE n 1 23 GLU n 1 24 ARG n 1 25 ARG n 1 26 THR n 1 27 ARG n 1 28 GLU n 1 29 SER n 1 30 ASP n 1 31 ILE n 1 32 VAL n 1 33 ILE n 1 34 GLU n 1 35 LEU n 1 36 ASP n 1 37 LEU n 1 38 ASP n 1 39 GLY n 1 40 THR n 1 41 GLY n 1 42 GLN n 1 43 VAL n 1 44 ALA n 1 45 VAL n 1 46 ASP n 1 47 THR n 1 48 GLY n 1 49 VAL n 1 50 PRO n 1 51 PHE n 1 52 TYR n 1 53 ASP n 1 54 HIS n 1 55 MET n 1 56 LEU n 1 57 THR n 1 58 ALA n 1 59 LEU n 1 60 GLY n 1 61 SER n 1 62 HIS n 1 63 ALA n 1 64 SER n 1 65 PHE n 1 66 ASP n 1 67 LEU n 1 68 THR n 1 69 VAL n 1 70 ARG n 1 71 ALA n 1 72 THR n 1 73 GLY n 1 74 ASP n 1 75 VAL n 1 76 GLU n 1 77 ILE n 1 78 GLU n 1 79 ALA n 1 80 HIS n 1 81 HIS n 1 82 THR n 1 83 ILE n 1 84 GLU n 1 85 ASP n 1 86 THR n 1 87 ALA n 1 88 ILE n 1 89 ALA n 1 90 LEU n 1 91 GLY n 1 92 THR n 1 93 ALA n 1 94 LEU n 1 95 GLY n 1 96 GLN n 1 97 ALA n 1 98 LEU n 1 99 GLY n 1 100 ASP n 1 101 LYS n 1 102 ARG n 1 103 GLY n 1 104 ILE n 1 105 ARG n 1 106 ARG n 1 107 PHE n 1 108 GLY n 1 109 ASP n 1 110 ALA n 1 111 PHE n 1 112 ILE n 1 113 PRO n 1 114 MET n 1 115 ASP n 1 116 GLU n 1 117 THR n 1 118 LEU n 1 119 ALA n 1 120 HIS n 1 121 ALA n 1 122 ALA n 1 123 VAL n 1 124 ASP n 1 125 LEU n 1 126 SER n 1 127 GLY n 1 128 LYS n 1 129 PRO n 1 130 TYR n 1 131 CYS n 1 132 VAL n 1 133 HIS n 1 134 THR n 1 135 GLY n 1 136 GLU n 1 137 PRO n 1 138 ASP n 1 139 HIS n 1 140 LEU n 1 141 GLN n 1 142 HIS n 1 143 THR n 1 144 THR n 1 145 ILE n 1 146 ALA n 1 147 GLY n 1 148 SER n 1 149 SER n 1 150 VAL n 1 151 PRO n 1 152 TYR n 1 153 HIS n 1 154 THR n 1 155 VAL n 1 156 ILE n 1 157 ASN n 1 158 ARG n 1 159 HIS n 1 160 VAL n 1 161 PHE n 1 162 GLU n 1 163 SER n 1 164 LEU n 1 165 ALA n 1 166 ALA n 1 167 ASN n 1 168 ALA n 1 169 ARG n 1 170 ILE n 1 171 ALA n 1 172 LEU n 1 173 HIS n 1 174 VAL n 1 175 ARG n 1 176 VAL n 1 177 LEU n 1 178 TYR n 1 179 GLY n 1 180 ARG n 1 181 ASP n 1 182 PRO n 1 183 HIS n 1 184 HIS n 1 185 ILE n 1 186 THR n 1 187 GLU n 1 188 ALA n 1 189 GLN n 1 190 TYR n 1 191 LYS n 1 192 ALA n 1 193 VAL n 1 194 ALA n 1 195 ARG n 1 196 ALA n 1 197 LEU n 1 198 ARG n 1 199 GLN n 1 200 ALA n 1 201 VAL n 1 202 GLU n 1 203 PRO n 1 204 ASP n 1 205 PRO n 1 206 ARG n 1 207 VAL n 1 208 SER n 1 209 GLY n 1 210 VAL n 1 211 PRO n 1 212 SER n 1 213 THR n 1 214 LYS n 1 215 GLY n 1 216 ALA n 1 217 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 217 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'hisB, MRA_1611' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Mycolicibacterium smegmatis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1772 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'MC2 (4517)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 HIS 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 MET 8 1 ? ? ? A . n A 1 9 THR 9 2 ? ? ? A . n A 1 10 THR 10 3 ? ? ? A . n A 1 11 THR 11 4 ? ? ? A . n A 1 12 GLN 12 5 ? ? ? A . n A 1 13 THR 13 6 ? ? ? A . n A 1 14 ALA 14 7 ? ? ? A . n A 1 15 LYS 15 8 ? ? ? A . n A 1 16 ALA 16 9 ? ? ? A . n A 1 17 SER 17 10 10 SER SER A . n A 1 18 ARG 18 11 11 ARG ARG A . n A 1 19 ARG 19 12 12 ARG ARG A . n A 1 20 ALA 20 13 13 ALA ALA A . n A 1 21 ARG 21 14 14 ARG ARG A . n A 1 22 ILE 22 15 15 ILE ILE A . n A 1 23 GLU 23 16 16 GLU GLU A . n A 1 24 ARG 24 17 17 ARG ARG A . n A 1 25 ARG 25 18 18 ARG ARG A . n A 1 26 THR 26 19 19 THR THR A . n A 1 27 ARG 27 20 20 ARG ARG A . n A 1 28 GLU 28 21 21 GLU GLU A . n A 1 29 SER 29 22 22 SER SER A . n A 1 30 ASP 30 23 23 ASP ASP A . n A 1 31 ILE 31 24 24 ILE ILE A . n A 1 32 VAL 32 25 25 VAL VAL A . n A 1 33 ILE 33 26 26 ILE ILE A . n A 1 34 GLU 34 27 27 GLU GLU A . n A 1 35 LEU 35 28 28 LEU LEU A . n A 1 36 ASP 36 29 29 ASP ASP A . n A 1 37 LEU 37 30 30 LEU LEU A . n A 1 38 ASP 38 31 31 ASP ASP A . n A 1 39 GLY 39 32 32 GLY GLY A . n A 1 40 THR 40 33 33 THR THR A . n A 1 41 GLY 41 34 34 GLY GLY A . n A 1 42 GLN 42 35 35 GLN GLN A . n A 1 43 VAL 43 36 36 VAL VAL A . n A 1 44 ALA 44 37 37 ALA ALA A . n A 1 45 VAL 45 38 38 VAL VAL A . n A 1 46 ASP 46 39 39 ASP ASP A . n A 1 47 THR 47 40 40 THR THR A . n A 1 48 GLY 48 41 41 GLY GLY A . n A 1 49 VAL 49 42 42 VAL VAL A . n A 1 50 PRO 50 43 43 PRO PRO A . n A 1 51 PHE 51 44 44 PHE PHE A . n A 1 52 TYR 52 45 45 TYR TYR A . n A 1 53 ASP 53 46 46 ASP ASP A . n A 1 54 HIS 54 47 47 HIS HIS A . n A 1 55 MET 55 48 48 MET MET A . n A 1 56 LEU 56 49 49 LEU LEU A . n A 1 57 THR 57 50 50 THR THR A . n A 1 58 ALA 58 51 51 ALA ALA A . n A 1 59 LEU 59 52 52 LEU LEU A . n A 1 60 GLY 60 53 53 GLY GLY A . n A 1 61 SER 61 54 54 SER SER A . n A 1 62 HIS 62 55 55 HIS HIS A . n A 1 63 ALA 63 56 56 ALA ALA A . n A 1 64 SER 64 57 57 SER SER A . n A 1 65 PHE 65 58 58 PHE PHE A . n A 1 66 ASP 66 59 59 ASP ASP A . n A 1 67 LEU 67 60 60 LEU LEU A . n A 1 68 THR 68 61 61 THR THR A . n A 1 69 VAL 69 62 62 VAL VAL A . n A 1 70 ARG 70 63 63 ARG ARG A . n A 1 71 ALA 71 64 64 ALA ALA A . n A 1 72 THR 72 65 65 THR THR A . n A 1 73 GLY 73 66 66 GLY GLY A . n A 1 74 ASP 74 67 67 ASP ASP A . n A 1 75 VAL 75 68 68 VAL VAL A . n A 1 76 GLU 76 69 69 GLU GLU A . n A 1 77 ILE 77 70 70 ILE ILE A . n A 1 78 GLU 78 71 71 GLU GLU A . n A 1 79 ALA 79 72 72 ALA ALA A . n A 1 80 HIS 80 73 73 HIS HIS A . n A 1 81 HIS 81 74 74 HIS HIS A . n A 1 82 THR 82 75 75 THR THR A . n A 1 83 ILE 83 76 76 ILE ILE A . n A 1 84 GLU 84 77 77 GLU GLU A . n A 1 85 ASP 85 78 78 ASP ASP A . n A 1 86 THR 86 79 79 THR THR A . n A 1 87 ALA 87 80 80 ALA ALA A . n A 1 88 ILE 88 81 81 ILE ILE A . n A 1 89 ALA 89 82 82 ALA ALA A . n A 1 90 LEU 90 83 83 LEU LEU A . n A 1 91 GLY 91 84 84 GLY GLY A . n A 1 92 THR 92 85 85 THR THR A . n A 1 93 ALA 93 86 86 ALA ALA A . n A 1 94 LEU 94 87 87 LEU LEU A . n A 1 95 GLY 95 88 88 GLY GLY A . n A 1 96 GLN 96 89 89 GLN GLN A . n A 1 97 ALA 97 90 90 ALA ALA A . n A 1 98 LEU 98 91 91 LEU LEU A . n A 1 99 GLY 99 92 92 GLY GLY A . n A 1 100 ASP 100 93 93 ASP ASP A . n A 1 101 LYS 101 94 94 LYS LYS A . n A 1 102 ARG 102 95 95 ARG ARG A . n A 1 103 GLY 103 96 96 GLY GLY A . n A 1 104 ILE 104 97 97 ILE ILE A . n A 1 105 ARG 105 98 98 ARG ARG A . n A 1 106 ARG 106 99 99 ARG ARG A . n A 1 107 PHE 107 100 100 PHE PHE A . n A 1 108 GLY 108 101 101 GLY GLY A . n A 1 109 ASP 109 102 102 ASP ASP A . n A 1 110 ALA 110 103 103 ALA ALA A . n A 1 111 PHE 111 104 104 PHE PHE A . n A 1 112 ILE 112 105 105 ILE ILE A . n A 1 113 PRO 113 106 106 PRO PRO A . n A 1 114 MET 114 107 107 MET MET A . n A 1 115 ASP 115 108 108 ASP ASP A . n A 1 116 GLU 116 109 109 GLU GLU A . n A 1 117 THR 117 110 110 THR THR A . n A 1 118 LEU 118 111 111 LEU LEU A . n A 1 119 ALA 119 112 112 ALA ALA A . n A 1 120 HIS 120 113 113 HIS HIS A . n A 1 121 ALA 121 114 114 ALA ALA A . n A 1 122 ALA 122 115 115 ALA ALA A . n A 1 123 VAL 123 116 116 VAL VAL A . n A 1 124 ASP 124 117 117 ASP ASP A . n A 1 125 LEU 125 118 118 LEU LEU A . n A 1 126 SER 126 119 119 SER SER A . n A 1 127 GLY 127 120 120 GLY GLY A . n A 1 128 LYS 128 121 121 LYS LYS A . n A 1 129 PRO 129 122 122 PRO PRO A . n A 1 130 TYR 130 123 123 TYR TYR A . n A 1 131 CYS 131 124 124 CYS CYS A . n A 1 132 VAL 132 125 125 VAL VAL A . n A 1 133 HIS 133 126 126 HIS HIS A . n A 1 134 THR 134 127 127 THR THR A . n A 1 135 GLY 135 128 128 GLY GLY A . n A 1 136 GLU 136 129 129 GLU GLU A . n A 1 137 PRO 137 130 130 PRO PRO A . n A 1 138 ASP 138 131 131 ASP ASP A . n A 1 139 HIS 139 132 132 HIS HIS A . n A 1 140 LEU 140 133 133 LEU LEU A . n A 1 141 GLN 141 134 134 GLN GLN A . n A 1 142 HIS 142 135 135 HIS HIS A . n A 1 143 THR 143 136 136 THR THR A . n A 1 144 THR 144 137 137 THR THR A . n A 1 145 ILE 145 138 138 ILE ILE A . n A 1 146 ALA 146 139 139 ALA ALA A . n A 1 147 GLY 147 140 140 GLY GLY A . n A 1 148 SER 148 141 141 SER SER A . n A 1 149 SER 149 142 142 SER SER A . n A 1 150 VAL 150 143 143 VAL VAL A . n A 1 151 PRO 151 144 144 PRO PRO A . n A 1 152 TYR 152 145 145 TYR TYR A . n A 1 153 HIS 153 146 146 HIS HIS A . n A 1 154 THR 154 147 147 THR THR A . n A 1 155 VAL 155 148 148 VAL VAL A . n A 1 156 ILE 156 149 149 ILE ILE A . n A 1 157 ASN 157 150 150 ASN ASN A . n A 1 158 ARG 158 151 151 ARG ARG A . n A 1 159 HIS 159 152 152 HIS HIS A . n A 1 160 VAL 160 153 153 VAL VAL A . n A 1 161 PHE 161 154 154 PHE PHE A . n A 1 162 GLU 162 155 155 GLU GLU A . n A 1 163 SER 163 156 156 SER SER A . n A 1 164 LEU 164 157 157 LEU LEU A . n A 1 165 ALA 165 158 158 ALA ALA A . n A 1 166 ALA 166 159 159 ALA ALA A . n A 1 167 ASN 167 160 160 ASN ASN A . n A 1 168 ALA 168 161 161 ALA ALA A . n A 1 169 ARG 169 162 162 ARG ARG A . n A 1 170 ILE 170 163 163 ILE ILE A . n A 1 171 ALA 171 164 164 ALA ALA A . n A 1 172 LEU 172 165 165 LEU LEU A . n A 1 173 HIS 173 166 166 HIS HIS A . n A 1 174 VAL 174 167 167 VAL VAL A . n A 1 175 ARG 175 168 168 ARG ARG A . n A 1 176 VAL 176 169 169 VAL VAL A . n A 1 177 LEU 177 170 170 LEU LEU A . n A 1 178 TYR 178 171 171 TYR TYR A . n A 1 179 GLY 179 172 172 GLY GLY A . n A 1 180 ARG 180 173 173 ARG ARG A . n A 1 181 ASP 181 174 174 ASP ASP A . n A 1 182 PRO 182 175 175 PRO PRO A . n A 1 183 HIS 183 176 176 HIS HIS A . n A 1 184 HIS 184 177 177 HIS HIS A . n A 1 185 ILE 185 178 178 ILE ILE A . n A 1 186 THR 186 179 179 THR THR A . n A 1 187 GLU 187 180 180 GLU GLU A . n A 1 188 ALA 188 181 181 ALA ALA A . n A 1 189 GLN 189 182 182 GLN GLN A . n A 1 190 TYR 190 183 183 TYR TYR A . n A 1 191 LYS 191 184 184 LYS LYS A . n A 1 192 ALA 192 185 185 ALA ALA A . n A 1 193 VAL 193 186 186 VAL VAL A . n A 1 194 ALA 194 187 187 ALA ALA A . n A 1 195 ARG 195 188 188 ARG ARG A . n A 1 196 ALA 196 189 189 ALA ALA A . n A 1 197 LEU 197 190 190 LEU LEU A . n A 1 198 ARG 198 191 191 ARG ARG A . n A 1 199 GLN 199 192 192 GLN GLN A . n A 1 200 ALA 200 193 193 ALA ALA A . n A 1 201 VAL 201 194 194 VAL VAL A . n A 1 202 GLU 202 195 195 GLU GLU A . n A 1 203 PRO 203 196 196 PRO PRO A . n A 1 204 ASP 204 197 197 ASP ASP A . n A 1 205 PRO 205 198 198 PRO PRO A . n A 1 206 ARG 206 199 199 ARG ARG A . n A 1 207 VAL 207 200 ? ? ? A . n A 1 208 SER 208 201 ? ? ? A . n A 1 209 GLY 209 202 ? ? ? A . n A 1 210 VAL 210 203 ? ? ? A . n A 1 211 PRO 211 204 ? ? ? A . n A 1 212 SER 212 205 ? ? ? A . n A 1 213 THR 213 206 ? ? ? A . n A 1 214 LYS 214 207 ? ? ? A . n A 1 215 GLY 215 208 ? ? ? A . n A 1 216 ALA 216 209 ? ? ? A . n A 1 217 LEU 217 210 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 301 MN MN A . C 2 MN 1 302 302 MN MN A . D 3 EDO 1 303 305 EDO EDO A . E 3 EDO 1 304 306 EDO EDO A . F 4 CL 1 305 307 CL CL A . G 5 HOH 1 401 348 HOH HOH A . G 5 HOH 2 402 382 HOH HOH A . G 5 HOH 3 403 427 HOH HOH A . G 5 HOH 4 404 408 HOH HOH A . G 5 HOH 5 405 413 HOH HOH A . G 5 HOH 6 406 404 HOH HOH A . G 5 HOH 7 407 374 HOH HOH A . G 5 HOH 8 408 360 HOH HOH A . G 5 HOH 9 409 308 HOH HOH A . G 5 HOH 10 410 383 HOH HOH A . G 5 HOH 11 411 419 HOH HOH A . G 5 HOH 12 412 347 HOH HOH A . G 5 HOH 13 413 310 HOH HOH A . G 5 HOH 14 414 328 HOH HOH A . G 5 HOH 15 415 315 HOH HOH A . G 5 HOH 16 416 345 HOH HOH A . G 5 HOH 17 417 363 HOH HOH A . G 5 HOH 18 418 313 HOH HOH A . G 5 HOH 19 419 322 HOH HOH A . G 5 HOH 20 420 375 HOH HOH A . G 5 HOH 21 421 319 HOH HOH A . G 5 HOH 22 422 331 HOH HOH A . G 5 HOH 23 423 320 HOH HOH A . G 5 HOH 24 424 312 HOH HOH A . G 5 HOH 25 425 314 HOH HOH A . G 5 HOH 26 426 410 HOH HOH A . G 5 HOH 27 427 338 HOH HOH A . G 5 HOH 28 428 453 HOH HOH A . G 5 HOH 29 429 368 HOH HOH A . G 5 HOH 30 430 439 HOH HOH A . G 5 HOH 31 431 400 HOH HOH A . G 5 HOH 32 432 364 HOH HOH A . G 5 HOH 33 433 349 HOH HOH A . G 5 HOH 34 434 474 HOH HOH A . G 5 HOH 35 435 380 HOH HOH A . G 5 HOH 36 436 309 HOH HOH A . G 5 HOH 37 437 390 HOH HOH A . G 5 HOH 38 438 352 HOH HOH A . G 5 HOH 39 439 463 HOH HOH A . G 5 HOH 40 440 435 HOH HOH A . G 5 HOH 41 441 365 HOH HOH A . G 5 HOH 42 442 414 HOH HOH A . G 5 HOH 43 443 425 HOH HOH A . G 5 HOH 44 444 316 HOH HOH A . G 5 HOH 45 445 405 HOH HOH A . G 5 HOH 46 446 389 HOH HOH A . G 5 HOH 47 447 485 HOH HOH A . G 5 HOH 48 448 351 HOH HOH A . G 5 HOH 49 449 395 HOH HOH A . G 5 HOH 50 450 406 HOH HOH A . G 5 HOH 51 451 343 HOH HOH A . G 5 HOH 52 452 397 HOH HOH A . G 5 HOH 53 453 388 HOH HOH A . G 5 HOH 54 454 371 HOH HOH A . G 5 HOH 55 455 401 HOH HOH A . G 5 HOH 56 456 457 HOH HOH A . G 5 HOH 57 457 356 HOH HOH A . G 5 HOH 58 458 324 HOH HOH A . G 5 HOH 59 459 454 HOH HOH A . G 5 HOH 60 460 437 HOH HOH A . G 5 HOH 61 461 329 HOH HOH A . G 5 HOH 62 462 361 HOH HOH A . G 5 HOH 63 463 317 HOH HOH A . G 5 HOH 64 464 446 HOH HOH A . G 5 HOH 65 465 376 HOH HOH A . G 5 HOH 66 466 354 HOH HOH A . G 5 HOH 67 467 373 HOH HOH A . G 5 HOH 68 468 434 HOH HOH A . G 5 HOH 69 469 384 HOH HOH A . G 5 HOH 70 470 326 HOH HOH A . G 5 HOH 71 471 472 HOH HOH A . G 5 HOH 72 472 366 HOH HOH A . G 5 HOH 73 473 392 HOH HOH A . G 5 HOH 74 474 5 HOH HOH A . G 5 HOH 75 475 359 HOH HOH A . G 5 HOH 76 476 337 HOH HOH A . G 5 HOH 77 477 421 HOH HOH A . G 5 HOH 78 478 325 HOH HOH A . G 5 HOH 79 479 416 HOH HOH A . G 5 HOH 80 480 340 HOH HOH A . G 5 HOH 81 481 379 HOH HOH A . G 5 HOH 82 482 385 HOH HOH A . G 5 HOH 83 483 412 HOH HOH A . G 5 HOH 84 484 323 HOH HOH A . G 5 HOH 85 485 358 HOH HOH A . G 5 HOH 86 486 431 HOH HOH A . G 5 HOH 87 487 393 HOH HOH A . G 5 HOH 88 488 428 HOH HOH A . G 5 HOH 89 489 353 HOH HOH A . G 5 HOH 90 490 321 HOH HOH A . G 5 HOH 91 491 394 HOH HOH A . G 5 HOH 92 492 480 HOH HOH A . G 5 HOH 93 493 327 HOH HOH A . G 5 HOH 94 494 355 HOH HOH A . G 5 HOH 95 495 469 HOH HOH A . G 5 HOH 96 496 466 HOH HOH A . G 5 HOH 97 497 396 HOH HOH A . G 5 HOH 98 498 438 HOH HOH A . G 5 HOH 99 499 386 HOH HOH A . G 5 HOH 100 500 381 HOH HOH A . G 5 HOH 101 501 452 HOH HOH A . G 5 HOH 102 502 369 HOH HOH A . G 5 HOH 103 503 372 HOH HOH A . G 5 HOH 104 504 424 HOH HOH A . G 5 HOH 105 505 426 HOH HOH A . G 5 HOH 106 506 341 HOH HOH A . G 5 HOH 107 507 357 HOH HOH A . G 5 HOH 108 508 399 HOH HOH A . G 5 HOH 109 509 339 HOH HOH A . G 5 HOH 110 510 442 HOH HOH A . G 5 HOH 111 511 333 HOH HOH A . G 5 HOH 112 512 464 HOH HOH A . G 5 HOH 113 513 342 HOH HOH A . G 5 HOH 114 514 335 HOH HOH A . G 5 HOH 115 515 4 HOH HOH A . G 5 HOH 116 516 367 HOH HOH A . G 5 HOH 117 517 344 HOH HOH A . G 5 HOH 118 518 467 HOH HOH A . G 5 HOH 119 519 346 HOH HOH A . G 5 HOH 120 520 429 HOH HOH A . G 5 HOH 121 521 418 HOH HOH A . G 5 HOH 122 522 391 HOH HOH A . G 5 HOH 123 523 336 HOH HOH A . G 5 HOH 124 524 403 HOH HOH A . G 5 HOH 125 525 433 HOH HOH A . G 5 HOH 126 526 482 HOH HOH A . G 5 HOH 127 527 436 HOH HOH A . G 5 HOH 128 528 423 HOH HOH A . G 5 HOH 129 529 449 HOH HOH A . G 5 HOH 130 530 370 HOH HOH A . G 5 HOH 131 531 417 HOH HOH A . G 5 HOH 132 532 415 HOH HOH A . G 5 HOH 133 533 398 HOH HOH A . G 5 HOH 134 534 332 HOH HOH A . G 5 HOH 135 535 458 HOH HOH A . G 5 HOH 136 536 440 HOH HOH A . G 5 HOH 137 537 318 HOH HOH A . G 5 HOH 138 538 350 HOH HOH A . G 5 HOH 139 539 465 HOH HOH A . G 5 HOH 140 540 2 HOH HOH A . G 5 HOH 141 541 448 HOH HOH A . G 5 HOH 142 542 432 HOH HOH A . G 5 HOH 143 543 402 HOH HOH A . G 5 HOH 144 544 462 HOH HOH A . G 5 HOH 145 545 444 HOH HOH A . G 5 HOH 146 546 362 HOH HOH A . G 5 HOH 147 547 311 HOH HOH A . G 5 HOH 148 548 377 HOH HOH A . G 5 HOH 149 549 422 HOH HOH A . G 5 HOH 150 550 430 HOH HOH A . G 5 HOH 151 551 420 HOH HOH A . G 5 HOH 152 552 3 HOH HOH A . G 5 HOH 153 553 456 HOH HOH A . G 5 HOH 154 554 443 HOH HOH A . G 5 HOH 155 555 378 HOH HOH A . G 5 HOH 156 556 409 HOH HOH A . G 5 HOH 157 557 441 HOH HOH A . G 5 HOH 158 558 407 HOH HOH A . G 5 HOH 159 559 334 HOH HOH A . G 5 HOH 160 560 451 HOH HOH A . G 5 HOH 161 561 447 HOH HOH A . G 5 HOH 162 562 461 HOH HOH A . G 5 HOH 163 563 445 HOH HOH A . G 5 HOH 164 564 459 HOH HOH A . G 5 HOH 165 565 411 HOH HOH A . G 5 HOH 166 566 330 HOH HOH A . G 5 HOH 167 567 387 HOH HOH A . G 5 HOH 168 568 479 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 20 ? CG ? A ARG 27 CG 2 1 Y 1 A ARG 20 ? CD ? A ARG 27 CD 3 1 Y 1 A ARG 20 ? NE ? A ARG 27 NE 4 1 Y 1 A ARG 20 ? CZ ? A ARG 27 CZ 5 1 Y 1 A ARG 20 ? NH1 ? A ARG 27 NH1 6 1 Y 1 A ARG 20 ? NH2 ? A ARG 27 NH2 7 1 Y 1 A ARG 95 ? CD ? A ARG 102 CD 8 1 Y 1 A ARG 95 ? NE ? A ARG 102 NE 9 1 Y 1 A ARG 95 ? CZ ? A ARG 102 CZ 10 1 Y 1 A ARG 95 ? NH1 ? A ARG 102 NH1 11 1 Y 1 A ARG 95 ? NH2 ? A ARG 102 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9M85 _cell.details ? _cell.formula_units_Z ? _cell.length_a 112.342 _cell.length_a_esd ? _cell.length_b 112.342 _cell.length_b_esd ? _cell.length_c 112.342 _cell.length_c_esd ? _cell.volume 1417837.484 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9M85 _symmetry.cell_setting ? _symmetry.Int_Tables_number 207 _symmetry.space_group_name_Hall 'P 4 2 3' _symmetry.space_group_name_H-M 'P 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9M85 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 1500, sodium citrate tribasic dehydrate, tris HCl' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-11-19 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9M85 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.83 _reflns.d_resolution_low 35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22000 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.80 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 42.39 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.83 _reflns_shell.d_res_low 1.90 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2127 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.429 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 29.23 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9M85 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.83 _refine.ls_d_res_low 32.43 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21999 _refine.ls_number_reflns_R_free 1069 _refine.ls_number_reflns_R_work 20930 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 4.86 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1634 _refine.ls_R_factor_R_free 0.1903 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1619 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.2675 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1939 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.83 _refine_hist.d_res_low 32.43 _refine_hist.number_atoms_solvent 168 _refine_hist.number_atoms_total 1636 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1457 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0071 ? 1559 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9121 ? 2136 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0611 ? 250 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0097 ? 283 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.5139 ? 582 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.83 1.91 . . 102 2579 99.67 . . . . 0.3034 . . . . . . . . . . . . . . . 0.3461 'X-RAY DIFFRACTION' 1.91 2.01 . . 127 2545 99.93 . . . . 0.2135 . . . . . . . . . . . . . . . 0.2670 'X-RAY DIFFRACTION' 2.01 2.14 . . 140 2547 100.00 . . . . 0.1855 . . . . . . . . . . . . . . . 0.2407 'X-RAY DIFFRACTION' 2.14 2.30 . . 126 2591 100.00 . . . . 0.1658 . . . . . . . . . . . . . . . 0.1803 'X-RAY DIFFRACTION' 2.31 2.54 . . 132 2591 100.00 . . . . 0.1654 . . . . . . . . . . . . . . . 0.1910 'X-RAY DIFFRACTION' 2.54 2.90 . . 131 2609 100.00 . . . . 0.1647 . . . . . . . . . . . . . . . 0.1826 'X-RAY DIFFRACTION' 2.90 3.66 . . 160 2635 99.93 . . . . 0.1451 . . . . . . . . . . . . . . . 0.1925 'X-RAY DIFFRACTION' 3.66 32.43 . . 151 2833 99.90 . . . . 0.1386 . . . . . . . . . . . . . . . 0.1578 # _struct.entry_id 9M85 _struct.title 'Crystal Structure of R121K Mutant HisB from Mycobacterium tuberculosis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9M85 _struct_keywords.text 'Dehydratase, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HIS7_MYCTA _struct_ref.pdbx_db_accession A5U2V7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTA IALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAAN ARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9M85 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 217 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A5U2V7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 210 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9M85 MET A 1 ? UNP A5U2V7 ? ? 'initiating methionine' -6 1 1 9M85 HIS A 2 ? UNP A5U2V7 ? ? 'expression tag' -5 2 1 9M85 HIS A 3 ? UNP A5U2V7 ? ? 'expression tag' -4 3 1 9M85 HIS A 4 ? UNP A5U2V7 ? ? 'expression tag' -3 4 1 9M85 HIS A 5 ? UNP A5U2V7 ? ? 'expression tag' -2 5 1 9M85 HIS A 6 ? UNP A5U2V7 ? ? 'expression tag' -1 6 1 9M85 HIS A 7 ? UNP A5U2V7 ? ? 'expression tag' 0 7 1 9M85 LYS A 128 ? UNP A5U2V7 ARG 121 'engineered mutation' 121 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 84330 ? 1 MORE -431 ? 1 'SSA (A^2)' 128040 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 49 ? ALA A 63 ? VAL A 42 ALA A 56 1 ? 15 HELX_P HELX_P2 AA2 ALA A 79 ? GLY A 99 ? ALA A 72 GLY A 92 1 ? 21 HELX_P HELX_P3 AA3 PRO A 137 ? HIS A 142 ? PRO A 130 HIS A 135 5 ? 6 HELX_P HELX_P4 AA4 VAL A 155 ? ARG A 169 ? VAL A 148 ARG A 162 1 ? 15 HELX_P HELX_P5 AA5 ASP A 181 ? GLU A 202 ? ASP A 174 GLU A 195 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 47 A MN 302 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc2 metalc ? ? A HIS 80 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 73 A MN 301 1_555 ? ? ? ? ? ? ? 2.198 ? ? metalc3 metalc ? ? A HIS 81 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 74 A MN 302 16_555 ? ? ? ? ? ? ? 2.179 ? ? metalc4 metalc ? ? A GLU 84 OE1 ? ? ? 1_555 B MN . MN ? ? A GLU 77 A MN 301 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc5 metalc ? ? A HIS 159 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 152 A MN 301 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc6 metalc ? ? A HIS 183 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 176 A MN 302 1_555 ? ? ? ? ? ? ? 2.149 ? ? metalc7 metalc ? ? A HIS 184 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 177 A MN 301 15_555 ? ? ? ? ? ? ? 2.214 ? ? metalc8 metalc ? ? A GLU 187 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 180 A MN 302 1_555 ? ? ? ? ? ? ? 2.188 ? ? metalc9 metalc ? ? B MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 301 A HOH 414 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc10 metalc ? ? B MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 301 A HOH 519 1_555 ? ? ? ? ? ? ? 2.208 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 302 A HOH 417 1_555 ? ? ? ? ? ? ? 2.228 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 302 A HOH 510 15_555 ? ? ? ? ? ? ? 2.322 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 54 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 81 ? A HIS 74 ? 1_555 56.4 ? 2 NE2 ? A HIS 54 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 183 ? A HIS 176 ? 1_555 108.2 ? 3 NE2 ? A HIS 81 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 183 ? A HIS 176 ? 1_555 54.0 ? 4 NE2 ? A HIS 54 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 187 ? A GLU 180 ? 1_555 93.0 ? 5 NE2 ? A HIS 81 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 187 ? A GLU 180 ? 1_555 76.4 ? 6 NE2 ? A HIS 183 ? A HIS 176 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 187 ? A GLU 180 ? 1_555 87.0 ? 7 NE2 ? A HIS 54 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 417 ? 1_555 83.3 ? 8 NE2 ? A HIS 81 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 417 ? 1_555 134.9 ? 9 NE2 ? A HIS 183 ? A HIS 176 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 417 ? 1_555 167.5 ? 10 OE1 ? A GLU 187 ? A GLU 180 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 417 ? 1_555 87.4 ? 11 NE2 ? A HIS 54 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 510 ? 15_555 155.7 ? 12 NE2 ? A HIS 81 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 510 ? 15_555 146.6 ? 13 NE2 ? A HIS 183 ? A HIS 176 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 510 ? 15_555 96.2 ? 14 OE1 ? A GLU 187 ? A GLU 180 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 510 ? 15_555 88.6 ? 15 O ? G HOH . ? A HOH 417 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 510 ? 15_555 72.6 ? 16 NE2 ? A HIS 80 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE1 ? A GLU 84 ? A GLU 77 ? 1_555 89.8 ? 17 NE2 ? A HIS 80 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 159 ? A HIS 152 ? 1_555 98.5 ? 18 OE1 ? A GLU 84 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 159 ? A HIS 152 ? 1_555 85.5 ? 19 NE2 ? A HIS 80 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 184 ? A HIS 177 ? 1_555 51.1 ? 20 OE1 ? A GLU 84 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 184 ? A HIS 177 ? 1_555 92.7 ? 21 NE2 ? A HIS 159 ? A HIS 152 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 184 ? A HIS 177 ? 1_555 48.0 ? 22 NE2 ? A HIS 80 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 173.1 ? 23 OE1 ? A GLU 84 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 85.5 ? 24 NE2 ? A HIS 159 ? A HIS 152 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 86.2 ? 25 NE2 ? A HIS 184 ? A HIS 177 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 134.1 ? 26 NE2 ? A HIS 80 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 519 ? 1_555 95.3 ? 27 OE1 ? A GLU 84 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 519 ? 1_555 88.2 ? 28 NE2 ? A HIS 159 ? A HIS 152 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 519 ? 1_555 164.8 ? 29 NE2 ? A HIS 184 ? A HIS 177 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 519 ? 1_555 146.3 ? 30 O ? G HOH . ? A HOH 414 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? G HOH . ? A HOH 519 ? 1_555 79.5 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 19 ? ARG A 25 ? ARG A 12 ARG A 18 AA1 2 SER A 29 ? ASP A 36 ? SER A 22 ASP A 29 AA1 3 ASP A 66 ? GLY A 73 ? ASP A 59 GLY A 66 AA1 4 VAL A 43 ? ASP A 46 ? VAL A 36 ASP A 39 AA2 1 PHE A 107 ? MET A 114 ? PHE A 100 MET A 107 AA2 2 THR A 117 ? ASP A 124 ? THR A 110 ASP A 117 AA2 3 ALA A 171 ? TYR A 178 ? ALA A 164 TYR A 171 AA2 4 TYR A 130 ? THR A 134 ? TYR A 123 THR A 127 AA3 1 THR A 144 ? ILE A 145 ? THR A 137 ILE A 138 AA3 2 TYR A 152 ? HIS A 153 ? TYR A 145 HIS A 146 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 20 ? N ALA A 13 O LEU A 35 ? O LEU A 28 AA1 2 3 N ASP A 36 ? N ASP A 29 O ASP A 66 ? O ASP A 59 AA1 3 4 O ALA A 71 ? O ALA A 64 N ASP A 46 ? N ASP A 39 AA2 1 2 N GLY A 108 ? N GLY A 101 O VAL A 123 ? O VAL A 116 AA2 2 3 N HIS A 120 ? N HIS A 113 O ARG A 175 ? O ARG A 168 AA2 3 4 O VAL A 174 ? O VAL A 167 N VAL A 132 ? N VAL A 125 AA3 1 2 N ILE A 145 ? N ILE A 138 O TYR A 152 ? O TYR A 145 # _pdbx_entry_details.entry_id 9M85 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 31 ? ? -101.27 54.15 2 1 GLU A 71 ? ? 167.24 -177.79 3 1 ARG A 99 ? ? 78.58 -53.77 4 1 ASP A 108 ? ? 48.64 -122.03 5 1 HIS A 135 ? ? -143.09 21.73 6 1 SER A 142 ? ? -132.25 -146.48 7 1 ARG A 173 ? ? -133.45 -50.65 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CL 305 ? F CL . 2 1 A HOH 502 ? G HOH . 3 1 A HOH 529 ? G HOH . 4 1 A HOH 536 ? G HOH . 5 1 A HOH 551 ? G HOH . 6 1 A HOH 568 ? G HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A HIS -5 ? A HIS 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 1 Y 1 A MET 1 ? A MET 8 9 1 Y 1 A THR 2 ? A THR 9 10 1 Y 1 A THR 3 ? A THR 10 11 1 Y 1 A THR 4 ? A THR 11 12 1 Y 1 A GLN 5 ? A GLN 12 13 1 Y 1 A THR 6 ? A THR 13 14 1 Y 1 A ALA 7 ? A ALA 14 15 1 Y 1 A LYS 8 ? A LYS 15 16 1 Y 1 A ALA 9 ? A ALA 16 17 1 Y 1 A VAL 200 ? A VAL 207 18 1 Y 1 A SER 201 ? A SER 208 19 1 Y 1 A GLY 202 ? A GLY 209 20 1 Y 1 A VAL 203 ? A VAL 210 21 1 Y 1 A PRO 204 ? A PRO 211 22 1 Y 1 A SER 205 ? A SER 212 23 1 Y 1 A THR 206 ? A THR 213 24 1 Y 1 A LYS 207 ? A LYS 214 25 1 Y 1 A GLY 208 ? A GLY 215 26 1 Y 1 A ALA 209 ? A ALA 216 27 1 Y 1 A LEU 210 ? A LEU 217 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 EDO C1 C N N 89 EDO O1 O N N 90 EDO C2 C N N 91 EDO O2 O N N 92 EDO H11 H N N 93 EDO H12 H N N 94 EDO HO1 H N N 95 EDO H21 H N N 96 EDO H22 H N N 97 EDO HO2 H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 MN MN MN N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TYR N N N N 333 TYR CA C N S 334 TYR C C N N 335 TYR O O N N 336 TYR CB C N N 337 TYR CG C Y N 338 TYR CD1 C Y N 339 TYR CD2 C Y N 340 TYR CE1 C Y N 341 TYR CE2 C Y N 342 TYR CZ C Y N 343 TYR OH O N N 344 TYR OXT O N N 345 TYR H H N N 346 TYR H2 H N N 347 TYR HA H N N 348 TYR HB2 H N N 349 TYR HB3 H N N 350 TYR HD1 H N N 351 TYR HD2 H N N 352 TYR HE1 H N N 353 TYR HE2 H N N 354 TYR HH H N N 355 TYR HXT H N N 356 VAL N N N N 357 VAL CA C N S 358 VAL C C N N 359 VAL O O N N 360 VAL CB C N N 361 VAL CG1 C N N 362 VAL CG2 C N N 363 VAL OXT O N N 364 VAL H H N N 365 VAL H2 H N N 366 VAL HA H N N 367 VAL HB H N N 368 VAL HG11 H N N 369 VAL HG12 H N N 370 VAL HG13 H N N 371 VAL HG21 H N N 372 VAL HG22 H N N 373 VAL HG23 H N N 374 VAL HXT H N N 375 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TYR N CA sing N N 315 TYR N H sing N N 316 TYR N H2 sing N N 317 TYR CA C sing N N 318 TYR CA CB sing N N 319 TYR CA HA sing N N 320 TYR C O doub N N 321 TYR C OXT sing N N 322 TYR CB CG sing N N 323 TYR CB HB2 sing N N 324 TYR CB HB3 sing N N 325 TYR CG CD1 doub Y N 326 TYR CG CD2 sing Y N 327 TYR CD1 CE1 sing Y N 328 TYR CD1 HD1 sing N N 329 TYR CD2 CE2 doub Y N 330 TYR CD2 HD2 sing N N 331 TYR CE1 CZ doub Y N 332 TYR CE1 HE1 sing N N 333 TYR CE2 CZ sing Y N 334 TYR CE2 HE2 sing N N 335 TYR CZ OH sing N N 336 TYR OH HH sing N N 337 TYR OXT HXT sing N N 338 VAL N CA sing N N 339 VAL N H sing N N 340 VAL N H2 sing N N 341 VAL CA C sing N N 342 VAL CA CB sing N N 343 VAL CA HA sing N N 344 VAL C O doub N N 345 VAL C OXT sing N N 346 VAL CB CG1 sing N N 347 VAL CB CG2 sing N N 348 VAL CB HB sing N N 349 VAL CG1 HG11 sing N N 350 VAL CG1 HG12 sing N N 351 VAL CG1 HG13 sing N N 352 VAL CG2 HG21 sing N N 353 VAL CG2 HG22 sing N N 354 VAL CG2 HG23 sing N N 355 VAL OXT HXT sing N N 356 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4GQU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9M85 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008901 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008901 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008901 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL 17 17 11.4601 0.0104 7.1962 1.1662 6.2554 18.5194 1.6455 47.7784 -9.2115 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 MN 25 25 11.2854 5.3409 7.3596 0.3432 3.0202 17.8674 2.2448 83.7543 0.5117 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.1842 # loop_ #