data_9MC1 # _entry.id 9MC1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9MC1 pdb_00009mc1 10.2210/pdb9mc1/pdb WWPDB D_1300057569 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-04-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9MC1 _pdbx_database_status.recvd_initial_deposition_date 2025-03-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email ose.toyoyuki@sci.hokudai.ac.jp _pdbx_contact_author.name_first Toyoyuki _pdbx_contact_author.name_last Ose _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2001-9388 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Takekawa, Y.' 1 0009-0009-7470-1524 'Takino, J.' 2 ? 'Sato, S.' 3 ? 'Yabuno, N.' 4 ? 'Oikawa, H.' 5 ? 'Ose, T.' 6 0000-0002-2001-9388 'Minami, A.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 761 _citation.language ? _citation.page_first 151737 _citation.page_last 151737 _citation.title 'Chain-length preference of trans-acting enoylreductases involved in the biosynthesis of fungal polyhydroxy polyketides.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2025.151737 _citation.pdbx_database_id_PubMed 40186921 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Takekawa, Y.' 1 ? primary 'Takino, J.' 2 ? primary 'Sato, S.' 3 ? primary 'Oikawa, H.' 4 ? primary 'Ose, T.' 5 ? primary 'Minami, A.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Trans-acting enoylreductase' 40083.367 1 ? ? ? ? 2 water nat water 18.015 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNHKVHHHHHHIEGRHMPHILTIKHKRGKPGAVYYPLQLKAVPKPGPPGPGEVLIRMAAAALNHRDHFIRQHLYPNISFE SPLFSDACGTVVEVGPGCKRSDELLNKLVVLVPYRGWDGDSPDGPEDWSAFATVGGTEPYRTLGGGQTWMVAAEDQVEVC PPHLSAVEGAALPSCGVTAWRALVTKCGRANVGPGRNILITGIGGGVALQALQMALALGANVYVTSGSEAKLARARQLGA KGGALYTEQDWPKIIAGLLPLAHPLLDAIVDGAGGDIVIRAVPILKPGGVIAIYGMTTAPVLDWPMQAVLKNIELRGTTL GSRAEFRDMVAFVAEHKLRPVISRTVKGLDCVDAIDGLFEDLKGGKQFGKLVIEI ; _entity_poly.pdbx_seq_one_letter_code_can ;MNHKVHHHHHHIEGRHMPHILTIKHKRGKPGAVYYPLQLKAVPKPGPPGPGEVLIRMAAAALNHRDHFIRQHLYPNISFE SPLFSDACGTVVEVGPGCKRSDELLNKLVVLVPYRGWDGDSPDGPEDWSAFATVGGTEPYRTLGGGQTWMVAAEDQVEVC PPHLSAVEGAALPSCGVTAWRALVTKCGRANVGPGRNILITGIGGGVALQALQMALALGANVYVTSGSEAKLARARQLGA KGGALYTEQDWPKIIAGLLPLAHPLLDAIVDGAGGDIVIRAVPILKPGGVIAIYGMTTAPVLDWPMQAVLKNIELRGTTL GSRAEFRDMVAFVAEHKLRPVISRTVKGLDCVDAIDGLFEDLKGGKQFGKLVIEI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 HIS n 1 4 LYS n 1 5 VAL n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 ILE n 1 13 GLU n 1 14 GLY n 1 15 ARG n 1 16 HIS n 1 17 MET n 1 18 PRO n 1 19 HIS n 1 20 ILE n 1 21 LEU n 1 22 THR n 1 23 ILE n 1 24 LYS n 1 25 HIS n 1 26 LYS n 1 27 ARG n 1 28 GLY n 1 29 LYS n 1 30 PRO n 1 31 GLY n 1 32 ALA n 1 33 VAL n 1 34 TYR n 1 35 TYR n 1 36 PRO n 1 37 LEU n 1 38 GLN n 1 39 LEU n 1 40 LYS n 1 41 ALA n 1 42 VAL n 1 43 PRO n 1 44 LYS n 1 45 PRO n 1 46 GLY n 1 47 PRO n 1 48 PRO n 1 49 GLY n 1 50 PRO n 1 51 GLY n 1 52 GLU n 1 53 VAL n 1 54 LEU n 1 55 ILE n 1 56 ARG n 1 57 MET n 1 58 ALA n 1 59 ALA n 1 60 ALA n 1 61 ALA n 1 62 LEU n 1 63 ASN n 1 64 HIS n 1 65 ARG n 1 66 ASP n 1 67 HIS n 1 68 PHE n 1 69 ILE n 1 70 ARG n 1 71 GLN n 1 72 HIS n 1 73 LEU n 1 74 TYR n 1 75 PRO n 1 76 ASN n 1 77 ILE n 1 78 SER n 1 79 PHE n 1 80 GLU n 1 81 SER n 1 82 PRO n 1 83 LEU n 1 84 PHE n 1 85 SER n 1 86 ASP n 1 87 ALA n 1 88 CYS n 1 89 GLY n 1 90 THR n 1 91 VAL n 1 92 VAL n 1 93 GLU n 1 94 VAL n 1 95 GLY n 1 96 PRO n 1 97 GLY n 1 98 CYS n 1 99 LYS n 1 100 ARG n 1 101 SER n 1 102 ASP n 1 103 GLU n 1 104 LEU n 1 105 LEU n 1 106 ASN n 1 107 LYS n 1 108 LEU n 1 109 VAL n 1 110 VAL n 1 111 LEU n 1 112 VAL n 1 113 PRO n 1 114 TYR n 1 115 ARG n 1 116 GLY n 1 117 TRP n 1 118 ASP n 1 119 GLY n 1 120 ASP n 1 121 SER n 1 122 PRO n 1 123 ASP n 1 124 GLY n 1 125 PRO n 1 126 GLU n 1 127 ASP n 1 128 TRP n 1 129 SER n 1 130 ALA n 1 131 PHE n 1 132 ALA n 1 133 THR n 1 134 VAL n 1 135 GLY n 1 136 GLY n 1 137 THR n 1 138 GLU n 1 139 PRO n 1 140 TYR n 1 141 ARG n 1 142 THR n 1 143 LEU n 1 144 GLY n 1 145 GLY n 1 146 GLY n 1 147 GLN n 1 148 THR n 1 149 TRP n 1 150 MET n 1 151 VAL n 1 152 ALA n 1 153 ALA n 1 154 GLU n 1 155 ASP n 1 156 GLN n 1 157 VAL n 1 158 GLU n 1 159 VAL n 1 160 CYS n 1 161 PRO n 1 162 PRO n 1 163 HIS n 1 164 LEU n 1 165 SER n 1 166 ALA n 1 167 VAL n 1 168 GLU n 1 169 GLY n 1 170 ALA n 1 171 ALA n 1 172 LEU n 1 173 PRO n 1 174 SER n 1 175 CYS n 1 176 GLY n 1 177 VAL n 1 178 THR n 1 179 ALA n 1 180 TRP n 1 181 ARG n 1 182 ALA n 1 183 LEU n 1 184 VAL n 1 185 THR n 1 186 LYS n 1 187 CYS n 1 188 GLY n 1 189 ARG n 1 190 ALA n 1 191 ASN n 1 192 VAL n 1 193 GLY n 1 194 PRO n 1 195 GLY n 1 196 ARG n 1 197 ASN n 1 198 ILE n 1 199 LEU n 1 200 ILE n 1 201 THR n 1 202 GLY n 1 203 ILE n 1 204 GLY n 1 205 GLY n 1 206 GLY n 1 207 VAL n 1 208 ALA n 1 209 LEU n 1 210 GLN n 1 211 ALA n 1 212 LEU n 1 213 GLN n 1 214 MET n 1 215 ALA n 1 216 LEU n 1 217 ALA n 1 218 LEU n 1 219 GLY n 1 220 ALA n 1 221 ASN n 1 222 VAL n 1 223 TYR n 1 224 VAL n 1 225 THR n 1 226 SER n 1 227 GLY n 1 228 SER n 1 229 GLU n 1 230 ALA n 1 231 LYS n 1 232 LEU n 1 233 ALA n 1 234 ARG n 1 235 ALA n 1 236 ARG n 1 237 GLN n 1 238 LEU n 1 239 GLY n 1 240 ALA n 1 241 LYS n 1 242 GLY n 1 243 GLY n 1 244 ALA n 1 245 LEU n 1 246 TYR n 1 247 THR n 1 248 GLU n 1 249 GLN n 1 250 ASP n 1 251 TRP n 1 252 PRO n 1 253 LYS n 1 254 ILE n 1 255 ILE n 1 256 ALA n 1 257 GLY n 1 258 LEU n 1 259 LEU n 1 260 PRO n 1 261 LEU n 1 262 ALA n 1 263 HIS n 1 264 PRO n 1 265 LEU n 1 266 LEU n 1 267 ASP n 1 268 ALA n 1 269 ILE n 1 270 VAL n 1 271 ASP n 1 272 GLY n 1 273 ALA n 1 274 GLY n 1 275 GLY n 1 276 ASP n 1 277 ILE n 1 278 VAL n 1 279 ILE n 1 280 ARG n 1 281 ALA n 1 282 VAL n 1 283 PRO n 1 284 ILE n 1 285 LEU n 1 286 LYS n 1 287 PRO n 1 288 GLY n 1 289 GLY n 1 290 VAL n 1 291 ILE n 1 292 ALA n 1 293 ILE n 1 294 TYR n 1 295 GLY n 1 296 MET n 1 297 THR n 1 298 THR n 1 299 ALA n 1 300 PRO n 1 301 VAL n 1 302 LEU n 1 303 ASP n 1 304 TRP n 1 305 PRO n 1 306 MET n 1 307 GLN n 1 308 ALA n 1 309 VAL n 1 310 LEU n 1 311 LYS n 1 312 ASN n 1 313 ILE n 1 314 GLU n 1 315 LEU n 1 316 ARG n 1 317 GLY n 1 318 THR n 1 319 THR n 1 320 LEU n 1 321 GLY n 1 322 SER n 1 323 ARG n 1 324 ALA n 1 325 GLU n 1 326 PHE n 1 327 ARG n 1 328 ASP n 1 329 MET n 1 330 VAL n 1 331 ALA n 1 332 PHE n 1 333 VAL n 1 334 ALA n 1 335 GLU n 1 336 HIS n 1 337 LYS n 1 338 LEU n 1 339 ARG n 1 340 PRO n 1 341 VAL n 1 342 ILE n 1 343 SER n 1 344 ARG n 1 345 THR n 1 346 VAL n 1 347 LYS n 1 348 GLY n 1 349 LEU n 1 350 ASP n 1 351 CYS n 1 352 VAL n 1 353 ASP n 1 354 ALA n 1 355 ILE n 1 356 ASP n 1 357 GLY n 1 358 LEU n 1 359 PHE n 1 360 GLU n 1 361 ASP n 1 362 LEU n 1 363 LYS n 1 364 GLY n 1 365 GLY n 1 366 LYS n 1 367 GLN n 1 368 PHE n 1 369 GLY n 1 370 LYS n 1 371 LEU n 1 372 VAL n 1 373 ILE n 1 374 GLU n 1 375 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 375 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'sp. BF-0158' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Pseudophialophora _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1524836 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -15 ? ? ? A . n A 1 2 ASN 2 -14 ? ? ? A . n A 1 3 HIS 3 -13 ? ? ? A . n A 1 4 LYS 4 -12 ? ? ? A . n A 1 5 VAL 5 -11 ? ? ? A . n A 1 6 HIS 6 -10 ? ? ? A . n A 1 7 HIS 7 -9 ? ? ? A . n A 1 8 HIS 8 -8 ? ? ? A . n A 1 9 HIS 9 -7 ? ? ? A . n A 1 10 HIS 10 -6 ? ? ? A . n A 1 11 HIS 11 -5 ? ? ? A . n A 1 12 ILE 12 -4 ? ? ? A . n A 1 13 GLU 13 -3 ? ? ? A . n A 1 14 GLY 14 -2 ? ? ? A . n A 1 15 ARG 15 -1 ? ? ? A . n A 1 16 HIS 16 0 ? ? ? A . n A 1 17 MET 17 1 ? ? ? A . n A 1 18 PRO 18 2 2 PRO PRO A . n A 1 19 HIS 19 3 3 HIS HIS A . n A 1 20 ILE 20 4 4 ILE ILE A . n A 1 21 LEU 21 5 5 LEU LEU A . n A 1 22 THR 22 6 6 THR THR A . n A 1 23 ILE 23 7 7 ILE ILE A . n A 1 24 LYS 24 8 8 LYS LYS A . n A 1 25 HIS 25 9 9 HIS HIS A . n A 1 26 LYS 26 10 10 LYS LYS A . n A 1 27 ARG 27 11 11 ARG ARG A . n A 1 28 GLY 28 12 ? ? ? A . n A 1 29 LYS 29 13 ? ? ? A . n A 1 30 PRO 30 14 ? ? ? A . n A 1 31 GLY 31 15 ? ? ? A . n A 1 32 ALA 32 16 16 ALA ALA A . n A 1 33 VAL 33 17 17 VAL VAL A . n A 1 34 TYR 34 18 18 TYR TYR A . n A 1 35 TYR 35 19 19 TYR TYR A . n A 1 36 PRO 36 20 20 PRO PRO A . n A 1 37 LEU 37 21 21 LEU LEU A . n A 1 38 GLN 38 22 22 GLN GLN A . n A 1 39 LEU 39 23 23 LEU LEU A . n A 1 40 LYS 40 24 24 LYS LYS A . n A 1 41 ALA 41 25 25 ALA ALA A . n A 1 42 VAL 42 26 26 VAL VAL A . n A 1 43 PRO 43 27 27 PRO PRO A . n A 1 44 LYS 44 28 28 LYS LYS A . n A 1 45 PRO 45 29 29 PRO PRO A . n A 1 46 GLY 46 30 30 GLY GLY A . n A 1 47 PRO 47 31 31 PRO PRO A . n A 1 48 PRO 48 32 32 PRO PRO A . n A 1 49 GLY 49 33 33 GLY GLY A . n A 1 50 PRO 50 34 34 PRO PRO A . n A 1 51 GLY 51 35 35 GLY GLY A . n A 1 52 GLU 52 36 36 GLU GLU A . n A 1 53 VAL 53 37 37 VAL VAL A . n A 1 54 LEU 54 38 38 LEU LEU A . n A 1 55 ILE 55 39 39 ILE ILE A . n A 1 56 ARG 56 40 40 ARG ARG A . n A 1 57 MET 57 41 41 MET MET A . n A 1 58 ALA 58 42 42 ALA ALA A . n A 1 59 ALA 59 43 43 ALA ALA A . n A 1 60 ALA 60 44 44 ALA ALA A . n A 1 61 ALA 61 45 45 ALA ALA A . n A 1 62 LEU 62 46 46 LEU LEU A . n A 1 63 ASN 63 47 47 ASN ASN A . n A 1 64 HIS 64 48 48 HIS HIS A . n A 1 65 ARG 65 49 49 ARG ARG A . n A 1 66 ASP 66 50 50 ASP ASP A . n A 1 67 HIS 67 51 51 HIS HIS A . n A 1 68 PHE 68 52 52 PHE PHE A . n A 1 69 ILE 69 53 53 ILE ILE A . n A 1 70 ARG 70 54 54 ARG ARG A . n A 1 71 GLN 71 55 55 GLN GLN A . n A 1 72 HIS 72 56 56 HIS HIS A . n A 1 73 LEU 73 57 57 LEU LEU A . n A 1 74 TYR 74 58 58 TYR TYR A . n A 1 75 PRO 75 59 59 PRO PRO A . n A 1 76 ASN 76 60 60 ASN ASN A . n A 1 77 ILE 77 61 61 ILE ILE A . n A 1 78 SER 78 62 62 SER SER A . n A 1 79 PHE 79 63 63 PHE PHE A . n A 1 80 GLU 80 64 64 GLU GLU A . n A 1 81 SER 81 65 65 SER SER A . n A 1 82 PRO 82 66 66 PRO PRO A . n A 1 83 LEU 83 67 67 LEU LEU A . n A 1 84 PHE 84 68 68 PHE PHE A . n A 1 85 SER 85 69 69 SER SER A . n A 1 86 ASP 86 70 70 ASP ASP A . n A 1 87 ALA 87 71 71 ALA ALA A . n A 1 88 CYS 88 72 72 CYS CYS A . n A 1 89 GLY 89 73 73 GLY GLY A . n A 1 90 THR 90 74 74 THR THR A . n A 1 91 VAL 91 75 75 VAL VAL A . n A 1 92 VAL 92 76 76 VAL VAL A . n A 1 93 GLU 93 77 77 GLU GLU A . n A 1 94 VAL 94 78 78 VAL VAL A . n A 1 95 GLY 95 79 79 GLY GLY A . n A 1 96 PRO 96 80 80 PRO PRO A . n A 1 97 GLY 97 81 81 GLY GLY A . n A 1 98 CYS 98 82 82 CYS CYS A . n A 1 99 LYS 99 83 83 LYS LYS A . n A 1 100 ARG 100 84 84 ARG ARG A . n A 1 101 SER 101 85 85 SER SER A . n A 1 102 ASP 102 86 86 ASP ASP A . n A 1 103 GLU 103 87 87 GLU GLU A . n A 1 104 LEU 104 88 88 LEU LEU A . n A 1 105 LEU 105 89 89 LEU LEU A . n A 1 106 ASN 106 90 90 ASN ASN A . n A 1 107 LYS 107 91 91 LYS LYS A . n A 1 108 LEU 108 92 92 LEU LEU A . n A 1 109 VAL 109 93 93 VAL VAL A . n A 1 110 VAL 110 94 94 VAL VAL A . n A 1 111 LEU 111 95 95 LEU LEU A . n A 1 112 VAL 112 96 96 VAL VAL A . n A 1 113 PRO 113 97 97 PRO PRO A . n A 1 114 TYR 114 98 98 TYR TYR A . n A 1 115 ARG 115 99 99 ARG ARG A . n A 1 116 GLY 116 100 100 GLY GLY A . n A 1 117 TRP 117 101 101 TRP TRP A . n A 1 118 ASP 118 102 102 ASP ASP A . n A 1 119 GLY 119 103 103 GLY GLY A . n A 1 120 ASP 120 104 104 ASP ASP A . n A 1 121 SER 121 105 105 SER SER A . n A 1 122 PRO 122 106 106 PRO PRO A . n A 1 123 ASP 123 107 107 ASP ASP A . n A 1 124 GLY 124 108 108 GLY GLY A . n A 1 125 PRO 125 109 109 PRO PRO A . n A 1 126 GLU 126 110 110 GLU GLU A . n A 1 127 ASP 127 111 111 ASP ASP A . n A 1 128 TRP 128 112 112 TRP TRP A . n A 1 129 SER 129 113 113 SER SER A . n A 1 130 ALA 130 114 114 ALA ALA A . n A 1 131 PHE 131 115 115 PHE PHE A . n A 1 132 ALA 132 116 116 ALA ALA A . n A 1 133 THR 133 117 117 THR THR A . n A 1 134 VAL 134 118 118 VAL VAL A . n A 1 135 GLY 135 119 119 GLY GLY A . n A 1 136 GLY 136 120 120 GLY GLY A . n A 1 137 THR 137 121 121 THR THR A . n A 1 138 GLU 138 122 122 GLU GLU A . n A 1 139 PRO 139 123 123 PRO PRO A . n A 1 140 TYR 140 124 124 TYR TYR A . n A 1 141 ARG 141 125 125 ARG ARG A . n A 1 142 THR 142 126 126 THR THR A . n A 1 143 LEU 143 127 127 LEU LEU A . n A 1 144 GLY 144 128 128 GLY GLY A . n A 1 145 GLY 145 129 129 GLY GLY A . n A 1 146 GLY 146 130 130 GLY GLY A . n A 1 147 GLN 147 131 131 GLN GLN A . n A 1 148 THR 148 132 132 THR THR A . n A 1 149 TRP 149 133 133 TRP TRP A . n A 1 150 MET 150 134 134 MET MET A . n A 1 151 VAL 151 135 135 VAL VAL A . n A 1 152 ALA 152 136 136 ALA ALA A . n A 1 153 ALA 153 137 137 ALA ALA A . n A 1 154 GLU 154 138 138 GLU GLU A . n A 1 155 ASP 155 139 139 ASP ASP A . n A 1 156 GLN 156 140 140 GLN GLN A . n A 1 157 VAL 157 141 141 VAL VAL A . n A 1 158 GLU 158 142 142 GLU GLU A . n A 1 159 VAL 159 143 143 VAL VAL A . n A 1 160 CYS 160 144 144 CYS CYS A . n A 1 161 PRO 161 145 145 PRO PRO A . n A 1 162 PRO 162 146 146 PRO PRO A . n A 1 163 HIS 163 147 147 HIS HIS A . n A 1 164 LEU 164 148 148 LEU LEU A . n A 1 165 SER 165 149 149 SER SER A . n A 1 166 ALA 166 150 150 ALA ALA A . n A 1 167 VAL 167 151 151 VAL VAL A . n A 1 168 GLU 168 152 152 GLU GLU A . n A 1 169 GLY 169 153 153 GLY GLY A . n A 1 170 ALA 170 154 154 ALA ALA A . n A 1 171 ALA 171 155 155 ALA ALA A . n A 1 172 LEU 172 156 156 LEU LEU A . n A 1 173 PRO 173 157 157 PRO PRO A . n A 1 174 SER 174 158 158 SER SER A . n A 1 175 CYS 175 159 159 CYS CYS A . n A 1 176 GLY 176 160 160 GLY GLY A . n A 1 177 VAL 177 161 161 VAL VAL A . n A 1 178 THR 178 162 162 THR THR A . n A 1 179 ALA 179 163 163 ALA ALA A . n A 1 180 TRP 180 164 164 TRP TRP A . n A 1 181 ARG 181 165 165 ARG ARG A . n A 1 182 ALA 182 166 166 ALA ALA A . n A 1 183 LEU 183 167 167 LEU LEU A . n A 1 184 VAL 184 168 168 VAL VAL A . n A 1 185 THR 185 169 169 THR THR A . n A 1 186 LYS 186 170 170 LYS LYS A . n A 1 187 CYS 187 171 171 CYS CYS A . n A 1 188 GLY 188 172 172 GLY GLY A . n A 1 189 ARG 189 173 173 ARG ARG A . n A 1 190 ALA 190 174 174 ALA ALA A . n A 1 191 ASN 191 175 175 ASN ASN A . n A 1 192 VAL 192 176 176 VAL VAL A . n A 1 193 GLY 193 177 177 GLY GLY A . n A 1 194 PRO 194 178 178 PRO PRO A . n A 1 195 GLY 195 179 179 GLY GLY A . n A 1 196 ARG 196 180 180 ARG ARG A . n A 1 197 ASN 197 181 181 ASN ASN A . n A 1 198 ILE 198 182 182 ILE ILE A . n A 1 199 LEU 199 183 183 LEU LEU A . n A 1 200 ILE 200 184 184 ILE ILE A . n A 1 201 THR 201 185 185 THR THR A . n A 1 202 GLY 202 186 186 GLY GLY A . n A 1 203 ILE 203 187 187 ILE ILE A . n A 1 204 GLY 204 188 188 GLY GLY A . n A 1 205 GLY 205 189 189 GLY GLY A . n A 1 206 GLY 206 190 190 GLY GLY A . n A 1 207 VAL 207 191 191 VAL VAL A . n A 1 208 ALA 208 192 192 ALA ALA A . n A 1 209 LEU 209 193 193 LEU LEU A . n A 1 210 GLN 210 194 194 GLN GLN A . n A 1 211 ALA 211 195 195 ALA ALA A . n A 1 212 LEU 212 196 196 LEU LEU A . n A 1 213 GLN 213 197 197 GLN GLN A . n A 1 214 MET 214 198 198 MET MET A . n A 1 215 ALA 215 199 199 ALA ALA A . n A 1 216 LEU 216 200 200 LEU LEU A . n A 1 217 ALA 217 201 201 ALA ALA A . n A 1 218 LEU 218 202 202 LEU LEU A . n A 1 219 GLY 219 203 203 GLY GLY A . n A 1 220 ALA 220 204 204 ALA ALA A . n A 1 221 ASN 221 205 205 ASN ASN A . n A 1 222 VAL 222 206 206 VAL VAL A . n A 1 223 TYR 223 207 207 TYR TYR A . n A 1 224 VAL 224 208 208 VAL VAL A . n A 1 225 THR 225 209 209 THR THR A . n A 1 226 SER 226 210 210 SER SER A . n A 1 227 GLY 227 211 211 GLY GLY A . n A 1 228 SER 228 212 212 SER SER A . n A 1 229 GLU 229 213 213 GLU GLU A . n A 1 230 ALA 230 214 214 ALA ALA A . n A 1 231 LYS 231 215 215 LYS LYS A . n A 1 232 LEU 232 216 216 LEU LEU A . n A 1 233 ALA 233 217 217 ALA ALA A . n A 1 234 ARG 234 218 218 ARG ARG A . n A 1 235 ALA 235 219 219 ALA ALA A . n A 1 236 ARG 236 220 220 ARG ARG A . n A 1 237 GLN 237 221 221 GLN GLN A . n A 1 238 LEU 238 222 222 LEU LEU A . n A 1 239 GLY 239 223 223 GLY GLY A . n A 1 240 ALA 240 224 224 ALA ALA A . n A 1 241 LYS 241 225 225 LYS LYS A . n A 1 242 GLY 242 226 226 GLY GLY A . n A 1 243 GLY 243 227 227 GLY GLY A . n A 1 244 ALA 244 228 228 ALA ALA A . n A 1 245 LEU 245 229 229 LEU LEU A . n A 1 246 TYR 246 230 230 TYR TYR A . n A 1 247 THR 247 231 231 THR THR A . n A 1 248 GLU 248 232 232 GLU GLU A . n A 1 249 GLN 249 233 233 GLN GLN A . n A 1 250 ASP 250 234 234 ASP ASP A . n A 1 251 TRP 251 235 235 TRP TRP A . n A 1 252 PRO 252 236 236 PRO PRO A . n A 1 253 LYS 253 237 237 LYS LYS A . n A 1 254 ILE 254 238 238 ILE ILE A . n A 1 255 ILE 255 239 239 ILE ILE A . n A 1 256 ALA 256 240 240 ALA ALA A . n A 1 257 GLY 257 241 241 GLY GLY A . n A 1 258 LEU 258 242 242 LEU LEU A . n A 1 259 LEU 259 243 243 LEU LEU A . n A 1 260 PRO 260 244 244 PRO PRO A . n A 1 261 LEU 261 245 245 LEU LEU A . n A 1 262 ALA 262 246 246 ALA ALA A . n A 1 263 HIS 263 247 247 HIS HIS A . n A 1 264 PRO 264 248 248 PRO PRO A . n A 1 265 LEU 265 249 249 LEU LEU A . n A 1 266 LEU 266 250 250 LEU LEU A . n A 1 267 ASP 267 251 251 ASP ASP A . n A 1 268 ALA 268 252 252 ALA ALA A . n A 1 269 ILE 269 253 253 ILE ILE A . n A 1 270 VAL 270 254 254 VAL VAL A . n A 1 271 ASP 271 255 255 ASP ASP A . n A 1 272 GLY 272 256 256 GLY GLY A . n A 1 273 ALA 273 257 257 ALA ALA A . n A 1 274 GLY 274 258 258 GLY GLY A . n A 1 275 GLY 275 259 259 GLY GLY A . n A 1 276 ASP 276 260 260 ASP ASP A . n A 1 277 ILE 277 261 261 ILE ILE A . n A 1 278 VAL 278 262 262 VAL VAL A . n A 1 279 ILE 279 263 263 ILE ILE A . n A 1 280 ARG 280 264 264 ARG ARG A . n A 1 281 ALA 281 265 265 ALA ALA A . n A 1 282 VAL 282 266 266 VAL VAL A . n A 1 283 PRO 283 267 267 PRO PRO A . n A 1 284 ILE 284 268 268 ILE ILE A . n A 1 285 LEU 285 269 269 LEU LEU A . n A 1 286 LYS 286 270 270 LYS LYS A . n A 1 287 PRO 287 271 271 PRO PRO A . n A 1 288 GLY 288 272 272 GLY GLY A . n A 1 289 GLY 289 273 273 GLY GLY A . n A 1 290 VAL 290 274 274 VAL VAL A . n A 1 291 ILE 291 275 275 ILE ILE A . n A 1 292 ALA 292 276 276 ALA ALA A . n A 1 293 ILE 293 277 277 ILE ILE A . n A 1 294 TYR 294 278 278 TYR TYR A . n A 1 295 GLY 295 279 279 GLY GLY A . n A 1 296 MET 296 280 280 MET MET A . n A 1 297 THR 297 281 281 THR THR A . n A 1 298 THR 298 282 282 THR THR A . n A 1 299 ALA 299 283 283 ALA ALA A . n A 1 300 PRO 300 284 284 PRO PRO A . n A 1 301 VAL 301 285 285 VAL VAL A . n A 1 302 LEU 302 286 286 LEU LEU A . n A 1 303 ASP 303 287 287 ASP ASP A . n A 1 304 TRP 304 288 288 TRP TRP A . n A 1 305 PRO 305 289 289 PRO PRO A . n A 1 306 MET 306 290 290 MET MET A . n A 1 307 GLN 307 291 291 GLN GLN A . n A 1 308 ALA 308 292 292 ALA ALA A . n A 1 309 VAL 309 293 293 VAL VAL A . n A 1 310 LEU 310 294 294 LEU LEU A . n A 1 311 LYS 311 295 295 LYS LYS A . n A 1 312 ASN 312 296 296 ASN ASN A . n A 1 313 ILE 313 297 297 ILE ILE A . n A 1 314 GLU 314 298 298 GLU GLU A . n A 1 315 LEU 315 299 299 LEU LEU A . n A 1 316 ARG 316 300 300 ARG ARG A . n A 1 317 GLY 317 301 301 GLY GLY A . n A 1 318 THR 318 302 302 THR THR A . n A 1 319 THR 319 303 303 THR THR A . n A 1 320 LEU 320 304 304 LEU LEU A . n A 1 321 GLY 321 305 305 GLY GLY A . n A 1 322 SER 322 306 306 SER SER A . n A 1 323 ARG 323 307 307 ARG ARG A . n A 1 324 ALA 324 308 308 ALA ALA A . n A 1 325 GLU 325 309 309 GLU GLU A . n A 1 326 PHE 326 310 310 PHE PHE A . n A 1 327 ARG 327 311 311 ARG ARG A . n A 1 328 ASP 328 312 312 ASP ASP A . n A 1 329 MET 329 313 313 MET MET A . n A 1 330 VAL 330 314 314 VAL VAL A . n A 1 331 ALA 331 315 315 ALA ALA A . n A 1 332 PHE 332 316 316 PHE PHE A . n A 1 333 VAL 333 317 317 VAL VAL A . n A 1 334 ALA 334 318 318 ALA ALA A . n A 1 335 GLU 335 319 319 GLU GLU A . n A 1 336 HIS 336 320 320 HIS HIS A . n A 1 337 LYS 337 321 321 LYS LYS A . n A 1 338 LEU 338 322 322 LEU LEU A . n A 1 339 ARG 339 323 323 ARG ARG A . n A 1 340 PRO 340 324 324 PRO PRO A . n A 1 341 VAL 341 325 325 VAL VAL A . n A 1 342 ILE 342 326 326 ILE ILE A . n A 1 343 SER 343 327 327 SER SER A . n A 1 344 ARG 344 328 328 ARG ARG A . n A 1 345 THR 345 329 329 THR THR A . n A 1 346 VAL 346 330 330 VAL VAL A . n A 1 347 LYS 347 331 331 LYS LYS A . n A 1 348 GLY 348 332 332 GLY GLY A . n A 1 349 LEU 349 333 333 LEU LEU A . n A 1 350 ASP 350 334 334 ASP ASP A . n A 1 351 CYS 351 335 335 CYS CYS A . n A 1 352 VAL 352 336 336 VAL VAL A . n A 1 353 ASP 353 337 337 ASP ASP A . n A 1 354 ALA 354 338 338 ALA ALA A . n A 1 355 ILE 355 339 339 ILE ILE A . n A 1 356 ASP 356 340 340 ASP ASP A . n A 1 357 GLY 357 341 341 GLY GLY A . n A 1 358 LEU 358 342 342 LEU LEU A . n A 1 359 PHE 359 343 343 PHE PHE A . n A 1 360 GLU 360 344 344 GLU GLU A . n A 1 361 ASP 361 345 345 ASP ASP A . n A 1 362 LEU 362 346 346 LEU LEU A . n A 1 363 LYS 363 347 347 LYS LYS A . n A 1 364 GLY 364 348 348 GLY GLY A . n A 1 365 GLY 365 349 349 GLY GLY A . n A 1 366 LYS 366 350 350 LYS LYS A . n A 1 367 GLN 367 351 351 GLN GLN A . n A 1 368 PHE 368 352 352 PHE PHE A . n A 1 369 GLY 369 353 353 GLY GLY A . n A 1 370 LYS 370 354 354 LYS LYS A . n A 1 371 LEU 371 355 355 LEU LEU A . n A 1 372 VAL 372 356 356 VAL VAL A . n A 1 373 ILE 373 357 357 ILE ILE A . n A 1 374 GLU 374 358 358 GLU GLU A . n A 1 375 ILE 375 359 359 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 3 HOH HOH A . B 2 HOH 2 402 2 HOH HOH A . B 2 HOH 3 403 1 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1-4487-000 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9MC1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 185.970 _cell.length_a_esd ? _cell.length_b 185.970 _cell.length_b_esd ? _cell.length_c 58.877 _cell.length_c_esd ? _cell.volume 1763445.681 _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9MC1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ;R 3 2" ; _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9MC1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.78 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Tris-HCl pH 7.8, PEG3350 16%(w/v), 0.20 M KSCN' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-05-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL45XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL45XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 59.90 _reflns.entry_id 9MC1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.90 _reflns.d_resolution_low 47.53 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8689 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.13 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.493 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.08 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.81 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1359 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 17.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.667 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.652 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.9 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 59.56 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9MC1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.90 _refine.ls_d_res_low 47.53 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8672 _refine.ls_number_reflns_R_free 435 _refine.ls_number_reflns_R_work 8237 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.63 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2284 _refine.ls_R_factor_R_free 0.2730 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2260 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model AlphaFold _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.3746 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4760 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 47.53 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 2645 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2642 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0028 ? 2702 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5416 ? 3677 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0429 ? 419 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0045 ? 476 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.8774 ? 986 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.90 3.32 . . 143 2703 99.06 . . . . 0.3344 . . . . . . . . . . . . . . . 0.3649 'X-RAY DIFFRACTION' 3.32 4.18 . . 144 2732 100.00 . . . . 0.2398 . . . . . . . . . . . . . . . 0.2775 'X-RAY DIFFRACTION' 4.18 47.53 . . 148 2802 99.90 . . . . 0.1818 . . . . . . . . . . . . . . . 0.2372 # _struct.entry_id 9MC1 _struct.title 'Trans-acting enoylreductase PhiaB involved in the phialotideA biosynthesis pathway' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9MC1 _struct_keywords.text 'Trans-acting enoylreductases, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9MC1 _struct_ref.pdbx_db_accession 9MC1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9MC1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 375 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9MC1 _struct_ref_seq.db_align_beg -15 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -15 _struct_ref_seq.pdbx_auth_seq_align_end 359 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 64 ? GLN A 71 ? HIS A 48 GLN A 55 1 ? 8 HELX_P HELX_P2 AA2 ARG A 100 ? LEU A 105 ? ARG A 84 LEU A 89 1 ? 6 HELX_P HELX_P3 AA3 SER A 165 ? ALA A 171 ? SER A 149 ALA A 155 1 ? 7 HELX_P HELX_P4 AA4 LEU A 172 ? THR A 185 ? LEU A 156 THR A 169 1 ? 14 HELX_P HELX_P5 AA5 GLY A 188 ? VAL A 192 ? GLY A 172 VAL A 176 5 ? 5 HELX_P HELX_P6 AA6 GLY A 205 ? GLY A 219 ? GLY A 189 GLY A 203 1 ? 15 HELX_P HELX_P7 AA7 SER A 228 ? GLY A 239 ? SER A 212 GLY A 223 1 ? 12 HELX_P HELX_P8 AA8 ASP A 250 ? LEU A 259 ? ASP A 234 LEU A 243 1 ? 10 HELX_P HELX_P9 AA9 ASP A 276 ? VAL A 282 ? ASP A 260 VAL A 266 1 ? 7 HELX_P HELX_P10 AB1 PRO A 305 ? LYS A 311 ? PRO A 289 LYS A 295 1 ? 7 HELX_P HELX_P11 AB2 SER A 322 ? LYS A 337 ? SER A 306 LYS A 321 1 ? 16 HELX_P HELX_P12 AB3 CYS A 351 ? GLY A 364 ? CYS A 335 GLY A 348 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 138 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 122 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 139 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 123 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.19 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel AA4 4 5 ? parallel AA4 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 19 ? ILE A 23 ? HIS A 3 ILE A 7 AA1 2 LEU A 37 ? ALA A 41 ? LEU A 21 ALA A 25 AA2 1 TRP A 149 ? ALA A 153 ? TRP A 133 ALA A 137 AA2 2 GLU A 52 ? LEU A 62 ? GLU A 36 LEU A 46 AA2 3 ASP A 86 ? VAL A 94 ? ASP A 70 VAL A 78 AA2 4 LEU A 108 ? LEU A 111 ? LEU A 92 LEU A 95 AA2 5 VAL A 157 ? VAL A 159 ? VAL A 141 VAL A 143 AA3 1 TRP A 149 ? ALA A 153 ? TRP A 133 ALA A 137 AA3 2 GLU A 52 ? LEU A 62 ? GLU A 36 LEU A 46 AA3 3 LYS A 370 ? GLU A 374 ? LYS A 354 GLU A 358 AA3 4 ILE A 342 ? LYS A 347 ? ILE A 326 LYS A 331 AA4 1 GLY A 243 ? LEU A 245 ? GLY A 227 LEU A 229 AA4 2 ASN A 221 ? SER A 226 ? ASN A 205 SER A 210 AA4 3 ASN A 197 ? ILE A 200 ? ASN A 181 ILE A 184 AA4 4 LEU A 266 ? ASP A 271 ? LEU A 250 ASP A 255 AA4 5 LEU A 285 ? ILE A 293 ? LEU A 269 ILE A 277 AA4 6 GLU A 314 ? GLY A 317 ? GLU A 298 GLY A 301 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 22 ? N THR A 6 O GLN A 38 ? O GLN A 22 AA2 1 2 O MET A 150 ? O MET A 134 N ILE A 55 ? N ILE A 39 AA2 2 3 N LEU A 54 ? N LEU A 38 O GLU A 93 ? O GLU A 77 AA2 3 4 N GLY A 89 ? N GLY A 73 O VAL A 109 ? O VAL A 93 AA2 4 5 N VAL A 110 ? N VAL A 94 O GLU A 158 ? O GLU A 142 AA3 1 2 O MET A 150 ? O MET A 134 N ILE A 55 ? N ILE A 39 AA3 2 3 N LEU A 62 ? N LEU A 46 O LEU A 371 ? O LEU A 355 AA3 3 4 O GLU A 374 ? O GLU A 358 N VAL A 346 ? N VAL A 330 AA4 1 2 O ALA A 244 ? O ALA A 228 N SER A 226 ? N SER A 210 AA4 2 3 O TYR A 223 ? O TYR A 207 N ILE A 198 ? N ILE A 182 AA4 3 4 N ASN A 197 ? N ASN A 181 O ASP A 267 ? O ASP A 251 AA4 4 5 N LEU A 266 ? N LEU A 250 O LYS A 286 ? O LYS A 270 AA4 5 6 N ILE A 291 ? N ILE A 275 O GLU A 314 ? O GLU A 298 # _pdbx_entry_details.entry_id 9MC1 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 10 ? ? -124.45 -87.71 2 1 PHE A 68 ? ? 71.93 124.09 3 1 PRO A 97 ? ? -85.39 37.66 4 1 LEU A 167 ? ? -98.48 -62.55 5 1 VAL A 176 ? ? -116.19 67.64 6 1 THR A 282 ? ? -64.92 -70.73 7 1 LEU A 304 ? ? 49.04 -141.38 8 1 THR A 329 ? ? -161.93 118.20 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z 7 x+1/3,y+2/3,z+2/3 8 -y+1/3,x-y+2/3,z+2/3 9 -x+y+1/3,-x+2/3,z+2/3 10 x-y+1/3,-y+2/3,-z+2/3 11 -x+1/3,-x+y+2/3,-z+2/3 12 y+1/3,x+2/3,-z+2/3 13 x+2/3,y+1/3,z+1/3 14 -y+2/3,x-y+1/3,z+1/3 15 -x+y+2/3,-x+1/3,z+1/3 16 x-y+2/3,-y+1/3,-z+1/3 17 -x+2/3,-x+y+1/3,-z+1/3 18 y+2/3,x+1/3,-z+1/3 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 29.6981949117 _pdbx_refine_tls.origin_y -18.0179995997 _pdbx_refine_tls.origin_z 11.7961645033 _pdbx_refine_tls.T[1][1] 0.383775995682 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0404525570769 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0160756685096 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.44889261845 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0529564825104 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.370596047901 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.91685217301 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -1.24032443574 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.530832352144 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.06306364507 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.971473319786 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.03678426705 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.169307883349 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.470668217946 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.118449865583 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.274459676818 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.25175021436 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.225461315969 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0580887215716 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.392989545957 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0791676913988 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id C _pdbx_refine_tls_group.end_auth_seq_id 3 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 402 ? 6.20 . 2 1 O ? A HOH 403 ? 22.46 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -15 ? A MET 1 2 1 Y 1 A ASN -14 ? A ASN 2 3 1 Y 1 A HIS -13 ? A HIS 3 4 1 Y 1 A LYS -12 ? A LYS 4 5 1 Y 1 A VAL -11 ? A VAL 5 6 1 Y 1 A HIS -10 ? A HIS 6 7 1 Y 1 A HIS -9 ? A HIS 7 8 1 Y 1 A HIS -8 ? A HIS 8 9 1 Y 1 A HIS -7 ? A HIS 9 10 1 Y 1 A HIS -6 ? A HIS 10 11 1 Y 1 A HIS -5 ? A HIS 11 12 1 Y 1 A ILE -4 ? A ILE 12 13 1 Y 1 A GLU -3 ? A GLU 13 14 1 Y 1 A GLY -2 ? A GLY 14 15 1 Y 1 A ARG -1 ? A ARG 15 16 1 Y 1 A HIS 0 ? A HIS 16 17 1 Y 1 A MET 1 ? A MET 17 18 1 Y 1 A GLY 12 ? A GLY 28 19 1 Y 1 A LYS 13 ? A LYS 29 20 1 Y 1 A PRO 14 ? A PRO 30 21 1 Y 1 A GLY 15 ? A GLY 31 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number JP23H04533 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'R 3 2 :H' _space_group.name_Hall ;R 3 2" ; _space_group.IT_number 155 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9MC1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005377 _atom_sites.fract_transf_matrix[1][2] 0.003105 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006209 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016985 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #