data_9ME2 # _entry.id 9ME2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ME2 pdb_00009me2 10.2210/pdb9me2/pdb WWPDB D_1000290799 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-08-13 ? 2 'Structure model' 1 1 2025-08-20 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9ME2 _pdbx_database_status.recvd_initial_deposition_date 2024-12-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'PDB entries for the same citation' 9EJJ unspecified PDB 'PDB entries for the same citation' 9EJR unspecified PDB 'PDB entries for the same citation' 9EJS unspecified PDB 'PDB entries for the same citation' 9EJX unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email amyand@iastate.edu _pdbx_contact_author.name_first Amy _pdbx_contact_author.name_last Andreotti _pdbx_contact_author.name_mi H _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6952-7244 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lin, D.Y.' 1 0000-0001-6149-5236 'Andreotti, A.H.' 2 0000-0002-6952-7244 'Tonge, P.J.' 3 0000-0003-1606-3471 'Bravo, E.' 4 0000-0002-7997-5534 'Li, X.' 5 0000-0001-8945-2107 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 147 _citation.language ? _citation.page_first 27876 _citation.page_last 27891 _citation.title ;Modulating the Binding Kinetics of Bruton's Tyrosine Kinase Inhibitors through Transition-State Effects. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.5c07063 _citation.pdbx_database_id_PubMed 40726426 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bravo Jr., E.' 1 ? primary 'Li, Y.' 2 ? primary 'Lin, D.Y.' 3 ? primary 'Srinivasan, B.' 4 ? primary 'Barone, M.' 5 ? primary 'Li, S.X.' 6 ? primary 'DelloRusso, F.' 7 ? primary 'Rahiyanath, A.S.' 8 ? primary 'Corrionero, A.' 9 ? primary 'Alfonso, P.' 10 ? primary 'Prendiville, N.' 11 ? primary 'Kozakov, D.' 12 ? primary 'Andreotti, A.H.' 13 ? primary 'Tonge, P.J.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase BTK' 31821.521 1 2.7.10.2 'K430R, L542M, S543T, V555T, R562K, S564A, P565S,Y617P' ? ? 2 non-polymer syn '3-(4-phenoxyphenyl)-1-[(3S)-piperidin-3-yl]-1H-pyrazolo[3,4-d]pyrimidin-4-amine' 386.450 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Agammaglobulinemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bruton tyrosine kinase,Kinase EMB' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIRMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIIT EYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGMTRYVLDDEYTSS TGSKFPVKWASPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLPRPHLASERVYTIMYSCW HEKADERPSFKILLSNILDVMDEESHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIRMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIIT EYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGMTRYVLDDEYTSS TGSKFPVKWASPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLPRPHLASERVYTIMYSCW HEKADERPSFKILLSNILDVMDEESHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '3-(4-phenoxyphenyl)-1-[(3S)-piperidin-3-yl]-1H-pyrazolo[3,4-d]pyrimidin-4-amine' _pdbx_entity_nonpoly.comp_id A1BKW # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ILE n 1 4 ASP n 1 5 PRO n 1 6 LYS n 1 7 ASP n 1 8 LEU n 1 9 THR n 1 10 PHE n 1 11 LEU n 1 12 LYS n 1 13 GLU n 1 14 LEU n 1 15 GLY n 1 16 THR n 1 17 GLY n 1 18 GLN n 1 19 PHE n 1 20 GLY n 1 21 VAL n 1 22 VAL n 1 23 LYS n 1 24 TYR n 1 25 GLY n 1 26 LYS n 1 27 TRP n 1 28 ARG n 1 29 GLY n 1 30 GLN n 1 31 TYR n 1 32 ASP n 1 33 VAL n 1 34 ALA n 1 35 ILE n 1 36 ARG n 1 37 MET n 1 38 ILE n 1 39 ARG n 1 40 GLU n 1 41 GLY n 1 42 SER n 1 43 MET n 1 44 SER n 1 45 GLU n 1 46 ASP n 1 47 GLU n 1 48 PHE n 1 49 ILE n 1 50 GLU n 1 51 GLU n 1 52 ALA n 1 53 LYS n 1 54 VAL n 1 55 MET n 1 56 MET n 1 57 ASN n 1 58 LEU n 1 59 SER n 1 60 HIS n 1 61 GLU n 1 62 LYS n 1 63 LEU n 1 64 VAL n 1 65 GLN n 1 66 LEU n 1 67 TYR n 1 68 GLY n 1 69 VAL n 1 70 CYS n 1 71 THR n 1 72 LYS n 1 73 GLN n 1 74 ARG n 1 75 PRO n 1 76 ILE n 1 77 PHE n 1 78 ILE n 1 79 ILE n 1 80 THR n 1 81 GLU n 1 82 TYR n 1 83 MET n 1 84 ALA n 1 85 ASN n 1 86 GLY n 1 87 CYS n 1 88 LEU n 1 89 LEU n 1 90 ASN n 1 91 TYR n 1 92 LEU n 1 93 ARG n 1 94 GLU n 1 95 MET n 1 96 ARG n 1 97 HIS n 1 98 ARG n 1 99 PHE n 1 100 GLN n 1 101 THR n 1 102 GLN n 1 103 GLN n 1 104 LEU n 1 105 LEU n 1 106 GLU n 1 107 MET n 1 108 CYS n 1 109 LYS n 1 110 ASP n 1 111 VAL n 1 112 CYS n 1 113 GLU n 1 114 ALA n 1 115 MET n 1 116 GLU n 1 117 TYR n 1 118 LEU n 1 119 GLU n 1 120 SER n 1 121 LYS n 1 122 GLN n 1 123 PHE n 1 124 LEU n 1 125 HIS n 1 126 ARG n 1 127 ASP n 1 128 LEU n 1 129 ALA n 1 130 ALA n 1 131 ARG n 1 132 ASN n 1 133 CYS n 1 134 LEU n 1 135 VAL n 1 136 ASN n 1 137 ASP n 1 138 GLN n 1 139 GLY n 1 140 VAL n 1 141 VAL n 1 142 LYS n 1 143 VAL n 1 144 SER n 1 145 ASP n 1 146 PHE n 1 147 GLY n 1 148 MET n 1 149 THR n 1 150 ARG n 1 151 TYR n 1 152 VAL n 1 153 LEU n 1 154 ASP n 1 155 ASP n 1 156 GLU n 1 157 TYR n 1 158 THR n 1 159 SER n 1 160 SER n 1 161 THR n 1 162 GLY n 1 163 SER n 1 164 LYS n 1 165 PHE n 1 166 PRO n 1 167 VAL n 1 168 LYS n 1 169 TRP n 1 170 ALA n 1 171 SER n 1 172 PRO n 1 173 GLU n 1 174 VAL n 1 175 LEU n 1 176 MET n 1 177 TYR n 1 178 SER n 1 179 LYS n 1 180 PHE n 1 181 SER n 1 182 SER n 1 183 LYS n 1 184 SER n 1 185 ASP n 1 186 ILE n 1 187 TRP n 1 188 ALA n 1 189 PHE n 1 190 GLY n 1 191 VAL n 1 192 LEU n 1 193 MET n 1 194 TRP n 1 195 GLU n 1 196 ILE n 1 197 TYR n 1 198 SER n 1 199 LEU n 1 200 GLY n 1 201 LYS n 1 202 MET n 1 203 PRO n 1 204 TYR n 1 205 GLU n 1 206 ARG n 1 207 PHE n 1 208 THR n 1 209 ASN n 1 210 SER n 1 211 GLU n 1 212 THR n 1 213 ALA n 1 214 GLU n 1 215 HIS n 1 216 ILE n 1 217 ALA n 1 218 GLN n 1 219 GLY n 1 220 LEU n 1 221 ARG n 1 222 LEU n 1 223 PRO n 1 224 ARG n 1 225 PRO n 1 226 HIS n 1 227 LEU n 1 228 ALA n 1 229 SER n 1 230 GLU n 1 231 ARG n 1 232 VAL n 1 233 TYR n 1 234 THR n 1 235 ILE n 1 236 MET n 1 237 TYR n 1 238 SER n 1 239 CYS n 1 240 TRP n 1 241 HIS n 1 242 GLU n 1 243 LYS n 1 244 ALA n 1 245 ASP n 1 246 GLU n 1 247 ARG n 1 248 PRO n 1 249 SER n 1 250 PHE n 1 251 LYS n 1 252 ILE n 1 253 LEU n 1 254 LEU n 1 255 SER n 1 256 ASN n 1 257 ILE n 1 258 LEU n 1 259 ASP n 1 260 VAL n 1 261 MET n 1 262 ASP n 1 263 GLU n 1 264 GLU n 1 265 SER n 1 266 HIS n 1 267 HIS n 1 268 HIS n 1 269 HIS n 1 270 HIS n 1 271 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Btk, Bpk' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1BKW non-polymer . '3-(4-phenoxyphenyl)-1-[(3S)-piperidin-3-yl]-1H-pyrazolo[3,4-d]pyrimidin-4-amine' ? 'C22 H22 N6 O' 386.450 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 395 395 MET MET A . n A 1 2 GLU 2 396 396 GLU GLU A . n A 1 3 ILE 3 397 397 ILE ILE A . n A 1 4 ASP 4 398 398 ASP ASP A . n A 1 5 PRO 5 399 399 PRO PRO A . n A 1 6 LYS 6 400 400 LYS LYS A . n A 1 7 ASP 7 401 401 ASP ASP A . n A 1 8 LEU 8 402 402 LEU LEU A . n A 1 9 THR 9 403 403 THR THR A . n A 1 10 PHE 10 404 404 PHE PHE A . n A 1 11 LEU 11 405 405 LEU LEU A . n A 1 12 LYS 12 406 406 LYS LYS A . n A 1 13 GLU 13 407 407 GLU GLU A . n A 1 14 LEU 14 408 408 LEU LEU A . n A 1 15 GLY 15 409 409 GLY GLY A . n A 1 16 THR 16 410 410 THR THR A . n A 1 17 GLY 17 411 411 GLY GLY A . n A 1 18 GLN 18 412 412 GLN GLN A . n A 1 19 PHE 19 413 413 PHE PHE A . n A 1 20 GLY 20 414 414 GLY GLY A . n A 1 21 VAL 21 415 415 VAL VAL A . n A 1 22 VAL 22 416 416 VAL VAL A . n A 1 23 LYS 23 417 417 LYS LYS A . n A 1 24 TYR 24 418 418 TYR TYR A . n A 1 25 GLY 25 419 419 GLY GLY A . n A 1 26 LYS 26 420 420 LYS LYS A . n A 1 27 TRP 27 421 421 TRP TRP A . n A 1 28 ARG 28 422 422 ARG ARG A . n A 1 29 GLY 29 423 423 GLY GLY A . n A 1 30 GLN 30 424 424 GLN GLN A . n A 1 31 TYR 31 425 425 TYR TYR A . n A 1 32 ASP 32 426 426 ASP ASP A . n A 1 33 VAL 33 427 427 VAL VAL A . n A 1 34 ALA 34 428 428 ALA ALA A . n A 1 35 ILE 35 429 429 ILE ILE A . n A 1 36 ARG 36 430 430 ARG ARG A . n A 1 37 MET 37 431 431 MET MET A . n A 1 38 ILE 38 432 432 ILE ILE A . n A 1 39 ARG 39 433 433 ARG ARG A . n A 1 40 GLU 40 434 434 GLU GLU A . n A 1 41 GLY 41 435 435 GLY GLY A . n A 1 42 SER 42 436 436 SER SER A . n A 1 43 MET 43 437 437 MET MET A . n A 1 44 SER 44 438 438 SER SER A . n A 1 45 GLU 45 439 439 GLU GLU A . n A 1 46 ASP 46 440 440 ASP ASP A . n A 1 47 GLU 47 441 441 GLU GLU A . n A 1 48 PHE 48 442 442 PHE PHE A . n A 1 49 ILE 49 443 443 ILE ILE A . n A 1 50 GLU 50 444 444 GLU GLU A . n A 1 51 GLU 51 445 445 GLU GLU A . n A 1 52 ALA 52 446 446 ALA ALA A . n A 1 53 LYS 53 447 447 LYS LYS A . n A 1 54 VAL 54 448 448 VAL VAL A . n A 1 55 MET 55 449 449 MET MET A . n A 1 56 MET 56 450 450 MET MET A . n A 1 57 ASN 57 451 451 ASN ASN A . n A 1 58 LEU 58 452 452 LEU LEU A . n A 1 59 SER 59 453 453 SER SER A . n A 1 60 HIS 60 454 454 HIS HIS A . n A 1 61 GLU 61 455 455 GLU GLU A . n A 1 62 LYS 62 456 456 LYS LYS A . n A 1 63 LEU 63 457 457 LEU LEU A . n A 1 64 VAL 64 458 458 VAL VAL A . n A 1 65 GLN 65 459 459 GLN GLN A . n A 1 66 LEU 66 460 460 LEU LEU A . n A 1 67 TYR 67 461 461 TYR TYR A . n A 1 68 GLY 68 462 462 GLY GLY A . n A 1 69 VAL 69 463 463 VAL VAL A . n A 1 70 CYS 70 464 464 CYS CYS A . n A 1 71 THR 71 465 465 THR THR A . n A 1 72 LYS 72 466 466 LYS LYS A . n A 1 73 GLN 73 467 467 GLN GLN A . n A 1 74 ARG 74 468 468 ARG ARG A . n A 1 75 PRO 75 469 469 PRO PRO A . n A 1 76 ILE 76 470 470 ILE ILE A . n A 1 77 PHE 77 471 471 PHE PHE A . n A 1 78 ILE 78 472 472 ILE ILE A . n A 1 79 ILE 79 473 473 ILE ILE A . n A 1 80 THR 80 474 474 THR THR A . n A 1 81 GLU 81 475 475 GLU GLU A . n A 1 82 TYR 82 476 476 TYR TYR A . n A 1 83 MET 83 477 477 MET MET A . n A 1 84 ALA 84 478 478 ALA ALA A . n A 1 85 ASN 85 479 479 ASN ASN A . n A 1 86 GLY 86 480 480 GLY GLY A . n A 1 87 CYS 87 481 481 CYS CYS A . n A 1 88 LEU 88 482 482 LEU LEU A . n A 1 89 LEU 89 483 483 LEU LEU A . n A 1 90 ASN 90 484 484 ASN ASN A . n A 1 91 TYR 91 485 485 TYR TYR A . n A 1 92 LEU 92 486 486 LEU LEU A . n A 1 93 ARG 93 487 487 ARG ARG A . n A 1 94 GLU 94 488 488 GLU GLU A . n A 1 95 MET 95 489 489 MET MET A . n A 1 96 ARG 96 490 490 ARG ARG A . n A 1 97 HIS 97 491 491 HIS HIS A . n A 1 98 ARG 98 492 492 ARG ARG A . n A 1 99 PHE 99 493 493 PHE PHE A . n A 1 100 GLN 100 494 494 GLN GLN A . n A 1 101 THR 101 495 495 THR THR A . n A 1 102 GLN 102 496 496 GLN GLN A . n A 1 103 GLN 103 497 497 GLN GLN A . n A 1 104 LEU 104 498 498 LEU LEU A . n A 1 105 LEU 105 499 499 LEU LEU A . n A 1 106 GLU 106 500 500 GLU GLU A . n A 1 107 MET 107 501 501 MET MET A . n A 1 108 CYS 108 502 502 CYS CYS A . n A 1 109 LYS 109 503 503 LYS LYS A . n A 1 110 ASP 110 504 504 ASP ASP A . n A 1 111 VAL 111 505 505 VAL VAL A . n A 1 112 CYS 112 506 506 CYS CYS A . n A 1 113 GLU 113 507 507 GLU GLU A . n A 1 114 ALA 114 508 508 ALA ALA A . n A 1 115 MET 115 509 509 MET MET A . n A 1 116 GLU 116 510 510 GLU GLU A . n A 1 117 TYR 117 511 511 TYR TYR A . n A 1 118 LEU 118 512 512 LEU LEU A . n A 1 119 GLU 119 513 513 GLU GLU A . n A 1 120 SER 120 514 514 SER SER A . n A 1 121 LYS 121 515 515 LYS LYS A . n A 1 122 GLN 122 516 516 GLN GLN A . n A 1 123 PHE 123 517 517 PHE PHE A . n A 1 124 LEU 124 518 518 LEU LEU A . n A 1 125 HIS 125 519 519 HIS HIS A . n A 1 126 ARG 126 520 520 ARG ARG A . n A 1 127 ASP 127 521 521 ASP ASP A . n A 1 128 LEU 128 522 522 LEU LEU A . n A 1 129 ALA 129 523 523 ALA ALA A . n A 1 130 ALA 130 524 524 ALA ALA A . n A 1 131 ARG 131 525 525 ARG ARG A . n A 1 132 ASN 132 526 526 ASN ASN A . n A 1 133 CYS 133 527 527 CYS CYS A . n A 1 134 LEU 134 528 528 LEU LEU A . n A 1 135 VAL 135 529 529 VAL VAL A . n A 1 136 ASN 136 530 530 ASN ASN A . n A 1 137 ASP 137 531 531 ASP ASP A . n A 1 138 GLN 138 532 532 GLN GLN A . n A 1 139 GLY 139 533 533 GLY GLY A . n A 1 140 VAL 140 534 534 VAL VAL A . n A 1 141 VAL 141 535 535 VAL VAL A . n A 1 142 LYS 142 536 536 LYS LYS A . n A 1 143 VAL 143 537 537 VAL VAL A . n A 1 144 SER 144 538 538 SER SER A . n A 1 145 ASP 145 539 539 ASP ASP A . n A 1 146 PHE 146 540 540 PHE PHE A . n A 1 147 GLY 147 541 541 GLY GLY A . n A 1 148 MET 148 542 542 MET MET A . n A 1 149 THR 149 543 543 THR THR A . n A 1 150 ARG 150 544 544 ARG ARG A . n A 1 151 TYR 151 545 545 TYR TYR A . n A 1 152 VAL 152 546 546 VAL VAL A . n A 1 153 LEU 153 547 547 LEU LEU A . n A 1 154 ASP 154 548 548 ASP ASP A . n A 1 155 ASP 155 549 549 ASP ASP A . n A 1 156 GLU 156 550 550 GLU GLU A . n A 1 157 TYR 157 551 551 TYR TYR A . n A 1 158 THR 158 552 552 THR THR A . n A 1 159 SER 159 553 553 SER SER A . n A 1 160 SER 160 554 554 SER SER A . n A 1 161 THR 161 555 555 THR THR A . n A 1 162 GLY 162 556 556 GLY GLY A . n A 1 163 SER 163 557 557 SER SER A . n A 1 164 LYS 164 558 558 LYS LYS A . n A 1 165 PHE 165 559 559 PHE PHE A . n A 1 166 PRO 166 560 560 PRO PRO A . n A 1 167 VAL 167 561 561 VAL VAL A . n A 1 168 LYS 168 562 562 LYS LYS A . n A 1 169 TRP 169 563 563 TRP TRP A . n A 1 170 ALA 170 564 564 ALA ALA A . n A 1 171 SER 171 565 565 SER SER A . n A 1 172 PRO 172 566 566 PRO PRO A . n A 1 173 GLU 173 567 567 GLU GLU A . n A 1 174 VAL 174 568 568 VAL VAL A . n A 1 175 LEU 175 569 569 LEU LEU A . n A 1 176 MET 176 570 570 MET MET A . n A 1 177 TYR 177 571 571 TYR TYR A . n A 1 178 SER 178 572 572 SER SER A . n A 1 179 LYS 179 573 573 LYS LYS A . n A 1 180 PHE 180 574 574 PHE PHE A . n A 1 181 SER 181 575 575 SER SER A . n A 1 182 SER 182 576 576 SER SER A . n A 1 183 LYS 183 577 577 LYS LYS A . n A 1 184 SER 184 578 578 SER SER A . n A 1 185 ASP 185 579 579 ASP ASP A . n A 1 186 ILE 186 580 580 ILE ILE A . n A 1 187 TRP 187 581 581 TRP TRP A . n A 1 188 ALA 188 582 582 ALA ALA A . n A 1 189 PHE 189 583 583 PHE PHE A . n A 1 190 GLY 190 584 584 GLY GLY A . n A 1 191 VAL 191 585 585 VAL VAL A . n A 1 192 LEU 192 586 586 LEU LEU A . n A 1 193 MET 193 587 587 MET MET A . n A 1 194 TRP 194 588 588 TRP TRP A . n A 1 195 GLU 195 589 589 GLU GLU A . n A 1 196 ILE 196 590 590 ILE ILE A . n A 1 197 TYR 197 591 591 TYR TYR A . n A 1 198 SER 198 592 592 SER SER A . n A 1 199 LEU 199 593 593 LEU LEU A . n A 1 200 GLY 200 594 594 GLY GLY A . n A 1 201 LYS 201 595 595 LYS LYS A . n A 1 202 MET 202 596 596 MET MET A . n A 1 203 PRO 203 597 597 PRO PRO A . n A 1 204 TYR 204 598 598 TYR TYR A . n A 1 205 GLU 205 599 599 GLU GLU A . n A 1 206 ARG 206 600 600 ARG ARG A . n A 1 207 PHE 207 601 601 PHE PHE A . n A 1 208 THR 208 602 602 THR THR A . n A 1 209 ASN 209 603 603 ASN ASN A . n A 1 210 SER 210 604 604 SER SER A . n A 1 211 GLU 211 605 605 GLU GLU A . n A 1 212 THR 212 606 606 THR THR A . n A 1 213 ALA 213 607 607 ALA ALA A . n A 1 214 GLU 214 608 608 GLU GLU A . n A 1 215 HIS 215 609 609 HIS HIS A . n A 1 216 ILE 216 610 610 ILE ILE A . n A 1 217 ALA 217 611 611 ALA ALA A . n A 1 218 GLN 218 612 612 GLN GLN A . n A 1 219 GLY 219 613 613 GLY GLY A . n A 1 220 LEU 220 614 614 LEU LEU A . n A 1 221 ARG 221 615 615 ARG ARG A . n A 1 222 LEU 222 616 616 LEU LEU A . n A 1 223 PRO 223 617 617 PRO PRO A . n A 1 224 ARG 224 618 618 ARG ARG A . n A 1 225 PRO 225 619 619 PRO PRO A . n A 1 226 HIS 226 620 620 HIS HIS A . n A 1 227 LEU 227 621 621 LEU LEU A . n A 1 228 ALA 228 622 622 ALA ALA A . n A 1 229 SER 229 623 623 SER SER A . n A 1 230 GLU 230 624 624 GLU GLU A . n A 1 231 ARG 231 625 625 ARG ARG A . n A 1 232 VAL 232 626 626 VAL VAL A . n A 1 233 TYR 233 627 627 TYR TYR A . n A 1 234 THR 234 628 628 THR THR A . n A 1 235 ILE 235 629 629 ILE ILE A . n A 1 236 MET 236 630 630 MET MET A . n A 1 237 TYR 237 631 631 TYR TYR A . n A 1 238 SER 238 632 632 SER SER A . n A 1 239 CYS 239 633 633 CYS CYS A . n A 1 240 TRP 240 634 634 TRP TRP A . n A 1 241 HIS 241 635 635 HIS HIS A . n A 1 242 GLU 242 636 636 GLU GLU A . n A 1 243 LYS 243 637 637 LYS LYS A . n A 1 244 ALA 244 638 638 ALA ALA A . n A 1 245 ASP 245 639 639 ASP ASP A . n A 1 246 GLU 246 640 640 GLU GLU A . n A 1 247 ARG 247 641 641 ARG ARG A . n A 1 248 PRO 248 642 642 PRO PRO A . n A 1 249 SER 249 643 643 SER SER A . n A 1 250 PHE 250 644 644 PHE PHE A . n A 1 251 LYS 251 645 645 LYS LYS A . n A 1 252 ILE 252 646 646 ILE ILE A . n A 1 253 LEU 253 647 647 LEU LEU A . n A 1 254 LEU 254 648 648 LEU LEU A . n A 1 255 SER 255 649 649 SER SER A . n A 1 256 ASN 256 650 650 ASN ASN A . n A 1 257 ILE 257 651 651 ILE ILE A . n A 1 258 LEU 258 652 652 LEU LEU A . n A 1 259 ASP 259 653 653 ASP ASP A . n A 1 260 VAL 260 654 654 VAL VAL A . n A 1 261 MET 261 655 655 MET MET A . n A 1 262 ASP 262 656 656 ASP ASP A . n A 1 263 GLU 263 657 657 GLU GLU A . n A 1 264 GLU 264 658 658 GLU GLU A . n A 1 265 SER 265 659 659 SER SER A . n A 1 266 HIS 266 660 ? ? ? A . n A 1 267 HIS 267 661 ? ? ? A . n A 1 268 HIS 268 662 ? ? ? A . n A 1 269 HIS 269 663 ? ? ? A . n A 1 270 HIS 270 664 ? ? ? A . n A 1 271 HIS 271 665 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1BKW _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1BKW _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id A1BKW _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 701 _pdbx_nonpoly_scheme.auth_seq_num 701 _pdbx_nonpoly_scheme.pdb_mon_id A1BKW _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 424 ? CG ? A GLN 30 CG 2 1 Y 1 A GLN 424 ? CD ? A GLN 30 CD 3 1 Y 1 A GLN 424 ? OE1 ? A GLN 30 OE1 4 1 Y 1 A GLN 424 ? NE2 ? A GLN 30 NE2 5 1 Y 1 A LYS 447 ? CG ? A LYS 53 CG 6 1 Y 1 A LYS 447 ? CD ? A LYS 53 CD 7 1 Y 1 A LYS 447 ? CE ? A LYS 53 CE 8 1 Y 1 A LYS 447 ? NZ ? A LYS 53 NZ 9 1 Y 1 A LYS 456 ? CG ? A LYS 62 CG 10 1 Y 1 A LYS 456 ? CD ? A LYS 62 CD 11 1 Y 1 A LYS 456 ? CE ? A LYS 62 CE 12 1 Y 1 A LYS 456 ? NZ ? A LYS 62 NZ 13 1 Y 1 A GLN 459 ? CG ? A GLN 65 CG 14 1 Y 1 A GLN 459 ? CD ? A GLN 65 CD 15 1 Y 1 A GLN 459 ? OE1 ? A GLN 65 OE1 16 1 Y 1 A GLN 459 ? NE2 ? A GLN 65 NE2 17 1 Y 1 A GLN 467 ? CG ? A GLN 73 CG 18 1 Y 1 A GLN 467 ? CD ? A GLN 73 CD 19 1 Y 1 A GLN 467 ? OE1 ? A GLN 73 OE1 20 1 Y 1 A GLN 467 ? NE2 ? A GLN 73 NE2 21 1 Y 1 A LEU 483 ? CG ? A LEU 89 CG 22 1 Y 1 A LEU 483 ? CD1 ? A LEU 89 CD1 23 1 Y 1 A LEU 483 ? CD2 ? A LEU 89 CD2 24 1 Y 1 A ARG 487 ? CG ? A ARG 93 CG 25 1 Y 1 A ARG 487 ? CD ? A ARG 93 CD 26 1 Y 1 A ARG 487 ? NE ? A ARG 93 NE 27 1 Y 1 A ARG 487 ? CZ ? A ARG 93 CZ 28 1 Y 1 A ARG 487 ? NH1 ? A ARG 93 NH1 29 1 Y 1 A ARG 487 ? NH2 ? A ARG 93 NH2 30 1 Y 1 A GLU 488 ? CG ? A GLU 94 CG 31 1 Y 1 A GLU 488 ? CD ? A GLU 94 CD 32 1 Y 1 A GLU 488 ? OE1 ? A GLU 94 OE1 33 1 Y 1 A GLU 488 ? OE2 ? A GLU 94 OE2 34 1 Y 1 A MET 489 ? CG ? A MET 95 CG 35 1 Y 1 A MET 489 ? SD ? A MET 95 SD 36 1 Y 1 A MET 489 ? CE ? A MET 95 CE 37 1 Y 1 A ARG 490 ? CG ? A ARG 96 CG 38 1 Y 1 A ARG 490 ? CD ? A ARG 96 CD 39 1 Y 1 A ARG 490 ? NE ? A ARG 96 NE 40 1 Y 1 A ARG 490 ? CZ ? A ARG 96 CZ 41 1 Y 1 A ARG 490 ? NH1 ? A ARG 96 NH1 42 1 Y 1 A ARG 490 ? NH2 ? A ARG 96 NH2 43 1 Y 1 A HIS 491 ? CG ? A HIS 97 CG 44 1 Y 1 A HIS 491 ? ND1 ? A HIS 97 ND1 45 1 Y 1 A HIS 491 ? CD2 ? A HIS 97 CD2 46 1 Y 1 A HIS 491 ? CE1 ? A HIS 97 CE1 47 1 Y 1 A HIS 491 ? NE2 ? A HIS 97 NE2 48 1 Y 1 A GLN 494 ? CG ? A GLN 100 CG 49 1 Y 1 A GLN 494 ? CD ? A GLN 100 CD 50 1 Y 1 A GLN 494 ? OE1 ? A GLN 100 OE1 51 1 Y 1 A GLN 494 ? NE2 ? A GLN 100 NE2 52 1 Y 1 A GLN 496 ? CG ? A GLN 102 CG 53 1 Y 1 A GLN 496 ? CD ? A GLN 102 CD 54 1 Y 1 A GLN 496 ? OE1 ? A GLN 102 OE1 55 1 Y 1 A GLN 496 ? NE2 ? A GLN 102 NE2 56 1 Y 1 A LYS 515 ? CG ? A LYS 121 CG 57 1 Y 1 A LYS 515 ? CD ? A LYS 121 CD 58 1 Y 1 A LYS 515 ? CE ? A LYS 121 CE 59 1 Y 1 A LYS 515 ? NZ ? A LYS 121 NZ 60 1 Y 1 A LEU 547 ? CG ? A LEU 153 CG 61 1 Y 1 A LEU 547 ? CD1 ? A LEU 153 CD1 62 1 Y 1 A LEU 547 ? CD2 ? A LEU 153 CD2 63 1 Y 1 A ARG 600 ? CG ? A ARG 206 CG 64 1 Y 1 A ARG 600 ? CD ? A ARG 206 CD 65 1 Y 1 A ARG 600 ? NE ? A ARG 206 NE 66 1 Y 1 A ARG 600 ? CZ ? A ARG 206 CZ 67 1 Y 1 A ARG 600 ? NH1 ? A ARG 206 NH1 68 1 Y 1 A ARG 600 ? NH2 ? A ARG 206 NH2 69 1 Y 1 A LYS 637 ? CG ? A LYS 243 CG 70 1 Y 1 A LYS 637 ? CD ? A LYS 243 CD 71 1 Y 1 A LYS 637 ? CE ? A LYS 243 CE 72 1 Y 1 A LYS 637 ? NZ ? A LYS 243 NZ 73 1 Y 1 A MET 655 ? CG ? A MET 261 CG 74 1 Y 1 A MET 655 ? SD ? A MET 261 SD 75 1 Y 1 A MET 655 ? CE ? A MET 261 CE # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9ME2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.243 _cell.length_a_esd ? _cell.length_b 106.243 _cell.length_b_esd ? _cell.length_c 47.008 _cell.length_c_esd ? _cell.volume 459518.559 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9ME2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall 'P 61' _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ME2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Sodium citrate tribasic dihydrate pH 5.5, 18% w/v Polyethylene glycol 8,000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-09-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.920153 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X17B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.920153 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X17B1 _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate 106.64 _reflns.entry_id 9ME2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.377 _reflns.d_resolution_low 32.88 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4461 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 88.98 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.89 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.271 _reflns.pdbx_Rpim_I_all 0.06924 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.2619 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.377 _reflns_shell.d_res_low 3.551 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 202 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.356 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 43.9 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 135.13 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9ME2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.38 _refine.ls_d_res_low 19.47 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3880 _refine.ls_number_reflns_R_free 186 _refine.ls_number_reflns_R_work 3694 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 88.95 _refine.ls_percent_reflns_R_free 4.79 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2361 _refine.ls_R_factor_R_free 0.2863 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2333 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5620 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5614 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.38 _refine_hist.d_res_low 19.47 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2121 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2092 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0039 ? 2190 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8416 ? 2965 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0504 ? 318 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0068 ? 376 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.6094 ? 800 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.38 3.50 . . 6 116 29 . . . . 0.3289 . . . . . . . . . . . 0.6108 'X-RAY DIFFRACTION' 3.50 3.64 . . 15 315 73.2 . . . . 0.3664 . . . . . . . . . . . 0.3325 'X-RAY DIFFRACTION' 3.64 3.80 . . 14 369 90.5 . . . . 0.3413 . . . . . . . . . . . 0.4081 'X-RAY DIFFRACTION' 3.80 4.00 . . 22 386 95.1 . . . . 0.3119 . . . . . . . . . . . 0.3518 'X-RAY DIFFRACTION' 4.00 4.24 . . 26 405 100 . . . . 0.2756 . . . . . . . . . . . 0.2734 'X-RAY DIFFRACTION' 4.25 4.57 . . 13 413 100 . . . . 0.2512 . . . . . . . . . . . 0.2663 'X-RAY DIFFRACTION' 4.57 5.02 . . 20 428 100 . . . . 0.2357 . . . . . . . . . . . 0.2688 'X-RAY DIFFRACTION' 5.02 5.73 . . 24 410 100 . . . . 0.2125 . . . . . . . . . . . 0.2532 'X-RAY DIFFRACTION' 5.74 7.16 . . 29 410 99.8 . . . . 0.2005 . . . . . . . . . . . 0.3561 'X-RAY DIFFRACTION' 7.18 19.47 . . 17 442 100 . . . . 0.1785 . . . . . . . . . . . 0.2227 # _struct.entry_id 9ME2 _struct.title ;Bruton's tyrosine kinase with mutations in the activation loop in complex with compound A110162 ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ME2 _struct_keywords.text 'inhibitor, kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BTK_MOUSE _struct_ref.pdbx_db_accession P35991 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITE YMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSV GSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWH EKADERPSFKILLSNILDVMDEES ; _struct_ref.pdbx_align_begin 396 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9ME2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 265 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35991 _struct_ref_seq.db_align_beg 396 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 659 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 396 _struct_ref_seq.pdbx_auth_seq_align_end 659 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9ME2 MET A 1 ? UNP P35991 ? ? 'initiating methionine' 395 1 1 9ME2 ARG A 36 ? UNP P35991 LYS 430 'engineered mutation' 430 2 1 9ME2 MET A 148 ? UNP P35991 LEU 542 'engineered mutation' 542 3 1 9ME2 THR A 149 ? UNP P35991 SER 543 'engineered mutation' 543 4 1 9ME2 THR A 161 ? UNP P35991 VAL 555 'engineered mutation' 555 5 1 9ME2 LYS A 168 ? UNP P35991 ARG 562 'engineered mutation' 562 6 1 9ME2 ALA A 170 ? UNP P35991 SER 564 'engineered mutation' 564 7 1 9ME2 SER A 171 ? UNP P35991 PRO 565 'engineered mutation' 565 8 1 9ME2 PRO A 223 ? UNP P35991 TYR 617 'engineered mutation' 617 9 1 9ME2 HIS A 266 ? UNP P35991 ? ? 'expression tag' 660 10 1 9ME2 HIS A 267 ? UNP P35991 ? ? 'expression tag' 661 11 1 9ME2 HIS A 268 ? UNP P35991 ? ? 'expression tag' 662 12 1 9ME2 HIS A 269 ? UNP P35991 ? ? 'expression tag' 663 13 1 9ME2 HIS A 270 ? UNP P35991 ? ? 'expression tag' 664 14 1 9ME2 HIS A 271 ? UNP P35991 ? ? 'expression tag' 665 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 4 ? LYS A 6 ? ASP A 398 LYS A 400 5 ? 3 HELX_P HELX_P2 AA2 SER A 44 ? ASN A 57 ? SER A 438 ASN A 451 1 ? 14 HELX_P HELX_P3 AA3 CYS A 87 ? MET A 95 ? CYS A 481 MET A 489 1 ? 9 HELX_P HELX_P4 AA4 GLN A 100 ? LYS A 121 ? GLN A 494 LYS A 515 1 ? 22 HELX_P HELX_P5 AA5 ALA A 129 ? ARG A 131 ? ALA A 523 ARG A 525 5 ? 3 HELX_P HELX_P6 AA6 GLY A 147 ? VAL A 152 ? GLY A 541 VAL A 546 5 ? 6 HELX_P HELX_P7 AA7 PRO A 166 ? ALA A 170 ? PRO A 560 ALA A 564 5 ? 5 HELX_P HELX_P8 AA8 SER A 171 ? TYR A 177 ? SER A 565 TYR A 571 1 ? 7 HELX_P HELX_P9 AA9 SER A 181 ? SER A 198 ? SER A 575 SER A 592 1 ? 18 HELX_P HELX_P10 AB1 THR A 208 ? GLN A 218 ? THR A 602 GLN A 612 1 ? 11 HELX_P HELX_P11 AB2 SER A 229 ? CYS A 239 ? SER A 623 CYS A 633 1 ? 11 HELX_P HELX_P12 AB3 LYS A 243 ? ARG A 247 ? LYS A 637 ARG A 641 5 ? 5 HELX_P HELX_P13 AB4 SER A 249 ? GLU A 264 ? SER A 643 GLU A 658 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 74 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 468 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 75 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 469 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.82 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 8 ? GLY A 17 ? LEU A 402 GLY A 411 AA1 2 GLY A 20 ? TRP A 27 ? GLY A 414 TRP A 421 AA1 3 TYR A 31 ? MET A 37 ? TYR A 425 MET A 431 AA1 4 PHE A 77 ? GLU A 81 ? PHE A 471 GLU A 475 AA1 5 LEU A 66 ? CYS A 70 ? LEU A 460 CYS A 464 AA2 1 CYS A 133 ? VAL A 135 ? CYS A 527 VAL A 529 AA2 2 VAL A 141 ? VAL A 143 ? VAL A 535 VAL A 537 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY A 411 O GLY A 20 ? O GLY A 414 AA1 2 3 N TRP A 27 ? N TRP A 421 O TYR A 31 ? O TYR A 425 AA1 3 4 N ALA A 34 ? N ALA A 428 O THR A 80 ? O THR A 474 AA1 4 5 O ILE A 79 ? O ILE A 473 N TYR A 67 ? N TYR A 461 AA2 1 2 N LEU A 134 ? N LEU A 528 O LYS A 142 ? O LYS A 536 # _pdbx_entry_details.entry_id 9ME2 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 458 ? ? -49.22 109.64 2 1 ARG A 520 ? ? 84.56 -6.48 3 1 ASP A 521 ? ? -155.35 46.14 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 -x,-y,z+1/2 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 34.3461635768 _pdbx_refine_tls.origin_y -21.4450416869 _pdbx_refine_tls.origin_z 4.35957496915 _pdbx_refine_tls.T[1][1] 0.967795644247 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.190467357732 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.300048637928 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.869610966771 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.382876136586 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 1.02165966985 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.66546635234 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.689041200644 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 1.56599575675 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 3.47482438282 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 2.12685325843 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 5.70340362798 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.748363744917 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0861303675654 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.176482697655 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.010931381793 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.822024257314 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.166523595264 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.8842964369 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.644041581344 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.522140441664 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 395 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 701 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 660 ? A HIS 266 2 1 Y 1 A HIS 661 ? A HIS 267 3 1 Y 1 A HIS 662 ? A HIS 268 4 1 Y 1 A HIS 663 ? A HIS 269 5 1 Y 1 A HIS 664 ? A HIS 270 6 1 Y 1 A HIS 665 ? A HIS 271 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1BKW C4 C Y N 1 A1BKW C5 C Y N 2 A1BKW C6 C Y N 3 A1BKW C7 C Y N 4 A1BKW C8 C Y N 5 A1BKW C10 C Y N 6 A1BKW N12 N Y N 7 A1BKW C13 C Y N 8 A1BKW C15 C Y N 9 A1BKW C20 C Y N 10 A1BKW C21 C Y N 11 A1BKW C22 C Y N 12 A1BKW C24 C N S 13 A1BKW C26 C N N 14 A1BKW C18 C Y N 15 A1BKW C19 C Y N 16 A1BKW C2 C Y N 17 A1BKW C23 C Y N 18 A1BKW C25 C N N 19 A1BKW C27 C N N 20 A1BKW C29 C N N 21 A1BKW C3 C Y N 22 A1BKW C9 C Y N 23 A1BKW N11 N Y N 24 A1BKW N14 N Y N 25 A1BKW N16 N Y N 26 A1BKW N17 N N N 27 A1BKW N28 N N N 28 A1BKW O1 O N N 29 A1BKW H4 H N N 30 A1BKW H6 H N N 31 A1BKW H7 H N N 32 A1BKW H15 H N N 33 A1BKW H20 H N N 34 A1BKW H21 H N N 35 A1BKW H22 H N N 36 A1BKW H24 H N N 37 A1BKW H26A H N N 38 A1BKW H26B H N N 39 A1BKW H19 H N N 40 A1BKW H23 H N N 41 A1BKW H25A H N N 42 A1BKW H25B H N N 43 A1BKW H27A H N N 44 A1BKW H27B H N N 45 A1BKW H29A H N N 46 A1BKW H29B H N N 47 A1BKW H3 H N N 48 A1BKW H17A H N N 49 A1BKW H17B H N N 50 A1BKW H28 H N N 51 ALA N N N N 52 ALA CA C N S 53 ALA C C N N 54 ALA O O N N 55 ALA CB C N N 56 ALA OXT O N N 57 ALA H H N N 58 ALA H2 H N N 59 ALA HA H N N 60 ALA HB1 H N N 61 ALA HB2 H N N 62 ALA HB3 H N N 63 ALA HXT H N N 64 ARG N N N N 65 ARG CA C N S 66 ARG C C N N 67 ARG O O N N 68 ARG CB C N N 69 ARG CG C N N 70 ARG CD C N N 71 ARG NE N N N 72 ARG CZ C N N 73 ARG NH1 N N N 74 ARG NH2 N N N 75 ARG OXT O N N 76 ARG H H N N 77 ARG H2 H N N 78 ARG HA H N N 79 ARG HB2 H N N 80 ARG HB3 H N N 81 ARG HG2 H N N 82 ARG HG3 H N N 83 ARG HD2 H N N 84 ARG HD3 H N N 85 ARG HE H N N 86 ARG HH11 H N N 87 ARG HH12 H N N 88 ARG HH21 H N N 89 ARG HH22 H N N 90 ARG HXT H N N 91 ASN N N N N 92 ASN CA C N S 93 ASN C C N N 94 ASN O O N N 95 ASN CB C N N 96 ASN CG C N N 97 ASN OD1 O N N 98 ASN ND2 N N N 99 ASN OXT O N N 100 ASN H H N N 101 ASN H2 H N N 102 ASN HA H N N 103 ASN HB2 H N N 104 ASN HB3 H N N 105 ASN HD21 H N N 106 ASN HD22 H N N 107 ASN HXT H N N 108 ASP N N N N 109 ASP CA C N S 110 ASP C C N N 111 ASP O O N N 112 ASP CB C N N 113 ASP CG C N N 114 ASP OD1 O N N 115 ASP OD2 O N N 116 ASP OXT O N N 117 ASP H H N N 118 ASP H2 H N N 119 ASP HA H N N 120 ASP HB2 H N N 121 ASP HB3 H N N 122 ASP HD2 H N N 123 ASP HXT H N N 124 CYS N N N N 125 CYS CA C N R 126 CYS C C N N 127 CYS O O N N 128 CYS CB C N N 129 CYS SG S N N 130 CYS OXT O N N 131 CYS H H N N 132 CYS H2 H N N 133 CYS HA H N N 134 CYS HB2 H N N 135 CYS HB3 H N N 136 CYS HG H N N 137 CYS HXT H N N 138 GLN N N N N 139 GLN CA C N S 140 GLN C C N N 141 GLN O O N N 142 GLN CB C N N 143 GLN CG C N N 144 GLN CD C N N 145 GLN OE1 O N N 146 GLN NE2 N N N 147 GLN OXT O N N 148 GLN H H N N 149 GLN H2 H N N 150 GLN HA H N N 151 GLN HB2 H N N 152 GLN HB3 H N N 153 GLN HG2 H N N 154 GLN HG3 H N N 155 GLN HE21 H N N 156 GLN HE22 H N N 157 GLN HXT H N N 158 GLU N N N N 159 GLU CA C N S 160 GLU C C N N 161 GLU O O N N 162 GLU CB C N N 163 GLU CG C N N 164 GLU CD C N N 165 GLU OE1 O N N 166 GLU OE2 O N N 167 GLU OXT O N N 168 GLU H H N N 169 GLU H2 H N N 170 GLU HA H N N 171 GLU HB2 H N N 172 GLU HB3 H N N 173 GLU HG2 H N N 174 GLU HG3 H N N 175 GLU HE2 H N N 176 GLU HXT H N N 177 GLY N N N N 178 GLY CA C N N 179 GLY C C N N 180 GLY O O N N 181 GLY OXT O N N 182 GLY H H N N 183 GLY H2 H N N 184 GLY HA2 H N N 185 GLY HA3 H N N 186 GLY HXT H N N 187 HIS N N N N 188 HIS CA C N S 189 HIS C C N N 190 HIS O O N N 191 HIS CB C N N 192 HIS CG C Y N 193 HIS ND1 N Y N 194 HIS CD2 C Y N 195 HIS CE1 C Y N 196 HIS NE2 N Y N 197 HIS OXT O N N 198 HIS H H N N 199 HIS H2 H N N 200 HIS HA H N N 201 HIS HB2 H N N 202 HIS HB3 H N N 203 HIS HD1 H N N 204 HIS HD2 H N N 205 HIS HE1 H N N 206 HIS HE2 H N N 207 HIS HXT H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TRP N N N N 369 TRP CA C N S 370 TRP C C N N 371 TRP O O N N 372 TRP CB C N N 373 TRP CG C Y N 374 TRP CD1 C Y N 375 TRP CD2 C Y N 376 TRP NE1 N Y N 377 TRP CE2 C Y N 378 TRP CE3 C Y N 379 TRP CZ2 C Y N 380 TRP CZ3 C Y N 381 TRP CH2 C Y N 382 TRP OXT O N N 383 TRP H H N N 384 TRP H2 H N N 385 TRP HA H N N 386 TRP HB2 H N N 387 TRP HB3 H N N 388 TRP HD1 H N N 389 TRP HE1 H N N 390 TRP HE3 H N N 391 TRP HZ2 H N N 392 TRP HZ3 H N N 393 TRP HH2 H N N 394 TRP HXT H N N 395 TYR N N N N 396 TYR CA C N S 397 TYR C C N N 398 TYR O O N N 399 TYR CB C N N 400 TYR CG C Y N 401 TYR CD1 C Y N 402 TYR CD2 C Y N 403 TYR CE1 C Y N 404 TYR CE2 C Y N 405 TYR CZ C Y N 406 TYR OH O N N 407 TYR OXT O N N 408 TYR H H N N 409 TYR H2 H N N 410 TYR HA H N N 411 TYR HB2 H N N 412 TYR HB3 H N N 413 TYR HD1 H N N 414 TYR HD2 H N N 415 TYR HE1 H N N 416 TYR HE2 H N N 417 TYR HH H N N 418 TYR HXT H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1BKW O1 C2 sing N N 1 A1BKW O1 C18 sing N N 2 A1BKW C2 C3 doub Y N 3 A1BKW C2 C7 sing Y N 4 A1BKW C3 C4 sing Y N 5 A1BKW C4 C5 doub Y N 6 A1BKW C5 C6 sing Y N 7 A1BKW C5 C8 sing N N 8 A1BKW C6 C7 doub Y N 9 A1BKW C8 C9 sing Y N 10 A1BKW C8 N12 doub Y N 11 A1BKW C9 C10 doub Y N 12 A1BKW C9 C13 sing Y N 13 A1BKW C10 N11 sing Y N 14 A1BKW C10 N16 sing Y N 15 A1BKW N11 N12 sing Y N 16 A1BKW N11 C24 sing N N 17 A1BKW C13 N14 doub Y N 18 A1BKW C13 N17 sing N N 19 A1BKW N14 C15 sing Y N 20 A1BKW C15 N16 doub Y N 21 A1BKW C18 C19 doub Y N 22 A1BKW C18 C23 sing Y N 23 A1BKW C19 C20 sing Y N 24 A1BKW C20 C21 doub Y N 25 A1BKW C21 C22 sing Y N 26 A1BKW C22 C23 doub Y N 27 A1BKW C24 C25 sing N N 28 A1BKW C24 C29 sing N N 29 A1BKW C25 C26 sing N N 30 A1BKW C26 C27 sing N N 31 A1BKW C27 N28 sing N N 32 A1BKW N28 C29 sing N N 33 A1BKW C4 H4 sing N N 34 A1BKW C6 H6 sing N N 35 A1BKW C7 H7 sing N N 36 A1BKW C15 H15 sing N N 37 A1BKW C20 H20 sing N N 38 A1BKW C21 H21 sing N N 39 A1BKW C22 H22 sing N N 40 A1BKW C24 H24 sing N N 41 A1BKW C26 H26A sing N N 42 A1BKW C26 H26B sing N N 43 A1BKW C19 H19 sing N N 44 A1BKW C23 H23 sing N N 45 A1BKW C25 H25A sing N N 46 A1BKW C25 H25B sing N N 47 A1BKW C27 H27A sing N N 48 A1BKW C27 H27B sing N N 49 A1BKW C29 H29A sing N N 50 A1BKW C29 H29B sing N N 51 A1BKW C3 H3 sing N N 52 A1BKW N17 H17A sing N N 53 A1BKW N17 H17B sing N N 54 A1BKW N28 H28 sing N N 55 ALA N CA sing N N 56 ALA N H sing N N 57 ALA N H2 sing N N 58 ALA CA C sing N N 59 ALA CA CB sing N N 60 ALA CA HA sing N N 61 ALA C O doub N N 62 ALA C OXT sing N N 63 ALA CB HB1 sing N N 64 ALA CB HB2 sing N N 65 ALA CB HB3 sing N N 66 ALA OXT HXT sing N N 67 ARG N CA sing N N 68 ARG N H sing N N 69 ARG N H2 sing N N 70 ARG CA C sing N N 71 ARG CA CB sing N N 72 ARG CA HA sing N N 73 ARG C O doub N N 74 ARG C OXT sing N N 75 ARG CB CG sing N N 76 ARG CB HB2 sing N N 77 ARG CB HB3 sing N N 78 ARG CG CD sing N N 79 ARG CG HG2 sing N N 80 ARG CG HG3 sing N N 81 ARG CD NE sing N N 82 ARG CD HD2 sing N N 83 ARG CD HD3 sing N N 84 ARG NE CZ sing N N 85 ARG NE HE sing N N 86 ARG CZ NH1 sing N N 87 ARG CZ NH2 doub N N 88 ARG NH1 HH11 sing N N 89 ARG NH1 HH12 sing N N 90 ARG NH2 HH21 sing N N 91 ARG NH2 HH22 sing N N 92 ARG OXT HXT sing N N 93 ASN N CA sing N N 94 ASN N H sing N N 95 ASN N H2 sing N N 96 ASN CA C sing N N 97 ASN CA CB sing N N 98 ASN CA HA sing N N 99 ASN C O doub N N 100 ASN C OXT sing N N 101 ASN CB CG sing N N 102 ASN CB HB2 sing N N 103 ASN CB HB3 sing N N 104 ASN CG OD1 doub N N 105 ASN CG ND2 sing N N 106 ASN ND2 HD21 sing N N 107 ASN ND2 HD22 sing N N 108 ASN OXT HXT sing N N 109 ASP N CA sing N N 110 ASP N H sing N N 111 ASP N H2 sing N N 112 ASP CA C sing N N 113 ASP CA CB sing N N 114 ASP CA HA sing N N 115 ASP C O doub N N 116 ASP C OXT sing N N 117 ASP CB CG sing N N 118 ASP CB HB2 sing N N 119 ASP CB HB3 sing N N 120 ASP CG OD1 doub N N 121 ASP CG OD2 sing N N 122 ASP OD2 HD2 sing N N 123 ASP OXT HXT sing N N 124 CYS N CA sing N N 125 CYS N H sing N N 126 CYS N H2 sing N N 127 CYS CA C sing N N 128 CYS CA CB sing N N 129 CYS CA HA sing N N 130 CYS C O doub N N 131 CYS C OXT sing N N 132 CYS CB SG sing N N 133 CYS CB HB2 sing N N 134 CYS CB HB3 sing N N 135 CYS SG HG sing N N 136 CYS OXT HXT sing N N 137 GLN N CA sing N N 138 GLN N H sing N N 139 GLN N H2 sing N N 140 GLN CA C sing N N 141 GLN CA CB sing N N 142 GLN CA HA sing N N 143 GLN C O doub N N 144 GLN C OXT sing N N 145 GLN CB CG sing N N 146 GLN CB HB2 sing N N 147 GLN CB HB3 sing N N 148 GLN CG CD sing N N 149 GLN CG HG2 sing N N 150 GLN CG HG3 sing N N 151 GLN CD OE1 doub N N 152 GLN CD NE2 sing N N 153 GLN NE2 HE21 sing N N 154 GLN NE2 HE22 sing N N 155 GLN OXT HXT sing N N 156 GLU N CA sing N N 157 GLU N H sing N N 158 GLU N H2 sing N N 159 GLU CA C sing N N 160 GLU CA CB sing N N 161 GLU CA HA sing N N 162 GLU C O doub N N 163 GLU C OXT sing N N 164 GLU CB CG sing N N 165 GLU CB HB2 sing N N 166 GLU CB HB3 sing N N 167 GLU CG CD sing N N 168 GLU CG HG2 sing N N 169 GLU CG HG3 sing N N 170 GLU CD OE1 doub N N 171 GLU CD OE2 sing N N 172 GLU OE2 HE2 sing N N 173 GLU OXT HXT sing N N 174 GLY N CA sing N N 175 GLY N H sing N N 176 GLY N H2 sing N N 177 GLY CA C sing N N 178 GLY CA HA2 sing N N 179 GLY CA HA3 sing N N 180 GLY C O doub N N 181 GLY C OXT sing N N 182 GLY OXT HXT sing N N 183 HIS N CA sing N N 184 HIS N H sing N N 185 HIS N H2 sing N N 186 HIS CA C sing N N 187 HIS CA CB sing N N 188 HIS CA HA sing N N 189 HIS C O doub N N 190 HIS C OXT sing N N 191 HIS CB CG sing N N 192 HIS CB HB2 sing N N 193 HIS CB HB3 sing N N 194 HIS CG ND1 sing Y N 195 HIS CG CD2 doub Y N 196 HIS ND1 CE1 doub Y N 197 HIS ND1 HD1 sing N N 198 HIS CD2 NE2 sing Y N 199 HIS CD2 HD2 sing N N 200 HIS CE1 NE2 sing Y N 201 HIS CE1 HE1 sing N N 202 HIS NE2 HE2 sing N N 203 HIS OXT HXT sing N N 204 ILE N CA sing N N 205 ILE N H sing N N 206 ILE N H2 sing N N 207 ILE CA C sing N N 208 ILE CA CB sing N N 209 ILE CA HA sing N N 210 ILE C O doub N N 211 ILE C OXT sing N N 212 ILE CB CG1 sing N N 213 ILE CB CG2 sing N N 214 ILE CB HB sing N N 215 ILE CG1 CD1 sing N N 216 ILE CG1 HG12 sing N N 217 ILE CG1 HG13 sing N N 218 ILE CG2 HG21 sing N N 219 ILE CG2 HG22 sing N N 220 ILE CG2 HG23 sing N N 221 ILE CD1 HD11 sing N N 222 ILE CD1 HD12 sing N N 223 ILE CD1 HD13 sing N N 224 ILE OXT HXT sing N N 225 LEU N CA sing N N 226 LEU N H sing N N 227 LEU N H2 sing N N 228 LEU CA C sing N N 229 LEU CA CB sing N N 230 LEU CA HA sing N N 231 LEU C O doub N N 232 LEU C OXT sing N N 233 LEU CB CG sing N N 234 LEU CB HB2 sing N N 235 LEU CB HB3 sing N N 236 LEU CG CD1 sing N N 237 LEU CG CD2 sing N N 238 LEU CG HG sing N N 239 LEU CD1 HD11 sing N N 240 LEU CD1 HD12 sing N N 241 LEU CD1 HD13 sing N N 242 LEU CD2 HD21 sing N N 243 LEU CD2 HD22 sing N N 244 LEU CD2 HD23 sing N N 245 LEU OXT HXT sing N N 246 LYS N CA sing N N 247 LYS N H sing N N 248 LYS N H2 sing N N 249 LYS CA C sing N N 250 LYS CA CB sing N N 251 LYS CA HA sing N N 252 LYS C O doub N N 253 LYS C OXT sing N N 254 LYS CB CG sing N N 255 LYS CB HB2 sing N N 256 LYS CB HB3 sing N N 257 LYS CG CD sing N N 258 LYS CG HG2 sing N N 259 LYS CG HG3 sing N N 260 LYS CD CE sing N N 261 LYS CD HD2 sing N N 262 LYS CD HD3 sing N N 263 LYS CE NZ sing N N 264 LYS CE HE2 sing N N 265 LYS CE HE3 sing N N 266 LYS NZ HZ1 sing N N 267 LYS NZ HZ2 sing N N 268 LYS NZ HZ3 sing N N 269 LYS OXT HXT sing N N 270 MET N CA sing N N 271 MET N H sing N N 272 MET N H2 sing N N 273 MET CA C sing N N 274 MET CA CB sing N N 275 MET CA HA sing N N 276 MET C O doub N N 277 MET C OXT sing N N 278 MET CB CG sing N N 279 MET CB HB2 sing N N 280 MET CB HB3 sing N N 281 MET CG SD sing N N 282 MET CG HG2 sing N N 283 MET CG HG3 sing N N 284 MET SD CE sing N N 285 MET CE HE1 sing N N 286 MET CE HE2 sing N N 287 MET CE HE3 sing N N 288 MET OXT HXT sing N N 289 PHE N CA sing N N 290 PHE N H sing N N 291 PHE N H2 sing N N 292 PHE CA C sing N N 293 PHE CA CB sing N N 294 PHE CA HA sing N N 295 PHE C O doub N N 296 PHE C OXT sing N N 297 PHE CB CG sing N N 298 PHE CB HB2 sing N N 299 PHE CB HB3 sing N N 300 PHE CG CD1 doub Y N 301 PHE CG CD2 sing Y N 302 PHE CD1 CE1 sing Y N 303 PHE CD1 HD1 sing N N 304 PHE CD2 CE2 doub Y N 305 PHE CD2 HD2 sing N N 306 PHE CE1 CZ doub Y N 307 PHE CE1 HE1 sing N N 308 PHE CE2 CZ sing Y N 309 PHE CE2 HE2 sing N N 310 PHE CZ HZ sing N N 311 PHE OXT HXT sing N N 312 PRO N CA sing N N 313 PRO N CD sing N N 314 PRO N H sing N N 315 PRO CA C sing N N 316 PRO CA CB sing N N 317 PRO CA HA sing N N 318 PRO C O doub N N 319 PRO C OXT sing N N 320 PRO CB CG sing N N 321 PRO CB HB2 sing N N 322 PRO CB HB3 sing N N 323 PRO CG CD sing N N 324 PRO CG HG2 sing N N 325 PRO CG HG3 sing N N 326 PRO CD HD2 sing N N 327 PRO CD HD3 sing N N 328 PRO OXT HXT sing N N 329 SER N CA sing N N 330 SER N H sing N N 331 SER N H2 sing N N 332 SER CA C sing N N 333 SER CA CB sing N N 334 SER CA HA sing N N 335 SER C O doub N N 336 SER C OXT sing N N 337 SER CB OG sing N N 338 SER CB HB2 sing N N 339 SER CB HB3 sing N N 340 SER OG HG sing N N 341 SER OXT HXT sing N N 342 THR N CA sing N N 343 THR N H sing N N 344 THR N H2 sing N N 345 THR CA C sing N N 346 THR CA CB sing N N 347 THR CA HA sing N N 348 THR C O doub N N 349 THR C OXT sing N N 350 THR CB OG1 sing N N 351 THR CB CG2 sing N N 352 THR CB HB sing N N 353 THR OG1 HG1 sing N N 354 THR CG2 HG21 sing N N 355 THR CG2 HG22 sing N N 356 THR CG2 HG23 sing N N 357 THR OXT HXT sing N N 358 TRP N CA sing N N 359 TRP N H sing N N 360 TRP N H2 sing N N 361 TRP CA C sing N N 362 TRP CA CB sing N N 363 TRP CA HA sing N N 364 TRP C O doub N N 365 TRP C OXT sing N N 366 TRP CB CG sing N N 367 TRP CB HB2 sing N N 368 TRP CB HB3 sing N N 369 TRP CG CD1 doub Y N 370 TRP CG CD2 sing Y N 371 TRP CD1 NE1 sing Y N 372 TRP CD1 HD1 sing N N 373 TRP CD2 CE2 doub Y N 374 TRP CD2 CE3 sing Y N 375 TRP NE1 CE2 sing Y N 376 TRP NE1 HE1 sing N N 377 TRP CE2 CZ2 sing Y N 378 TRP CE3 CZ3 doub Y N 379 TRP CE3 HE3 sing N N 380 TRP CZ2 CH2 doub Y N 381 TRP CZ2 HZ2 sing N N 382 TRP CZ3 CH2 sing Y N 383 TRP CZ3 HZ3 sing N N 384 TRP CH2 HH2 sing N N 385 TRP OXT HXT sing N N 386 TYR N CA sing N N 387 TYR N H sing N N 388 TYR N H2 sing N N 389 TYR CA C sing N N 390 TYR CA CB sing N N 391 TYR CA HA sing N N 392 TYR C O doub N N 393 TYR C OXT sing N N 394 TYR CB CG sing N N 395 TYR CB HB2 sing N N 396 TYR CB HB3 sing N N 397 TYR CG CD1 doub Y N 398 TYR CG CD2 sing Y N 399 TYR CD1 CE1 sing Y N 400 TYR CD1 HD1 sing N N 401 TYR CD2 CE2 doub Y N 402 TYR CD2 HD2 sing N N 403 TYR CE1 CZ doub Y N 404 TYR CE1 HE1 sing N N 405 TYR CE2 CZ sing Y N 406 TYR CE2 HE2 sing N N 407 TYR CZ OH sing N N 408 TYR OH HH sing N N 409 TYR OXT HXT sing N N 410 VAL N CA sing N N 411 VAL N H sing N N 412 VAL N H2 sing N N 413 VAL CA C sing N N 414 VAL CA CB sing N N 415 VAL CA HA sing N N 416 VAL C O doub N N 417 VAL C OXT sing N N 418 VAL CB CG1 sing N N 419 VAL CB CG2 sing N N 420 VAL CB HB sing N N 421 VAL CG1 HG11 sing N N 422 VAL CG1 HG12 sing N N 423 VAL CG1 HG13 sing N N 424 VAL CG2 HG21 sing N N 425 VAL CG2 HG22 sing N N 426 VAL CG2 HG23 sing N N 427 VAL OXT HXT sing N N 428 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9EJS _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 61' _space_group.name_Hall 'P 61' _space_group.IT_number 169 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9ME2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009412 _atom_sites.fract_transf_matrix[1][2] 0.005434 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010868 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021273 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.99627 ? ? ? 14.84254 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #