data_9ME3 # _entry.id 9ME3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ME3 pdb_00009me3 10.2210/pdb9me3/pdb WWPDB D_1000290800 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-08-13 ? 2 'Structure model' 1 1 2025-08-20 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9ME3 _pdbx_database_status.recvd_initial_deposition_date 2024-12-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'PDB entries for the same citation' 9EJJ unspecified PDB 'PDB entries for the same citation' 9EJR unspecified PDB 'PDB entries for the same citation' 9EJS unspecified PDB 'PDB entries for the same citation' 9EJX unspecified PDB 'PDB entries for the same citation' 9ME2 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email amyand@iastate.edu _pdbx_contact_author.name_first Amy _pdbx_contact_author.name_last Andreotti _pdbx_contact_author.name_mi H _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6952-7244 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lin, D.Y.' 1 0000-0001-6149-5236 'Andreotti, A.H.' 2 0000-0002-6952-7244 'Tonge, P.J.' 3 0000-0003-1606-3471 'Bravo, E.' 4 0000-0002-7997-5534 'Li, X.' 5 0000-0001-8945-2107 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 147 _citation.language ? _citation.page_first 27876 _citation.page_last 27891 _citation.title ;Modulating the Binding Kinetics of Bruton's Tyrosine Kinase Inhibitors through Transition-State Effects. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.5c07063 _citation.pdbx_database_id_PubMed 40726426 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bravo Jr., E.' 1 ? primary 'Li, Y.' 2 ? primary 'Lin, D.Y.' 3 ? primary 'Srinivasan, B.' 4 ? primary 'Barone, M.' 5 ? primary 'Li, S.X.' 6 ? primary 'DelloRusso, F.' 7 ? primary 'Rahiyanath, A.S.' 8 ? primary 'Corrionero, A.' 9 ? primary 'Alfonso, P.' 10 ? primary 'Prendiville, N.' 11 ? primary 'Kozakov, D.' 12 ? primary 'Andreotti, A.H.' 13 ? primary 'Tonge, P.J.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase BTK' 31821.521 1 2.7.10.2 'K430R, L542M, S543T, V555T, R562K, S564A, P565S,Y617P' ? ? 2 non-polymer syn '3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine' 303.318 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Agammaglobulinemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bruton tyrosine kinase,Kinase EMB' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIRMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIIT EYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGMTRYVLDDEYTSS TGSKFPVKWASPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLPRPHLASERVYTIMYSCW HEKADERPSFKILLSNILDVMDEESHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIRMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIIT EYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGMTRYVLDDEYTSS TGSKFPVKWASPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLPRPHLASERVYTIMYSCW HEKADERPSFKILLSNILDVMDEESHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine' _pdbx_entity_nonpoly.comp_id A1BJE # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ILE n 1 4 ASP n 1 5 PRO n 1 6 LYS n 1 7 ASP n 1 8 LEU n 1 9 THR n 1 10 PHE n 1 11 LEU n 1 12 LYS n 1 13 GLU n 1 14 LEU n 1 15 GLY n 1 16 THR n 1 17 GLY n 1 18 GLN n 1 19 PHE n 1 20 GLY n 1 21 VAL n 1 22 VAL n 1 23 LYS n 1 24 TYR n 1 25 GLY n 1 26 LYS n 1 27 TRP n 1 28 ARG n 1 29 GLY n 1 30 GLN n 1 31 TYR n 1 32 ASP n 1 33 VAL n 1 34 ALA n 1 35 ILE n 1 36 ARG n 1 37 MET n 1 38 ILE n 1 39 ARG n 1 40 GLU n 1 41 GLY n 1 42 SER n 1 43 MET n 1 44 SER n 1 45 GLU n 1 46 ASP n 1 47 GLU n 1 48 PHE n 1 49 ILE n 1 50 GLU n 1 51 GLU n 1 52 ALA n 1 53 LYS n 1 54 VAL n 1 55 MET n 1 56 MET n 1 57 ASN n 1 58 LEU n 1 59 SER n 1 60 HIS n 1 61 GLU n 1 62 LYS n 1 63 LEU n 1 64 VAL n 1 65 GLN n 1 66 LEU n 1 67 TYR n 1 68 GLY n 1 69 VAL n 1 70 CYS n 1 71 THR n 1 72 LYS n 1 73 GLN n 1 74 ARG n 1 75 PRO n 1 76 ILE n 1 77 PHE n 1 78 ILE n 1 79 ILE n 1 80 THR n 1 81 GLU n 1 82 TYR n 1 83 MET n 1 84 ALA n 1 85 ASN n 1 86 GLY n 1 87 CYS n 1 88 LEU n 1 89 LEU n 1 90 ASN n 1 91 TYR n 1 92 LEU n 1 93 ARG n 1 94 GLU n 1 95 MET n 1 96 ARG n 1 97 HIS n 1 98 ARG n 1 99 PHE n 1 100 GLN n 1 101 THR n 1 102 GLN n 1 103 GLN n 1 104 LEU n 1 105 LEU n 1 106 GLU n 1 107 MET n 1 108 CYS n 1 109 LYS n 1 110 ASP n 1 111 VAL n 1 112 CYS n 1 113 GLU n 1 114 ALA n 1 115 MET n 1 116 GLU n 1 117 TYR n 1 118 LEU n 1 119 GLU n 1 120 SER n 1 121 LYS n 1 122 GLN n 1 123 PHE n 1 124 LEU n 1 125 HIS n 1 126 ARG n 1 127 ASP n 1 128 LEU n 1 129 ALA n 1 130 ALA n 1 131 ARG n 1 132 ASN n 1 133 CYS n 1 134 LEU n 1 135 VAL n 1 136 ASN n 1 137 ASP n 1 138 GLN n 1 139 GLY n 1 140 VAL n 1 141 VAL n 1 142 LYS n 1 143 VAL n 1 144 SER n 1 145 ASP n 1 146 PHE n 1 147 GLY n 1 148 MET n 1 149 THR n 1 150 ARG n 1 151 TYR n 1 152 VAL n 1 153 LEU n 1 154 ASP n 1 155 ASP n 1 156 GLU n 1 157 TYR n 1 158 THR n 1 159 SER n 1 160 SER n 1 161 THR n 1 162 GLY n 1 163 SER n 1 164 LYS n 1 165 PHE n 1 166 PRO n 1 167 VAL n 1 168 LYS n 1 169 TRP n 1 170 ALA n 1 171 SER n 1 172 PRO n 1 173 GLU n 1 174 VAL n 1 175 LEU n 1 176 MET n 1 177 TYR n 1 178 SER n 1 179 LYS n 1 180 PHE n 1 181 SER n 1 182 SER n 1 183 LYS n 1 184 SER n 1 185 ASP n 1 186 ILE n 1 187 TRP n 1 188 ALA n 1 189 PHE n 1 190 GLY n 1 191 VAL n 1 192 LEU n 1 193 MET n 1 194 TRP n 1 195 GLU n 1 196 ILE n 1 197 TYR n 1 198 SER n 1 199 LEU n 1 200 GLY n 1 201 LYS n 1 202 MET n 1 203 PRO n 1 204 TYR n 1 205 GLU n 1 206 ARG n 1 207 PHE n 1 208 THR n 1 209 ASN n 1 210 SER n 1 211 GLU n 1 212 THR n 1 213 ALA n 1 214 GLU n 1 215 HIS n 1 216 ILE n 1 217 ALA n 1 218 GLN n 1 219 GLY n 1 220 LEU n 1 221 ARG n 1 222 LEU n 1 223 PRO n 1 224 ARG n 1 225 PRO n 1 226 HIS n 1 227 LEU n 1 228 ALA n 1 229 SER n 1 230 GLU n 1 231 ARG n 1 232 VAL n 1 233 TYR n 1 234 THR n 1 235 ILE n 1 236 MET n 1 237 TYR n 1 238 SER n 1 239 CYS n 1 240 TRP n 1 241 HIS n 1 242 GLU n 1 243 LYS n 1 244 ALA n 1 245 ASP n 1 246 GLU n 1 247 ARG n 1 248 PRO n 1 249 SER n 1 250 PHE n 1 251 LYS n 1 252 ILE n 1 253 LEU n 1 254 LEU n 1 255 SER n 1 256 ASN n 1 257 ILE n 1 258 LEU n 1 259 ASP n 1 260 VAL n 1 261 MET n 1 262 ASP n 1 263 GLU n 1 264 GLU n 1 265 SER n 1 266 HIS n 1 267 HIS n 1 268 HIS n 1 269 HIS n 1 270 HIS n 1 271 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Btk, Bpk' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1BJE non-polymer . '3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine' ? 'C17 H13 N5 O' 303.318 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 395 395 MET MET A . n A 1 2 GLU 2 396 396 GLU GLU A . n A 1 3 ILE 3 397 397 ILE ILE A . n A 1 4 ASP 4 398 398 ASP ASP A . n A 1 5 PRO 5 399 399 PRO PRO A . n A 1 6 LYS 6 400 400 LYS LYS A . n A 1 7 ASP 7 401 401 ASP ASP A . n A 1 8 LEU 8 402 402 LEU LEU A . n A 1 9 THR 9 403 403 THR THR A . n A 1 10 PHE 10 404 404 PHE PHE A . n A 1 11 LEU 11 405 405 LEU LEU A . n A 1 12 LYS 12 406 406 LYS LYS A . n A 1 13 GLU 13 407 407 GLU GLU A . n A 1 14 LEU 14 408 408 LEU LEU A . n A 1 15 GLY 15 409 409 GLY GLY A . n A 1 16 THR 16 410 410 THR THR A . n A 1 17 GLY 17 411 411 GLY GLY A . n A 1 18 GLN 18 412 412 GLN GLN A . n A 1 19 PHE 19 413 413 PHE PHE A . n A 1 20 GLY 20 414 414 GLY GLY A . n A 1 21 VAL 21 415 415 VAL VAL A . n A 1 22 VAL 22 416 416 VAL VAL A . n A 1 23 LYS 23 417 417 LYS LYS A . n A 1 24 TYR 24 418 418 TYR TYR A . n A 1 25 GLY 25 419 419 GLY GLY A . n A 1 26 LYS 26 420 420 LYS LYS A . n A 1 27 TRP 27 421 421 TRP TRP A . n A 1 28 ARG 28 422 422 ARG ARG A . n A 1 29 GLY 29 423 423 GLY GLY A . n A 1 30 GLN 30 424 424 GLN GLN A . n A 1 31 TYR 31 425 425 TYR TYR A . n A 1 32 ASP 32 426 426 ASP ASP A . n A 1 33 VAL 33 427 427 VAL VAL A . n A 1 34 ALA 34 428 428 ALA ALA A . n A 1 35 ILE 35 429 429 ILE ILE A . n A 1 36 ARG 36 430 430 ARG ARG A . n A 1 37 MET 37 431 431 MET MET A . n A 1 38 ILE 38 432 432 ILE ILE A . n A 1 39 ARG 39 433 433 ARG ARG A . n A 1 40 GLU 40 434 434 GLU GLU A . n A 1 41 GLY 41 435 435 GLY GLY A . n A 1 42 SER 42 436 436 SER SER A . n A 1 43 MET 43 437 437 MET MET A . n A 1 44 SER 44 438 438 SER SER A . n A 1 45 GLU 45 439 439 GLU GLU A . n A 1 46 ASP 46 440 440 ASP ASP A . n A 1 47 GLU 47 441 441 GLU GLU A . n A 1 48 PHE 48 442 442 PHE PHE A . n A 1 49 ILE 49 443 443 ILE ILE A . n A 1 50 GLU 50 444 444 GLU GLU A . n A 1 51 GLU 51 445 445 GLU GLU A . n A 1 52 ALA 52 446 446 ALA ALA A . n A 1 53 LYS 53 447 447 LYS LYS A . n A 1 54 VAL 54 448 448 VAL VAL A . n A 1 55 MET 55 449 449 MET MET A . n A 1 56 MET 56 450 450 MET MET A . n A 1 57 ASN 57 451 451 ASN ASN A . n A 1 58 LEU 58 452 452 LEU LEU A . n A 1 59 SER 59 453 453 SER SER A . n A 1 60 HIS 60 454 454 HIS HIS A . n A 1 61 GLU 61 455 455 GLU GLU A . n A 1 62 LYS 62 456 456 LYS LYS A . n A 1 63 LEU 63 457 457 LEU LEU A . n A 1 64 VAL 64 458 458 VAL VAL A . n A 1 65 GLN 65 459 459 GLN GLN A . n A 1 66 LEU 66 460 460 LEU LEU A . n A 1 67 TYR 67 461 461 TYR TYR A . n A 1 68 GLY 68 462 462 GLY GLY A . n A 1 69 VAL 69 463 463 VAL VAL A . n A 1 70 CYS 70 464 464 CYS CYS A . n A 1 71 THR 71 465 465 THR THR A . n A 1 72 LYS 72 466 466 LYS LYS A . n A 1 73 GLN 73 467 467 GLN GLN A . n A 1 74 ARG 74 468 468 ARG ARG A . n A 1 75 PRO 75 469 469 PRO PRO A . n A 1 76 ILE 76 470 470 ILE ILE A . n A 1 77 PHE 77 471 471 PHE PHE A . n A 1 78 ILE 78 472 472 ILE ILE A . n A 1 79 ILE 79 473 473 ILE ILE A . n A 1 80 THR 80 474 474 THR THR A . n A 1 81 GLU 81 475 475 GLU GLU A . n A 1 82 TYR 82 476 476 TYR TYR A . n A 1 83 MET 83 477 477 MET MET A . n A 1 84 ALA 84 478 478 ALA ALA A . n A 1 85 ASN 85 479 479 ASN ASN A . n A 1 86 GLY 86 480 480 GLY GLY A . n A 1 87 CYS 87 481 481 CYS CYS A . n A 1 88 LEU 88 482 482 LEU LEU A . n A 1 89 LEU 89 483 483 LEU LEU A . n A 1 90 ASN 90 484 484 ASN ASN A . n A 1 91 TYR 91 485 485 TYR TYR A . n A 1 92 LEU 92 486 486 LEU LEU A . n A 1 93 ARG 93 487 487 ARG ARG A . n A 1 94 GLU 94 488 488 GLU GLU A . n A 1 95 MET 95 489 489 MET MET A . n A 1 96 ARG 96 490 490 ARG ARG A . n A 1 97 HIS 97 491 491 HIS HIS A . n A 1 98 ARG 98 492 492 ARG ARG A . n A 1 99 PHE 99 493 493 PHE PHE A . n A 1 100 GLN 100 494 494 GLN GLN A . n A 1 101 THR 101 495 495 THR THR A . n A 1 102 GLN 102 496 496 GLN GLN A . n A 1 103 GLN 103 497 497 GLN GLN A . n A 1 104 LEU 104 498 498 LEU LEU A . n A 1 105 LEU 105 499 499 LEU LEU A . n A 1 106 GLU 106 500 500 GLU GLU A . n A 1 107 MET 107 501 501 MET MET A . n A 1 108 CYS 108 502 502 CYS CYS A . n A 1 109 LYS 109 503 503 LYS LYS A . n A 1 110 ASP 110 504 504 ASP ASP A . n A 1 111 VAL 111 505 505 VAL VAL A . n A 1 112 CYS 112 506 506 CYS CYS A . n A 1 113 GLU 113 507 507 GLU GLU A . n A 1 114 ALA 114 508 508 ALA ALA A . n A 1 115 MET 115 509 509 MET MET A . n A 1 116 GLU 116 510 510 GLU GLU A . n A 1 117 TYR 117 511 511 TYR TYR A . n A 1 118 LEU 118 512 512 LEU LEU A . n A 1 119 GLU 119 513 513 GLU GLU A . n A 1 120 SER 120 514 514 SER SER A . n A 1 121 LYS 121 515 515 LYS LYS A . n A 1 122 GLN 122 516 516 GLN GLN A . n A 1 123 PHE 123 517 517 PHE PHE A . n A 1 124 LEU 124 518 518 LEU LEU A . n A 1 125 HIS 125 519 519 HIS HIS A . n A 1 126 ARG 126 520 520 ARG ARG A . n A 1 127 ASP 127 521 521 ASP ASP A . n A 1 128 LEU 128 522 522 LEU LEU A . n A 1 129 ALA 129 523 523 ALA ALA A . n A 1 130 ALA 130 524 524 ALA ALA A . n A 1 131 ARG 131 525 525 ARG ARG A . n A 1 132 ASN 132 526 526 ASN ASN A . n A 1 133 CYS 133 527 527 CYS CYS A . n A 1 134 LEU 134 528 528 LEU LEU A . n A 1 135 VAL 135 529 529 VAL VAL A . n A 1 136 ASN 136 530 530 ASN ASN A . n A 1 137 ASP 137 531 531 ASP ASP A . n A 1 138 GLN 138 532 532 GLN GLN A . n A 1 139 GLY 139 533 533 GLY GLY A . n A 1 140 VAL 140 534 534 VAL VAL A . n A 1 141 VAL 141 535 535 VAL VAL A . n A 1 142 LYS 142 536 536 LYS LYS A . n A 1 143 VAL 143 537 537 VAL VAL A . n A 1 144 SER 144 538 538 SER SER A . n A 1 145 ASP 145 539 539 ASP ASP A . n A 1 146 PHE 146 540 540 PHE PHE A . n A 1 147 GLY 147 541 541 GLY GLY A . n A 1 148 MET 148 542 542 MET MET A . n A 1 149 THR 149 543 543 THR THR A . n A 1 150 ARG 150 544 544 ARG ARG A . n A 1 151 TYR 151 545 545 TYR TYR A . n A 1 152 VAL 152 546 546 VAL VAL A . n A 1 153 LEU 153 547 547 LEU LEU A . n A 1 154 ASP 154 548 548 ASP ASP A . n A 1 155 ASP 155 549 549 ASP ASP A . n A 1 156 GLU 156 550 550 GLU GLU A . n A 1 157 TYR 157 551 551 TYR TYR A . n A 1 158 THR 158 552 552 THR THR A . n A 1 159 SER 159 553 553 SER SER A . n A 1 160 SER 160 554 554 SER SER A . n A 1 161 THR 161 555 555 THR THR A . n A 1 162 GLY 162 556 556 GLY GLY A . n A 1 163 SER 163 557 557 SER SER A . n A 1 164 LYS 164 558 558 LYS LYS A . n A 1 165 PHE 165 559 559 PHE PHE A . n A 1 166 PRO 166 560 560 PRO PRO A . n A 1 167 VAL 167 561 561 VAL VAL A . n A 1 168 LYS 168 562 562 LYS LYS A . n A 1 169 TRP 169 563 563 TRP TRP A . n A 1 170 ALA 170 564 564 ALA ALA A . n A 1 171 SER 171 565 565 SER SER A . n A 1 172 PRO 172 566 566 PRO PRO A . n A 1 173 GLU 173 567 567 GLU GLU A . n A 1 174 VAL 174 568 568 VAL VAL A . n A 1 175 LEU 175 569 569 LEU LEU A . n A 1 176 MET 176 570 570 MET MET A . n A 1 177 TYR 177 571 571 TYR TYR A . n A 1 178 SER 178 572 572 SER SER A . n A 1 179 LYS 179 573 573 LYS LYS A . n A 1 180 PHE 180 574 574 PHE PHE A . n A 1 181 SER 181 575 575 SER SER A . n A 1 182 SER 182 576 576 SER SER A . n A 1 183 LYS 183 577 577 LYS LYS A . n A 1 184 SER 184 578 578 SER SER A . n A 1 185 ASP 185 579 579 ASP ASP A . n A 1 186 ILE 186 580 580 ILE ILE A . n A 1 187 TRP 187 581 581 TRP TRP A . n A 1 188 ALA 188 582 582 ALA ALA A . n A 1 189 PHE 189 583 583 PHE PHE A . n A 1 190 GLY 190 584 584 GLY GLY A . n A 1 191 VAL 191 585 585 VAL VAL A . n A 1 192 LEU 192 586 586 LEU LEU A . n A 1 193 MET 193 587 587 MET MET A . n A 1 194 TRP 194 588 588 TRP TRP A . n A 1 195 GLU 195 589 589 GLU GLU A . n A 1 196 ILE 196 590 590 ILE ILE A . n A 1 197 TYR 197 591 591 TYR TYR A . n A 1 198 SER 198 592 592 SER SER A . n A 1 199 LEU 199 593 593 LEU LEU A . n A 1 200 GLY 200 594 594 GLY GLY A . n A 1 201 LYS 201 595 595 LYS LYS A . n A 1 202 MET 202 596 596 MET MET A . n A 1 203 PRO 203 597 597 PRO PRO A . n A 1 204 TYR 204 598 598 TYR TYR A . n A 1 205 GLU 205 599 599 GLU GLU A . n A 1 206 ARG 206 600 600 ARG ARG A . n A 1 207 PHE 207 601 601 PHE PHE A . n A 1 208 THR 208 602 602 THR THR A . n A 1 209 ASN 209 603 603 ASN ASN A . n A 1 210 SER 210 604 604 SER SER A . n A 1 211 GLU 211 605 605 GLU GLU A . n A 1 212 THR 212 606 606 THR THR A . n A 1 213 ALA 213 607 607 ALA ALA A . n A 1 214 GLU 214 608 608 GLU GLU A . n A 1 215 HIS 215 609 609 HIS HIS A . n A 1 216 ILE 216 610 610 ILE ILE A . n A 1 217 ALA 217 611 611 ALA ALA A . n A 1 218 GLN 218 612 612 GLN GLN A . n A 1 219 GLY 219 613 613 GLY GLY A . n A 1 220 LEU 220 614 614 LEU LEU A . n A 1 221 ARG 221 615 615 ARG ARG A . n A 1 222 LEU 222 616 616 LEU LEU A . n A 1 223 PRO 223 617 617 PRO PRO A . n A 1 224 ARG 224 618 618 ARG ARG A . n A 1 225 PRO 225 619 619 PRO PRO A . n A 1 226 HIS 226 620 620 HIS HIS A . n A 1 227 LEU 227 621 621 LEU LEU A . n A 1 228 ALA 228 622 622 ALA ALA A . n A 1 229 SER 229 623 623 SER SER A . n A 1 230 GLU 230 624 624 GLU GLU A . n A 1 231 ARG 231 625 625 ARG ARG A . n A 1 232 VAL 232 626 626 VAL VAL A . n A 1 233 TYR 233 627 627 TYR TYR A . n A 1 234 THR 234 628 628 THR THR A . n A 1 235 ILE 235 629 629 ILE ILE A . n A 1 236 MET 236 630 630 MET MET A . n A 1 237 TYR 237 631 631 TYR TYR A . n A 1 238 SER 238 632 632 SER SER A . n A 1 239 CYS 239 633 633 CYS CYS A . n A 1 240 TRP 240 634 634 TRP TRP A . n A 1 241 HIS 241 635 635 HIS HIS A . n A 1 242 GLU 242 636 636 GLU GLU A . n A 1 243 LYS 243 637 637 LYS LYS A . n A 1 244 ALA 244 638 638 ALA ALA A . n A 1 245 ASP 245 639 639 ASP ASP A . n A 1 246 GLU 246 640 640 GLU GLU A . n A 1 247 ARG 247 641 641 ARG ARG A . n A 1 248 PRO 248 642 642 PRO PRO A . n A 1 249 SER 249 643 643 SER SER A . n A 1 250 PHE 250 644 644 PHE PHE A . n A 1 251 LYS 251 645 645 LYS LYS A . n A 1 252 ILE 252 646 646 ILE ILE A . n A 1 253 LEU 253 647 647 LEU LEU A . n A 1 254 LEU 254 648 648 LEU LEU A . n A 1 255 SER 255 649 649 SER SER A . n A 1 256 ASN 256 650 650 ASN ASN A . n A 1 257 ILE 257 651 651 ILE ILE A . n A 1 258 LEU 258 652 652 LEU LEU A . n A 1 259 ASP 259 653 653 ASP ASP A . n A 1 260 VAL 260 654 654 VAL VAL A . n A 1 261 MET 261 655 655 MET MET A . n A 1 262 ASP 262 656 656 ASP ASP A . n A 1 263 GLU 263 657 657 GLU GLU A . n A 1 264 GLU 264 658 658 GLU GLU A . n A 1 265 SER 265 659 659 SER SER A . n A 1 266 HIS 266 660 ? ? ? A . n A 1 267 HIS 267 661 ? ? ? A . n A 1 268 HIS 268 662 ? ? ? A . n A 1 269 HIS 269 663 ? ? ? A . n A 1 270 HIS 270 664 ? ? ? A . n A 1 271 HIS 271 665 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id A1BJE _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 701 _pdbx_nonpoly_scheme.auth_seq_num 701 _pdbx_nonpoly_scheme.pdb_mon_id A1BJE _pdbx_nonpoly_scheme.auth_mon_id 390 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 444 ? CG ? A GLU 50 CG 2 1 Y 1 A GLU 444 ? CD ? A GLU 50 CD 3 1 Y 1 A GLU 444 ? OE1 ? A GLU 50 OE1 4 1 Y 1 A GLU 444 ? OE2 ? A GLU 50 OE2 5 1 Y 1 A LYS 447 ? CG ? A LYS 53 CG 6 1 Y 1 A LYS 447 ? CD ? A LYS 53 CD 7 1 Y 1 A LYS 447 ? CE ? A LYS 53 CE 8 1 Y 1 A LYS 447 ? NZ ? A LYS 53 NZ 9 1 Y 1 A ARG 468 ? CG ? A ARG 74 CG 10 1 Y 1 A ARG 468 ? CD ? A ARG 74 CD 11 1 Y 1 A ARG 468 ? NE ? A ARG 74 NE 12 1 Y 1 A ARG 468 ? CZ ? A ARG 74 CZ 13 1 Y 1 A ARG 468 ? NH1 ? A ARG 74 NH1 14 1 Y 1 A ARG 468 ? NH2 ? A ARG 74 NH2 15 1 Y 1 A MET 489 ? CG ? A MET 95 CG 16 1 Y 1 A MET 489 ? SD ? A MET 95 SD 17 1 Y 1 A MET 489 ? CE ? A MET 95 CE 18 1 Y 1 A ARG 490 ? CG ? A ARG 96 CG 19 1 Y 1 A ARG 490 ? CD ? A ARG 96 CD 20 1 Y 1 A ARG 490 ? NE ? A ARG 96 NE 21 1 Y 1 A ARG 490 ? CZ ? A ARG 96 CZ 22 1 Y 1 A ARG 490 ? NH1 ? A ARG 96 NH1 23 1 Y 1 A ARG 490 ? NH2 ? A ARG 96 NH2 24 1 Y 1 A HIS 491 ? CG ? A HIS 97 CG 25 1 Y 1 A HIS 491 ? ND1 ? A HIS 97 ND1 26 1 Y 1 A HIS 491 ? CD2 ? A HIS 97 CD2 27 1 Y 1 A HIS 491 ? CE1 ? A HIS 97 CE1 28 1 Y 1 A HIS 491 ? NE2 ? A HIS 97 NE2 29 1 Y 1 A ARG 492 ? CG ? A ARG 98 CG 30 1 Y 1 A ARG 492 ? CD ? A ARG 98 CD 31 1 Y 1 A ARG 492 ? NE ? A ARG 98 NE 32 1 Y 1 A ARG 492 ? CZ ? A ARG 98 CZ 33 1 Y 1 A ARG 492 ? NH1 ? A ARG 98 NH1 34 1 Y 1 A ARG 492 ? NH2 ? A ARG 98 NH2 35 1 Y 1 A GLN 496 ? CG ? A GLN 102 CG 36 1 Y 1 A GLN 496 ? CD ? A GLN 102 CD 37 1 Y 1 A GLN 496 ? OE1 ? A GLN 102 OE1 38 1 Y 1 A GLN 496 ? NE2 ? A GLN 102 NE2 39 1 Y 1 A ARG 600 ? CG ? A ARG 206 CG 40 1 Y 1 A ARG 600 ? CD ? A ARG 206 CD 41 1 Y 1 A ARG 600 ? NE ? A ARG 206 NE 42 1 Y 1 A ARG 600 ? CZ ? A ARG 206 CZ 43 1 Y 1 A ARG 600 ? NH1 ? A ARG 206 NH1 44 1 Y 1 A ARG 600 ? NH2 ? A ARG 206 NH2 45 1 Y 1 A LYS 637 ? CG ? A LYS 243 CG 46 1 Y 1 A LYS 637 ? CD ? A LYS 243 CD 47 1 Y 1 A LYS 637 ? CE ? A LYS 243 CE 48 1 Y 1 A LYS 637 ? NZ ? A LYS 243 NZ 49 1 Y 1 A LYS 645 ? CG ? A LYS 251 CG 50 1 Y 1 A LYS 645 ? CD ? A LYS 251 CD 51 1 Y 1 A LYS 645 ? CE ? A LYS 251 CE 52 1 Y 1 A LYS 645 ? NZ ? A LYS 251 NZ 53 1 Y 1 A GLU 657 ? CG ? A GLU 263 CG 54 1 Y 1 A GLU 657 ? CD ? A GLU 263 CD 55 1 Y 1 A GLU 657 ? OE1 ? A GLU 263 OE1 56 1 Y 1 A GLU 657 ? OE2 ? A GLU 263 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9ME3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 107.630 _cell.length_a_esd ? _cell.length_b 107.630 _cell.length_b_esd ? _cell.length_c 45.276 _cell.length_c_esd ? _cell.volume 454222.079 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9ME3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall 'P 61' _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ME3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Sodium citrate tribasic dihydrate pH 5.5, 18% w/v Polyethylene glycol 8,000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-09-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.920153 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X17B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.920153 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X17B1 _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate 84.74 _reflns.entry_id 9ME3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.048 _reflns.d_resolution_low 34.646 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5760 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 42.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.280 _reflns.pdbx_Rpim_I_all 0.043 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.277 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.048 _reflns_shell.d_res_low 3.116 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 289 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 22.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.2833 _reflns_shell.pdbx_Rpim_I_all 0.07223 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.428 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 81.4 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.2737 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 84.88 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9ME3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.05 _refine.ls_d_res_low 19.34 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5758 _refine.ls_number_reflns_R_free 304 _refine.ls_number_reflns_R_work 5454 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.29 _refine.ls_percent_reflns_R_free 5.28 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2281 _refine.ls_R_factor_R_free 0.2879 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2248 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.3407 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2226 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.05 _refine_hist.d_res_low 19.34 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2134 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2111 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0043 ? 2193 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9458 ? 2965 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0530 ? 318 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0075 ? 376 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.1905 ? 801 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.05 3.16 . . 32 464 84.5 . . . . 0.3667 . . . . . . . . . . . 0.3570 'X-RAY DIFFRACTION' 3.16 3.28 . . 32 535 99.1 . . . . 0.3556 . . . . . . . . . . . 0.4512 'X-RAY DIFFRACTION' 3.28 3.43 . . 27 558 100 . . . . 0.3354 . . . . . . . . . . . 0.3779 'X-RAY DIFFRACTION' 3.43 3.61 . . 32 541 100 . . . . 0.2904 . . . . . . . . . . . 0.3989 'X-RAY DIFFRACTION' 3.61 3.83 . . 17 567 100 . . . . 0.2827 . . . . . . . . . . . 0.3384 'X-RAY DIFFRACTION' 3.84 4.12 . . 45 537 100 . . . . 0.2454 . . . . . . . . . . . 0.2856 'X-RAY DIFFRACTION' 4.13 4.54 . . 45 537 100 . . . . 0.2065 . . . . . . . . . . . 0.2613 'X-RAY DIFFRACTION' 4.54 5.18 . . 31 555 100 . . . . 0.1965 . . . . . . . . . . . 0.2775 'X-RAY DIFFRACTION' 5.19 6.48 . . 31 565 100 . . . . 0.1837 . . . . . . . . . . . 0.2813 'X-RAY DIFFRACTION' 6.49 19.34 . . 33 575 99.3 . . . . 0.1581 . . . . . . . . . . . 0.2160 # _struct.entry_id 9ME3 _struct.title ;Bruton's tyrosine kinase with mutations in the activation loop in complex with compound P301390 ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ME3 _struct_keywords.text 'inhibitor, kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex, TRANSFERASE' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BTK_MOUSE _struct_ref.pdbx_db_accession P35991 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITE YMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSV GSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWH EKADERPSFKILLSNILDVMDEES ; _struct_ref.pdbx_align_begin 396 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9ME3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 265 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35991 _struct_ref_seq.db_align_beg 396 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 659 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 396 _struct_ref_seq.pdbx_auth_seq_align_end 659 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9ME3 MET A 1 ? UNP P35991 ? ? 'initiating methionine' 395 1 1 9ME3 ARG A 36 ? UNP P35991 LYS 430 'engineered mutation' 430 2 1 9ME3 MET A 148 ? UNP P35991 LEU 542 'engineered mutation' 542 3 1 9ME3 THR A 149 ? UNP P35991 SER 543 'engineered mutation' 543 4 1 9ME3 THR A 161 ? UNP P35991 VAL 555 'engineered mutation' 555 5 1 9ME3 LYS A 168 ? UNP P35991 ARG 562 'engineered mutation' 562 6 1 9ME3 ALA A 170 ? UNP P35991 SER 564 'engineered mutation' 564 7 1 9ME3 SER A 171 ? UNP P35991 PRO 565 'engineered mutation' 565 8 1 9ME3 PRO A 223 ? UNP P35991 TYR 617 'engineered mutation' 617 9 1 9ME3 HIS A 266 ? UNP P35991 ? ? 'expression tag' 660 10 1 9ME3 HIS A 267 ? UNP P35991 ? ? 'expression tag' 661 11 1 9ME3 HIS A 268 ? UNP P35991 ? ? 'expression tag' 662 12 1 9ME3 HIS A 269 ? UNP P35991 ? ? 'expression tag' 663 13 1 9ME3 HIS A 270 ? UNP P35991 ? ? 'expression tag' 664 14 1 9ME3 HIS A 271 ? UNP P35991 ? ? 'expression tag' 665 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 4 ? LYS A 6 ? ASP A 398 LYS A 400 5 ? 3 HELX_P HELX_P2 AA2 SER A 44 ? LEU A 58 ? SER A 438 LEU A 452 1 ? 15 HELX_P HELX_P3 AA3 CYS A 87 ? MET A 95 ? CYS A 481 MET A 489 1 ? 9 HELX_P HELX_P4 AA4 ARG A 96 ? PHE A 99 ? ARG A 490 PHE A 493 5 ? 4 HELX_P HELX_P5 AA5 GLN A 100 ? LYS A 121 ? GLN A 494 LYS A 515 1 ? 22 HELX_P HELX_P6 AA6 ALA A 129 ? ARG A 131 ? ALA A 523 ARG A 525 5 ? 3 HELX_P HELX_P7 AA7 GLY A 147 ? VAL A 152 ? GLY A 541 VAL A 546 5 ? 6 HELX_P HELX_P8 AA8 ASP A 154 ? SER A 159 ? ASP A 548 SER A 553 1 ? 6 HELX_P HELX_P9 AA9 PRO A 166 ? ALA A 170 ? PRO A 560 ALA A 564 5 ? 5 HELX_P HELX_P10 AB1 SER A 171 ? TYR A 177 ? SER A 565 TYR A 571 1 ? 7 HELX_P HELX_P11 AB2 SER A 181 ? SER A 198 ? SER A 575 SER A 592 1 ? 18 HELX_P HELX_P12 AB3 THR A 208 ? GLN A 218 ? THR A 602 GLN A 612 1 ? 11 HELX_P HELX_P13 AB4 SER A 229 ? CYS A 239 ? SER A 623 CYS A 633 1 ? 11 HELX_P HELX_P14 AB5 LYS A 243 ? ARG A 247 ? LYS A 637 ARG A 641 5 ? 5 HELX_P HELX_P15 AB6 SER A 249 ? GLU A 264 ? SER A 643 GLU A 658 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 74 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 468 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 75 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 469 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.90 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 8 ? GLY A 17 ? LEU A 402 GLY A 411 AA1 2 GLY A 20 ? TRP A 27 ? GLY A 414 TRP A 421 AA1 3 TYR A 31 ? ILE A 38 ? TYR A 425 ILE A 432 AA1 4 PHE A 77 ? GLU A 81 ? PHE A 471 GLU A 475 AA1 5 LEU A 66 ? CYS A 70 ? LEU A 460 CYS A 464 AA2 1 CYS A 133 ? VAL A 135 ? CYS A 527 VAL A 529 AA2 2 VAL A 141 ? VAL A 143 ? VAL A 535 VAL A 537 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY A 411 O GLY A 20 ? O GLY A 414 AA1 2 3 N TRP A 27 ? N TRP A 421 O TYR A 31 ? O TYR A 425 AA1 3 4 N ALA A 34 ? N ALA A 428 O THR A 80 ? O THR A 474 AA1 4 5 O ILE A 79 ? O ILE A 473 N TYR A 67 ? N TYR A 461 AA2 1 2 N LEU A 134 ? N LEU A 528 O LYS A 142 ? O LYS A 536 # _pdbx_entry_details.entry_id 9ME3 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 458 ? ? -49.93 108.59 2 1 ARG A 520 ? ? 84.63 -7.62 3 1 ASP A 521 ? ? -156.52 46.43 4 1 ARG A 600 ? ? -99.94 34.84 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 -x,-y,z+1/2 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 34.9168913128 _pdbx_refine_tls.origin_y -21.1878322409 _pdbx_refine_tls.origin_z -1.30129423201 _pdbx_refine_tls.T[1][1] 0.495033700779 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0362006860361 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0985812524178 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.448752930454 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.102358529953 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.426566995818 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 4.05605706287 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.618144330694 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 1.29697053692 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 3.96736133453 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.712770105942 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.63233503844 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.43264650989 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0727172995486 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.35812454441 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.138952151327 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.102841500385 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.143207790075 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.50899658552 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.173839015407 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.496385699921 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 395 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 701 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 660 ? A HIS 266 2 1 Y 1 A HIS 661 ? A HIS 267 3 1 Y 1 A HIS 662 ? A HIS 268 4 1 Y 1 A HIS 663 ? A HIS 269 5 1 Y 1 A HIS 664 ? A HIS 270 6 1 Y 1 A HIS 665 ? A HIS 271 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1BJE C15 C Y N 1 A1BJE C22 C Y N 2 A1BJE C21 C Y N 3 A1BJE C20 C Y N 4 A1BJE C19 C Y N 5 A1BJE C18 C Y N 6 A1BJE C13 C Y N 7 A1BJE C23 C Y N 8 A1BJE C10 C Y N 9 A1BJE C02 C Y N 10 A1BJE C03 C Y N 11 A1BJE C04 C Y N 12 A1BJE C05 C Y N 13 A1BJE C06 C Y N 14 A1BJE C07 C Y N 15 A1BJE C08 C Y N 16 A1BJE C09 C Y N 17 A1BJE N11 N Y N 18 A1BJE N12 N Y N 19 A1BJE N14 N Y N 20 A1BJE N16 N Y N 21 A1BJE N17 N N N 22 A1BJE O01 O N N 23 A1BJE H151 H N N 24 A1BJE H221 H N N 25 A1BJE H211 H N N 26 A1BJE H201 H N N 27 A1BJE H191 H N N 28 A1BJE H231 H N N 29 A1BJE H031 H N N 30 A1BJE H041 H N N 31 A1BJE H061 H N N 32 A1BJE H071 H N N 33 A1BJE H1 H N N 34 A1BJE H172 H N N 35 A1BJE H171 H N N 36 ALA N N N N 37 ALA CA C N S 38 ALA C C N N 39 ALA O O N N 40 ALA CB C N N 41 ALA OXT O N N 42 ALA H H N N 43 ALA H2 H N N 44 ALA HA H N N 45 ALA HB1 H N N 46 ALA HB2 H N N 47 ALA HB3 H N N 48 ALA HXT H N N 49 ARG N N N N 50 ARG CA C N S 51 ARG C C N N 52 ARG O O N N 53 ARG CB C N N 54 ARG CG C N N 55 ARG CD C N N 56 ARG NE N N N 57 ARG CZ C N N 58 ARG NH1 N N N 59 ARG NH2 N N N 60 ARG OXT O N N 61 ARG H H N N 62 ARG H2 H N N 63 ARG HA H N N 64 ARG HB2 H N N 65 ARG HB3 H N N 66 ARG HG2 H N N 67 ARG HG3 H N N 68 ARG HD2 H N N 69 ARG HD3 H N N 70 ARG HE H N N 71 ARG HH11 H N N 72 ARG HH12 H N N 73 ARG HH21 H N N 74 ARG HH22 H N N 75 ARG HXT H N N 76 ASN N N N N 77 ASN CA C N S 78 ASN C C N N 79 ASN O O N N 80 ASN CB C N N 81 ASN CG C N N 82 ASN OD1 O N N 83 ASN ND2 N N N 84 ASN OXT O N N 85 ASN H H N N 86 ASN H2 H N N 87 ASN HA H N N 88 ASN HB2 H N N 89 ASN HB3 H N N 90 ASN HD21 H N N 91 ASN HD22 H N N 92 ASN HXT H N N 93 ASP N N N N 94 ASP CA C N S 95 ASP C C N N 96 ASP O O N N 97 ASP CB C N N 98 ASP CG C N N 99 ASP OD1 O N N 100 ASP OD2 O N N 101 ASP OXT O N N 102 ASP H H N N 103 ASP H2 H N N 104 ASP HA H N N 105 ASP HB2 H N N 106 ASP HB3 H N N 107 ASP HD2 H N N 108 ASP HXT H N N 109 CYS N N N N 110 CYS CA C N R 111 CYS C C N N 112 CYS O O N N 113 CYS CB C N N 114 CYS SG S N N 115 CYS OXT O N N 116 CYS H H N N 117 CYS H2 H N N 118 CYS HA H N N 119 CYS HB2 H N N 120 CYS HB3 H N N 121 CYS HG H N N 122 CYS HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 HIS N N N N 173 HIS CA C N S 174 HIS C C N N 175 HIS O O N N 176 HIS CB C N N 177 HIS CG C Y N 178 HIS ND1 N Y N 179 HIS CD2 C Y N 180 HIS CE1 C Y N 181 HIS NE2 N Y N 182 HIS OXT O N N 183 HIS H H N N 184 HIS H2 H N N 185 HIS HA H N N 186 HIS HB2 H N N 187 HIS HB3 H N N 188 HIS HD1 H N N 189 HIS HD2 H N N 190 HIS HE1 H N N 191 HIS HE2 H N N 192 HIS HXT H N N 193 ILE N N N N 194 ILE CA C N S 195 ILE C C N N 196 ILE O O N N 197 ILE CB C N S 198 ILE CG1 C N N 199 ILE CG2 C N N 200 ILE CD1 C N N 201 ILE OXT O N N 202 ILE H H N N 203 ILE H2 H N N 204 ILE HA H N N 205 ILE HB H N N 206 ILE HG12 H N N 207 ILE HG13 H N N 208 ILE HG21 H N N 209 ILE HG22 H N N 210 ILE HG23 H N N 211 ILE HD11 H N N 212 ILE HD12 H N N 213 ILE HD13 H N N 214 ILE HXT H N N 215 LEU N N N N 216 LEU CA C N S 217 LEU C C N N 218 LEU O O N N 219 LEU CB C N N 220 LEU CG C N N 221 LEU CD1 C N N 222 LEU CD2 C N N 223 LEU OXT O N N 224 LEU H H N N 225 LEU H2 H N N 226 LEU HA H N N 227 LEU HB2 H N N 228 LEU HB3 H N N 229 LEU HG H N N 230 LEU HD11 H N N 231 LEU HD12 H N N 232 LEU HD13 H N N 233 LEU HD21 H N N 234 LEU HD22 H N N 235 LEU HD23 H N N 236 LEU HXT H N N 237 LYS N N N N 238 LYS CA C N S 239 LYS C C N N 240 LYS O O N N 241 LYS CB C N N 242 LYS CG C N N 243 LYS CD C N N 244 LYS CE C N N 245 LYS NZ N N N 246 LYS OXT O N N 247 LYS H H N N 248 LYS H2 H N N 249 LYS HA H N N 250 LYS HB2 H N N 251 LYS HB3 H N N 252 LYS HG2 H N N 253 LYS HG3 H N N 254 LYS HD2 H N N 255 LYS HD3 H N N 256 LYS HE2 H N N 257 LYS HE3 H N N 258 LYS HZ1 H N N 259 LYS HZ2 H N N 260 LYS HZ3 H N N 261 LYS HXT H N N 262 MET N N N N 263 MET CA C N S 264 MET C C N N 265 MET O O N N 266 MET CB C N N 267 MET CG C N N 268 MET SD S N N 269 MET CE C N N 270 MET OXT O N N 271 MET H H N N 272 MET H2 H N N 273 MET HA H N N 274 MET HB2 H N N 275 MET HB3 H N N 276 MET HG2 H N N 277 MET HG3 H N N 278 MET HE1 H N N 279 MET HE2 H N N 280 MET HE3 H N N 281 MET HXT H N N 282 PHE N N N N 283 PHE CA C N S 284 PHE C C N N 285 PHE O O N N 286 PHE CB C N N 287 PHE CG C Y N 288 PHE CD1 C Y N 289 PHE CD2 C Y N 290 PHE CE1 C Y N 291 PHE CE2 C Y N 292 PHE CZ C Y N 293 PHE OXT O N N 294 PHE H H N N 295 PHE H2 H N N 296 PHE HA H N N 297 PHE HB2 H N N 298 PHE HB3 H N N 299 PHE HD1 H N N 300 PHE HD2 H N N 301 PHE HE1 H N N 302 PHE HE2 H N N 303 PHE HZ H N N 304 PHE HXT H N N 305 PRO N N N N 306 PRO CA C N S 307 PRO C C N N 308 PRO O O N N 309 PRO CB C N N 310 PRO CG C N N 311 PRO CD C N N 312 PRO OXT O N N 313 PRO H H N N 314 PRO HA H N N 315 PRO HB2 H N N 316 PRO HB3 H N N 317 PRO HG2 H N N 318 PRO HG3 H N N 319 PRO HD2 H N N 320 PRO HD3 H N N 321 PRO HXT H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1BJE O01 C02 sing N N 1 A1BJE C02 C03 doub Y N 2 A1BJE C03 C04 sing Y N 3 A1BJE C04 C05 doub Y N 4 A1BJE C05 C06 sing Y N 5 A1BJE C06 C07 doub Y N 6 A1BJE C07 C02 sing Y N 7 A1BJE C05 C08 sing N N 8 A1BJE C08 C09 sing Y N 9 A1BJE C09 C10 doub Y N 10 A1BJE C10 N11 sing Y N 11 A1BJE N11 N12 sing Y N 12 A1BJE N12 C08 doub Y N 13 A1BJE C09 C13 sing Y N 14 A1BJE C13 N14 doub Y N 15 A1BJE N14 C15 sing Y N 16 A1BJE C15 N16 doub Y N 17 A1BJE N16 C10 sing Y N 18 A1BJE C13 N17 sing N N 19 A1BJE O01 C18 sing N N 20 A1BJE C18 C19 doub Y N 21 A1BJE C19 C20 sing Y N 22 A1BJE C20 C21 doub Y N 23 A1BJE C21 C22 sing Y N 24 A1BJE C22 C23 doub Y N 25 A1BJE C23 C18 sing Y N 26 A1BJE C15 H151 sing N N 27 A1BJE C22 H221 sing N N 28 A1BJE C21 H211 sing N N 29 A1BJE C20 H201 sing N N 30 A1BJE C19 H191 sing N N 31 A1BJE C23 H231 sing N N 32 A1BJE C03 H031 sing N N 33 A1BJE C04 H041 sing N N 34 A1BJE C06 H061 sing N N 35 A1BJE C07 H071 sing N N 36 A1BJE N11 H1 sing N N 37 A1BJE N17 H172 sing N N 38 A1BJE N17 H171 sing N N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 CYS N CA sing N N 109 CYS N H sing N N 110 CYS N H2 sing N N 111 CYS CA C sing N N 112 CYS CA CB sing N N 113 CYS CA HA sing N N 114 CYS C O doub N N 115 CYS C OXT sing N N 116 CYS CB SG sing N N 117 CYS CB HB2 sing N N 118 CYS CB HB3 sing N N 119 CYS SG HG sing N N 120 CYS OXT HXT sing N N 121 GLN N CA sing N N 122 GLN N H sing N N 123 GLN N H2 sing N N 124 GLN CA C sing N N 125 GLN CA CB sing N N 126 GLN CA HA sing N N 127 GLN C O doub N N 128 GLN C OXT sing N N 129 GLN CB CG sing N N 130 GLN CB HB2 sing N N 131 GLN CB HB3 sing N N 132 GLN CG CD sing N N 133 GLN CG HG2 sing N N 134 GLN CG HG3 sing N N 135 GLN CD OE1 doub N N 136 GLN CD NE2 sing N N 137 GLN NE2 HE21 sing N N 138 GLN NE2 HE22 sing N N 139 GLN OXT HXT sing N N 140 GLU N CA sing N N 141 GLU N H sing N N 142 GLU N H2 sing N N 143 GLU CA C sing N N 144 GLU CA CB sing N N 145 GLU CA HA sing N N 146 GLU C O doub N N 147 GLU C OXT sing N N 148 GLU CB CG sing N N 149 GLU CB HB2 sing N N 150 GLU CB HB3 sing N N 151 GLU CG CD sing N N 152 GLU CG HG2 sing N N 153 GLU CG HG3 sing N N 154 GLU CD OE1 doub N N 155 GLU CD OE2 sing N N 156 GLU OE2 HE2 sing N N 157 GLU OXT HXT sing N N 158 GLY N CA sing N N 159 GLY N H sing N N 160 GLY N H2 sing N N 161 GLY CA C sing N N 162 GLY CA HA2 sing N N 163 GLY CA HA3 sing N N 164 GLY C O doub N N 165 GLY C OXT sing N N 166 GLY OXT HXT sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9EJS _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 61' _space_group.name_Hall 'P 61' _space_group.IT_number 169 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9ME3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009291 _atom_sites.fract_transf_matrix[1][2] 0.005364 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010728 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022087 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.99627 ? ? ? 14.84254 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #