data_9N28 # _entry.id 9N28 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9N28 pdb_00009n28 10.2210/pdb9n28/pdb WWPDB D_1000292238 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9N28 _pdbx_database_status.recvd_initial_deposition_date 2025-01-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Same protein complexed with different ligand' 9N06 unspecified PDB 'Same protein complexed with different ligand' 9N03 unspecified PDB 'Same protein complexed with different ligand' 9N0A unspecified PDB 'Same protein complexed with different ligand' 9N0C unspecified PDB 'Same protein complexed with different ligand' 9N24 unspecified PDB 'Same protein complexed with different ligand' 9N25 unspecified PDB 'Same protein complexed with different ligand' 9N27 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email john.bruning@adelaide.edu.au _pdbx_contact_author.name_first John _pdbx_contact_author.name_last Bruning _pdbx_contact_author.name_mi B _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6919-1824 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pederick, J.L.' 1 0000-0003-4048-9771 'Bruning, J.B.' 2 0000-0002-6919-1824 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Melanotaenia fluviatilis estrogen receptor alpha ligand binding domain complexed with estradiol and D22 13mer' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pederick, J.L.' 1 0000-0003-4048-9771 primary 'McDougal, D.P.' 2 0000-0003-4499-6789 primary 'Shearwin-Whyatt, L.' 3 0000-0002-4504-6534 primary 'Woolman, J.C.' 4 ? primary 'Grutzner, F.' 5 0000-0002-3088-7314 primary 'Bruning, J.B.' 6 0000-0002-6919-1824 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Estrogen receptor' 28714.871 1 ? ? ? ? 2 polymer syn 'D22 13mer' 1410.745 1 ? ? ? ? 3 non-polymer syn ESTRADIOL 272.382 1 ? ? ? ? 4 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MHHHHHHMPPEQVLILLQGAEPPILCSRQKLSRPYTEVTMMTLLTSMADKELVHMIAWAKKLPGFLQLSLHDQVLLLESS WLEVLMIGLIWRSIHCPGKLIFAQDLILDRNEGDCVEGMTEIFDMLLATASRFRLLKLKPEEFLCLKAIILLNSGAFSFC TGTMEPLHDSTAVQNMLDTITDALIHHISQSGYSAQQQARRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLE MLDAHHLHQPV ; ;MHHHHHHMPPEQVLILLQGAEPPILCSRQKLSRPYTEVTMMTLLTSMADKELVHMIAWAKKLPGFLQLSLHDQVLLLESS WLEVLMIGLIWRSIHCPGKLIFAQDLILDRNEGDCVEGMTEIFDMLLATASRFRLLKLKPEEFLCLKAIILLNSGAFSFC TGTMEPLHDSTAVQNMLDTITDALIHHISQSGYSAQQQARRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLE MLDAHHLHQPV ; A ? 2 'polypeptide(L)' no no EGSLLLKLLRAPV EGSLLLKLLRAPV B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ESTRADIOL EST 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 PRO n 1 10 PRO n 1 11 GLU n 1 12 GLN n 1 13 VAL n 1 14 LEU n 1 15 ILE n 1 16 LEU n 1 17 LEU n 1 18 GLN n 1 19 GLY n 1 20 ALA n 1 21 GLU n 1 22 PRO n 1 23 PRO n 1 24 ILE n 1 25 LEU n 1 26 CYS n 1 27 SER n 1 28 ARG n 1 29 GLN n 1 30 LYS n 1 31 LEU n 1 32 SER n 1 33 ARG n 1 34 PRO n 1 35 TYR n 1 36 THR n 1 37 GLU n 1 38 VAL n 1 39 THR n 1 40 MET n 1 41 MET n 1 42 THR n 1 43 LEU n 1 44 LEU n 1 45 THR n 1 46 SER n 1 47 MET n 1 48 ALA n 1 49 ASP n 1 50 LYS n 1 51 GLU n 1 52 LEU n 1 53 VAL n 1 54 HIS n 1 55 MET n 1 56 ILE n 1 57 ALA n 1 58 TRP n 1 59 ALA n 1 60 LYS n 1 61 LYS n 1 62 LEU n 1 63 PRO n 1 64 GLY n 1 65 PHE n 1 66 LEU n 1 67 GLN n 1 68 LEU n 1 69 SER n 1 70 LEU n 1 71 HIS n 1 72 ASP n 1 73 GLN n 1 74 VAL n 1 75 LEU n 1 76 LEU n 1 77 LEU n 1 78 GLU n 1 79 SER n 1 80 SER n 1 81 TRP n 1 82 LEU n 1 83 GLU n 1 84 VAL n 1 85 LEU n 1 86 MET n 1 87 ILE n 1 88 GLY n 1 89 LEU n 1 90 ILE n 1 91 TRP n 1 92 ARG n 1 93 SER n 1 94 ILE n 1 95 HIS n 1 96 CYS n 1 97 PRO n 1 98 GLY n 1 99 LYS n 1 100 LEU n 1 101 ILE n 1 102 PHE n 1 103 ALA n 1 104 GLN n 1 105 ASP n 1 106 LEU n 1 107 ILE n 1 108 LEU n 1 109 ASP n 1 110 ARG n 1 111 ASN n 1 112 GLU n 1 113 GLY n 1 114 ASP n 1 115 CYS n 1 116 VAL n 1 117 GLU n 1 118 GLY n 1 119 MET n 1 120 THR n 1 121 GLU n 1 122 ILE n 1 123 PHE n 1 124 ASP n 1 125 MET n 1 126 LEU n 1 127 LEU n 1 128 ALA n 1 129 THR n 1 130 ALA n 1 131 SER n 1 132 ARG n 1 133 PHE n 1 134 ARG n 1 135 LEU n 1 136 LEU n 1 137 LYS n 1 138 LEU n 1 139 LYS n 1 140 PRO n 1 141 GLU n 1 142 GLU n 1 143 PHE n 1 144 LEU n 1 145 CYS n 1 146 LEU n 1 147 LYS n 1 148 ALA n 1 149 ILE n 1 150 ILE n 1 151 LEU n 1 152 LEU n 1 153 ASN n 1 154 SER n 1 155 GLY n 1 156 ALA n 1 157 PHE n 1 158 SER n 1 159 PHE n 1 160 CYS n 1 161 THR n 1 162 GLY n 1 163 THR n 1 164 MET n 1 165 GLU n 1 166 PRO n 1 167 LEU n 1 168 HIS n 1 169 ASP n 1 170 SER n 1 171 THR n 1 172 ALA n 1 173 VAL n 1 174 GLN n 1 175 ASN n 1 176 MET n 1 177 LEU n 1 178 ASP n 1 179 THR n 1 180 ILE n 1 181 THR n 1 182 ASP n 1 183 ALA n 1 184 LEU n 1 185 ILE n 1 186 HIS n 1 187 HIS n 1 188 ILE n 1 189 SER n 1 190 GLN n 1 191 SER n 1 192 GLY n 1 193 TYR n 1 194 SER n 1 195 ALA n 1 196 GLN n 1 197 GLN n 1 198 GLN n 1 199 ALA n 1 200 ARG n 1 201 ARG n 1 202 GLN n 1 203 ALA n 1 204 GLN n 1 205 LEU n 1 206 LEU n 1 207 LEU n 1 208 LEU n 1 209 LEU n 1 210 SER n 1 211 HIS n 1 212 ILE n 1 213 ARG n 1 214 HIS n 1 215 MET n 1 216 SER n 1 217 ASN n 1 218 LYS n 1 219 GLY n 1 220 MET n 1 221 GLU n 1 222 HIS n 1 223 LEU n 1 224 TYR n 1 225 SER n 1 226 MET n 1 227 LYS n 1 228 CYS n 1 229 LYS n 1 230 ASN n 1 231 LYS n 1 232 VAL n 1 233 PRO n 1 234 LEU n 1 235 TYR n 1 236 ASP n 1 237 LEU n 1 238 LEU n 1 239 LEU n 1 240 GLU n 1 241 MET n 1 242 LEU n 1 243 ASP n 1 244 ALA n 1 245 HIS n 1 246 HIS n 1 247 LEU n 1 248 HIS n 1 249 GLN n 1 250 PRO n 1 251 VAL n 2 1 GLU n 2 2 GLY n 2 3 SER n 2 4 LEU n 2 5 LEU n 2 6 LEU n 2 7 LYS n 2 8 LEU n 2 9 LEU n 2 10 ARG n 2 11 ALA n 2 12 PRO n 2 13 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 251 _entity_src_gen.gene_src_common_name 'Murray River rainbowfish' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ESR1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Melanotaenia fluviatilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 120844 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EST non-polymer . ESTRADIOL ? 'C18 H24 O2' 272.382 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 303 ? ? ? A . n A 1 2 HIS 2 304 ? ? ? A . n A 1 3 HIS 3 305 ? ? ? A . n A 1 4 HIS 4 306 ? ? ? A . n A 1 5 HIS 5 307 ? ? ? A . n A 1 6 HIS 6 308 ? ? ? A . n A 1 7 HIS 7 309 ? ? ? A . n A 1 8 MET 8 310 310 MET MET A . n A 1 9 PRO 9 311 311 PRO PRO A . n A 1 10 PRO 10 312 312 PRO PRO A . n A 1 11 GLU 11 313 313 GLU GLU A . n A 1 12 GLN 12 314 314 GLN GLN A . n A 1 13 VAL 13 315 315 VAL VAL A . n A 1 14 LEU 14 316 316 LEU LEU A . n A 1 15 ILE 15 317 317 ILE ILE A . n A 1 16 LEU 16 318 318 LEU LEU A . n A 1 17 LEU 17 319 319 LEU LEU A . n A 1 18 GLN 18 320 320 GLN GLN A . n A 1 19 GLY 19 321 321 GLY GLY A . n A 1 20 ALA 20 322 322 ALA ALA A . n A 1 21 GLU 21 323 323 GLU GLU A . n A 1 22 PRO 22 324 324 PRO PRO A . n A 1 23 PRO 23 325 325 PRO PRO A . n A 1 24 ILE 24 326 326 ILE ILE A . n A 1 25 LEU 25 327 327 LEU LEU A . n A 1 26 CYS 26 328 328 CYS CYS A . n A 1 27 SER 27 329 ? ? ? A . n A 1 28 ARG 28 330 ? ? ? A . n A 1 29 GLN 29 331 ? ? ? A . n A 1 30 LYS 30 332 ? ? ? A . n A 1 31 LEU 31 333 ? ? ? A . n A 1 32 SER 32 334 ? ? ? A . n A 1 33 ARG 33 335 ? ? ? A . n A 1 34 PRO 34 336 ? ? ? A . n A 1 35 TYR 35 337 337 TYR TYR A . n A 1 36 THR 36 338 338 THR THR A . n A 1 37 GLU 37 339 339 GLU GLU A . n A 1 38 VAL 38 340 340 VAL VAL A . n A 1 39 THR 39 341 341 THR THR A . n A 1 40 MET 40 342 342 MET MET A . n A 1 41 MET 41 343 343 MET MET A . n A 1 42 THR 42 344 344 THR THR A . n A 1 43 LEU 43 345 345 LEU LEU A . n A 1 44 LEU 44 346 346 LEU LEU A . n A 1 45 THR 45 347 347 THR THR A . n A 1 46 SER 46 348 348 SER SER A . n A 1 47 MET 47 349 349 MET MET A . n A 1 48 ALA 48 350 350 ALA ALA A . n A 1 49 ASP 49 351 351 ASP ASP A . n A 1 50 LYS 50 352 352 LYS LYS A . n A 1 51 GLU 51 353 353 GLU GLU A . n A 1 52 LEU 52 354 354 LEU LEU A . n A 1 53 VAL 53 355 355 VAL VAL A . n A 1 54 HIS 54 356 356 HIS HIS A . n A 1 55 MET 55 357 357 MET MET A . n A 1 56 ILE 56 358 358 ILE ILE A . n A 1 57 ALA 57 359 359 ALA ALA A . n A 1 58 TRP 58 360 360 TRP TRP A . n A 1 59 ALA 59 361 361 ALA ALA A . n A 1 60 LYS 60 362 362 LYS LYS A . n A 1 61 LYS 61 363 363 LYS LYS A . n A 1 62 LEU 62 364 364 LEU LEU A . n A 1 63 PRO 63 365 365 PRO PRO A . n A 1 64 GLY 64 366 366 GLY GLY A . n A 1 65 PHE 65 367 367 PHE PHE A . n A 1 66 LEU 66 368 368 LEU LEU A . n A 1 67 GLN 67 369 369 GLN GLN A . n A 1 68 LEU 68 370 370 LEU LEU A . n A 1 69 SER 69 371 371 SER SER A . n A 1 70 LEU 70 372 372 LEU LEU A . n A 1 71 HIS 71 373 373 HIS HIS A . n A 1 72 ASP 72 374 374 ASP ASP A . n A 1 73 GLN 73 375 375 GLN GLN A . n A 1 74 VAL 74 376 376 VAL VAL A . n A 1 75 LEU 75 377 377 LEU LEU A . n A 1 76 LEU 76 378 378 LEU LEU A . n A 1 77 LEU 77 379 379 LEU LEU A . n A 1 78 GLU 78 380 380 GLU GLU A . n A 1 79 SER 79 381 381 SER SER A . n A 1 80 SER 80 382 382 SER SER A . n A 1 81 TRP 81 383 383 TRP TRP A . n A 1 82 LEU 82 384 384 LEU LEU A . n A 1 83 GLU 83 385 385 GLU GLU A . n A 1 84 VAL 84 386 386 VAL VAL A . n A 1 85 LEU 85 387 387 LEU LEU A . n A 1 86 MET 86 388 388 MET MET A . n A 1 87 ILE 87 389 389 ILE ILE A . n A 1 88 GLY 88 390 390 GLY GLY A . n A 1 89 LEU 89 391 391 LEU LEU A . n A 1 90 ILE 90 392 392 ILE ILE A . n A 1 91 TRP 91 393 393 TRP TRP A . n A 1 92 ARG 92 394 394 ARG ARG A . n A 1 93 SER 93 395 395 SER SER A . n A 1 94 ILE 94 396 396 ILE ILE A . n A 1 95 HIS 95 397 397 HIS HIS A . n A 1 96 CYS 96 398 398 CYS CYS A . n A 1 97 PRO 97 399 399 PRO PRO A . n A 1 98 GLY 98 400 400 GLY GLY A . n A 1 99 LYS 99 401 401 LYS LYS A . n A 1 100 LEU 100 402 402 LEU LEU A . n A 1 101 ILE 101 403 403 ILE ILE A . n A 1 102 PHE 102 404 404 PHE PHE A . n A 1 103 ALA 103 405 405 ALA ALA A . n A 1 104 GLN 104 406 406 GLN GLN A . n A 1 105 ASP 105 407 407 ASP ASP A . n A 1 106 LEU 106 408 408 LEU LEU A . n A 1 107 ILE 107 409 409 ILE ILE A . n A 1 108 LEU 108 410 410 LEU LEU A . n A 1 109 ASP 109 411 411 ASP ASP A . n A 1 110 ARG 110 412 412 ARG ARG A . n A 1 111 ASN 111 413 413 ASN ASN A . n A 1 112 GLU 112 414 414 GLU GLU A . n A 1 113 GLY 113 415 415 GLY GLY A . n A 1 114 ASP 114 416 416 ASP ASP A . n A 1 115 CYS 115 417 417 CYS CYS A . n A 1 116 VAL 116 418 418 VAL VAL A . n A 1 117 GLU 117 419 419 GLU GLU A . n A 1 118 GLY 118 420 420 GLY GLY A . n A 1 119 MET 119 421 421 MET MET A . n A 1 120 THR 120 422 422 THR THR A . n A 1 121 GLU 121 423 423 GLU GLU A . n A 1 122 ILE 122 424 424 ILE ILE A . n A 1 123 PHE 123 425 425 PHE PHE A . n A 1 124 ASP 124 426 426 ASP ASP A . n A 1 125 MET 125 427 427 MET MET A . n A 1 126 LEU 126 428 428 LEU LEU A . n A 1 127 LEU 127 429 429 LEU LEU A . n A 1 128 ALA 128 430 430 ALA ALA A . n A 1 129 THR 129 431 431 THR THR A . n A 1 130 ALA 130 432 432 ALA ALA A . n A 1 131 SER 131 433 433 SER SER A . n A 1 132 ARG 132 434 434 ARG ARG A . n A 1 133 PHE 133 435 435 PHE PHE A . n A 1 134 ARG 134 436 436 ARG ARG A . n A 1 135 LEU 135 437 437 LEU LEU A . n A 1 136 LEU 136 438 438 LEU LEU A . n A 1 137 LYS 137 439 439 LYS LYS A . n A 1 138 LEU 138 440 440 LEU LEU A . n A 1 139 LYS 139 441 441 LYS LYS A . n A 1 140 PRO 140 442 442 PRO PRO A . n A 1 141 GLU 141 443 443 GLU GLU A . n A 1 142 GLU 142 444 444 GLU GLU A . n A 1 143 PHE 143 445 445 PHE PHE A . n A 1 144 LEU 144 446 446 LEU LEU A . n A 1 145 CYS 145 447 447 CYS CYS A . n A 1 146 LEU 146 448 448 LEU LEU A . n A 1 147 LYS 147 449 449 LYS LYS A . n A 1 148 ALA 148 450 450 ALA ALA A . n A 1 149 ILE 149 451 451 ILE ILE A . n A 1 150 ILE 150 452 452 ILE ILE A . n A 1 151 LEU 151 453 453 LEU LEU A . n A 1 152 LEU 152 454 454 LEU LEU A . n A 1 153 ASN 153 455 455 ASN ASN A . n A 1 154 SER 154 456 ? ? ? A . n A 1 155 GLY 155 457 ? ? ? A . n A 1 156 ALA 156 458 ? ? ? A . n A 1 157 PHE 157 459 ? ? ? A . n A 1 158 SER 158 460 ? ? ? A . n A 1 159 PHE 159 461 ? ? ? A . n A 1 160 CYS 160 462 ? ? ? A . n A 1 161 THR 161 463 ? ? ? A . n A 1 162 GLY 162 464 ? ? ? A . n A 1 163 THR 163 465 ? ? ? A . n A 1 164 MET 164 466 ? ? ? A . n A 1 165 GLU 165 467 ? ? ? A . n A 1 166 PRO 166 468 468 PRO PRO A . n A 1 167 LEU 167 469 469 LEU LEU A . n A 1 168 HIS 168 470 470 HIS HIS A . n A 1 169 ASP 169 471 471 ASP ASP A . n A 1 170 SER 170 472 472 SER SER A . n A 1 171 THR 171 473 473 THR THR A . n A 1 172 ALA 172 474 474 ALA ALA A . n A 1 173 VAL 173 475 475 VAL VAL A . n A 1 174 GLN 174 476 476 GLN GLN A . n A 1 175 ASN 175 477 477 ASN ASN A . n A 1 176 MET 176 478 478 MET MET A . n A 1 177 LEU 177 479 479 LEU LEU A . n A 1 178 ASP 178 480 480 ASP ASP A . n A 1 179 THR 179 481 481 THR THR A . n A 1 180 ILE 180 482 482 ILE ILE A . n A 1 181 THR 181 483 483 THR THR A . n A 1 182 ASP 182 484 484 ASP ASP A . n A 1 183 ALA 183 485 485 ALA ALA A . n A 1 184 LEU 184 486 486 LEU LEU A . n A 1 185 ILE 185 487 487 ILE ILE A . n A 1 186 HIS 186 488 488 HIS HIS A . n A 1 187 HIS 187 489 489 HIS HIS A . n A 1 188 ILE 188 490 490 ILE ILE A . n A 1 189 SER 189 491 491 SER SER A . n A 1 190 GLN 190 492 492 GLN GLN A . n A 1 191 SER 191 493 493 SER SER A . n A 1 192 GLY 192 494 494 GLY GLY A . n A 1 193 TYR 193 495 495 TYR TYR A . n A 1 194 SER 194 496 496 SER SER A . n A 1 195 ALA 195 497 497 ALA ALA A . n A 1 196 GLN 196 498 498 GLN GLN A . n A 1 197 GLN 197 499 499 GLN GLN A . n A 1 198 GLN 198 500 500 GLN GLN A . n A 1 199 ALA 199 501 501 ALA ALA A . n A 1 200 ARG 200 502 502 ARG ARG A . n A 1 201 ARG 201 503 503 ARG ARG A . n A 1 202 GLN 202 504 504 GLN GLN A . n A 1 203 ALA 203 505 505 ALA ALA A . n A 1 204 GLN 204 506 506 GLN GLN A . n A 1 205 LEU 205 507 507 LEU LEU A . n A 1 206 LEU 206 508 508 LEU LEU A . n A 1 207 LEU 207 509 509 LEU LEU A . n A 1 208 LEU 208 510 510 LEU LEU A . n A 1 209 LEU 209 511 511 LEU LEU A . n A 1 210 SER 210 512 512 SER SER A . n A 1 211 HIS 211 513 513 HIS HIS A . n A 1 212 ILE 212 514 514 ILE ILE A . n A 1 213 ARG 213 515 515 ARG ARG A . n A 1 214 HIS 214 516 516 HIS HIS A . n A 1 215 MET 215 517 517 MET MET A . n A 1 216 SER 216 518 518 SER SER A . n A 1 217 ASN 217 519 519 ASN ASN A . n A 1 218 LYS 218 520 520 LYS LYS A . n A 1 219 GLY 219 521 521 GLY GLY A . n A 1 220 MET 220 522 522 MET MET A . n A 1 221 GLU 221 523 523 GLU GLU A . n A 1 222 HIS 222 524 524 HIS HIS A . n A 1 223 LEU 223 525 525 LEU LEU A . n A 1 224 TYR 224 526 526 TYR TYR A . n A 1 225 SER 225 527 527 SER SER A . n A 1 226 MET 226 528 528 MET MET A . n A 1 227 LYS 227 529 529 LYS LYS A . n A 1 228 CYS 228 530 530 CYS CYS A . n A 1 229 LYS 229 531 531 LYS LYS A . n A 1 230 ASN 230 532 532 ASN ASN A . n A 1 231 LYS 231 533 533 LYS LYS A . n A 1 232 VAL 232 534 534 VAL VAL A . n A 1 233 PRO 233 535 535 PRO PRO A . n A 1 234 LEU 234 536 536 LEU LEU A . n A 1 235 TYR 235 537 537 TYR TYR A . n A 1 236 ASP 236 538 538 ASP ASP A . n A 1 237 LEU 237 539 539 LEU LEU A . n A 1 238 LEU 238 540 540 LEU LEU A . n A 1 239 LEU 239 541 541 LEU LEU A . n A 1 240 GLU 240 542 542 GLU GLU A . n A 1 241 MET 241 543 543 MET MET A . n A 1 242 LEU 242 544 544 LEU LEU A . n A 1 243 ASP 243 545 545 ASP ASP A . n A 1 244 ALA 244 546 546 ALA ALA A . n A 1 245 HIS 245 547 547 HIS HIS A . n A 1 246 HIS 246 548 548 HIS HIS A . n A 1 247 LEU 247 549 ? ? ? A . n A 1 248 HIS 248 550 ? ? ? A . n A 1 249 GLN 249 551 ? ? ? A . n A 1 250 PRO 250 552 ? ? ? A . n A 1 251 VAL 251 553 ? ? ? A . n B 2 1 GLU 1 -2 ? ? ? B . n B 2 2 GLY 2 -1 -1 GLY GLY B . n B 2 3 SER 3 0 0 SER SER B . n B 2 4 LEU 4 1 1 LEU LEU B . n B 2 5 LEU 5 2 2 LEU LEU B . n B 2 6 LEU 6 3 3 LEU LEU B . n B 2 7 LYS 7 4 4 LYS LYS B . n B 2 8 LEU 8 5 5 LEU LEU B . n B 2 9 LEU 9 6 6 LEU LEU B . n B 2 10 ARG 10 7 7 ARG ARG B . n B 2 11 ALA 11 8 8 ALA ALA B . n B 2 12 PRO 12 9 9 PRO PRO B . n B 2 13 VAL 13 10 ? ? ? B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id EST _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id EST _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 EST 1 601 601 EST EST A . D 4 HOH 1 701 14 HOH HOH A . D 4 HOH 2 702 8 HOH HOH A . D 4 HOH 3 703 12 HOH HOH A . D 4 HOH 4 704 5 HOH HOH A . D 4 HOH 5 705 21 HOH HOH A . D 4 HOH 6 706 10 HOH HOH A . D 4 HOH 7 707 20 HOH HOH A . D 4 HOH 8 708 3 HOH HOH A . D 4 HOH 9 709 23 HOH HOH A . D 4 HOH 10 710 16 HOH HOH A . D 4 HOH 11 711 18 HOH HOH A . D 4 HOH 12 712 1 HOH HOH A . D 4 HOH 13 713 11 HOH HOH A . D 4 HOH 14 714 6 HOH HOH A . D 4 HOH 15 715 15 HOH HOH A . D 4 HOH 16 716 9 HOH HOH A . D 4 HOH 17 717 22 HOH HOH A . D 4 HOH 18 718 19 HOH HOH A . D 4 HOH 19 719 17 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 326 ? CG1 ? A ILE 24 CG1 2 1 Y 1 A ILE 326 ? CG2 ? A ILE 24 CG2 3 1 Y 1 A ILE 326 ? CD1 ? A ILE 24 CD1 4 1 Y 1 A LEU 327 ? CG ? A LEU 25 CG 5 1 Y 1 A LEU 327 ? CD1 ? A LEU 25 CD1 6 1 Y 1 A LEU 327 ? CD2 ? A LEU 25 CD2 7 1 Y 1 A CYS 328 ? SG ? A CYS 26 SG 8 1 Y 1 A GLU 339 ? CG ? A GLU 37 CG 9 1 Y 1 A GLU 339 ? CD ? A GLU 37 CD 10 1 Y 1 A GLU 339 ? OE1 ? A GLU 37 OE1 11 1 Y 1 A GLU 339 ? OE2 ? A GLU 37 OE2 12 1 Y 1 A VAL 340 ? CG1 ? A VAL 38 CG1 13 1 Y 1 A VAL 340 ? CG2 ? A VAL 38 CG2 14 1 Y 1 A LEU 345 ? CG ? A LEU 43 CG 15 1 Y 1 A LEU 345 ? CD1 ? A LEU 43 CD1 16 1 Y 1 A LEU 345 ? CD2 ? A LEU 43 CD2 17 1 Y 1 A MET 349 ? CG ? A MET 47 CG 18 1 Y 1 A MET 349 ? SD ? A MET 47 SD 19 1 Y 1 A MET 349 ? CE ? A MET 47 CE 20 1 Y 1 A LYS 401 ? CG ? A LYS 99 CG 21 1 Y 1 A LYS 401 ? CD ? A LYS 99 CD 22 1 Y 1 A LYS 401 ? CE ? A LYS 99 CE 23 1 Y 1 A LYS 401 ? NZ ? A LYS 99 NZ 24 1 Y 1 A GLN 406 ? CG ? A GLN 104 CG 25 1 Y 1 A GLN 406 ? CD ? A GLN 104 CD 26 1 Y 1 A GLN 406 ? OE1 ? A GLN 104 OE1 27 1 Y 1 A GLN 406 ? NE2 ? A GLN 104 NE2 28 1 Y 1 A LEU 408 ? CG ? A LEU 106 CG 29 1 Y 1 A LEU 408 ? CD1 ? A LEU 106 CD1 30 1 Y 1 A LEU 408 ? CD2 ? A LEU 106 CD2 31 1 Y 1 A ASN 413 ? CG ? A ASN 111 CG 32 1 Y 1 A ASN 413 ? OD1 ? A ASN 111 OD1 33 1 Y 1 A ASN 413 ? ND2 ? A ASN 111 ND2 34 1 Y 1 A VAL 418 ? CG1 ? A VAL 116 CG1 35 1 Y 1 A VAL 418 ? CG2 ? A VAL 116 CG2 36 1 Y 1 A GLU 419 ? CG ? A GLU 117 CG 37 1 Y 1 A GLU 419 ? CD ? A GLU 117 CD 38 1 Y 1 A GLU 419 ? OE1 ? A GLU 117 OE1 39 1 Y 1 A GLU 419 ? OE2 ? A GLU 117 OE2 40 1 Y 1 A LYS 439 ? CG ? A LYS 137 CG 41 1 Y 1 A LYS 439 ? CD ? A LYS 137 CD 42 1 Y 1 A LYS 439 ? CE ? A LYS 137 CE 43 1 Y 1 A LYS 439 ? NZ ? A LYS 137 NZ 44 1 Y 1 A ILE 490 ? CG1 ? A ILE 188 CG1 45 1 Y 1 A ILE 490 ? CG2 ? A ILE 188 CG2 46 1 Y 1 A ILE 490 ? CD1 ? A ILE 188 CD1 47 1 Y 1 A GLN 492 ? CG ? A GLN 190 CG 48 1 Y 1 A GLN 492 ? CD ? A GLN 190 CD 49 1 Y 1 A GLN 492 ? OE1 ? A GLN 190 OE1 50 1 Y 1 A GLN 492 ? NE2 ? A GLN 190 NE2 51 1 Y 1 A LYS 533 ? CG ? A LYS 231 CG 52 1 Y 1 A LYS 533 ? CD ? A LYS 231 CD 53 1 Y 1 A LYS 533 ? CE ? A LYS 231 CE 54 1 Y 1 A LYS 533 ? NZ ? A LYS 231 NZ 55 1 Y 1 A ASP 545 ? CG ? A ASP 243 CG 56 1 Y 1 A ASP 545 ? OD1 ? A ASP 243 OD1 57 1 Y 1 A ASP 545 ? OD2 ? A ASP 243 OD2 58 1 Y 1 B LYS 4 ? CG ? B LYS 7 CG 59 1 Y 1 B LYS 4 ? CD ? B LYS 7 CD 60 1 Y 1 B LYS 4 ? CE ? B LYS 7 CE 61 1 Y 1 B LYS 4 ? NZ ? B LYS 7 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9N28 _cell.details ? _cell.formula_units_Z ? _cell.length_a 167.863 _cell.length_a_esd ? _cell.length_b 167.863 _cell.length_b_esd ? _cell.length_c 167.863 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9N28 _symmetry.cell_setting ? _symmetry.Int_Tables_number 214 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9N28 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.01M iron (III) chloride hexahydrate, 0.1M sodium citrate tribasic dihydrate pH 5.6, 10% Jeffamine M-600' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9N28 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 39.57 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23819 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 80.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 51.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.01 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all 0.009 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 1927545 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.080 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 159408 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1914 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 83.3 _reflns_shell.pdbx_chi_squared 1.02 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.9 _reflns_shell.pdbx_Rrim_I_all 4.049 _reflns_shell.pdbx_Rpim_I_all 0.442 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.704 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.024 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9N28 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 39.57 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23797 _refine.ls_number_reflns_R_free 1251 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 5.26 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2501 _refine.ls_R_factor_R_free 0.2677 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2490 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.76 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.28 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 39.57 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1804 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1765 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1820 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.993 ? 2470 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 4.912 ? 242 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.050 ? 299 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 302 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.10 2.18 . . 112 2482 100.00 . . . . 0.3172 . . . . . . . . . . . 0.3717 'X-RAY DIFFRACTION' 2.18 2.28 . . 136 2446 100.00 . . . . 0.2777 . . . . . . . . . . . 0.3412 'X-RAY DIFFRACTION' 2.28 2.40 . . 140 2464 100.00 . . . . 0.2665 . . . . . . . . . . . 0.2878 'X-RAY DIFFRACTION' 2.40 2.55 . . 130 2495 100.00 . . . . 0.2962 . . . . . . . . . . . 0.3338 'X-RAY DIFFRACTION' 2.56 2.75 . . 150 2459 100.00 . . . . 0.2848 . . . . . . . . . . . 0.2921 'X-RAY DIFFRACTION' 2.75 3.03 . . 142 2493 100.00 . . . . 0.2761 . . . . . . . . . . . 0.3068 'X-RAY DIFFRACTION' 3.03 3.47 . . 154 2480 100.00 . . . . 0.2875 . . . . . . . . . . . 0.2949 'X-RAY DIFFRACTION' 3.47 4.37 . . 148 2539 100.00 . . . . 0.2187 . . . . . . . . . . . 0.2552 'X-RAY DIFFRACTION' 4.37 39.57 . . 139 2688 100.00 . . . . 0.2307 . . . . . . . . . . . 0.2324 # _struct.entry_id 9N28 _struct.title 'Crystal structure of Melanotaenia fluviatilis estrogen receptor alpha ligand binding domain complexed with estradiol and D22 13mer' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9N28 _struct_keywords.text 'ligand binding domain, transcription factor, endocrine disrupting compound, NUCLEAR PROTEIN' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP D6N7U3_MELFL D6N7U3 ? 1 ;MPPEQVLILLQGAEPPILCSRQKLSRPYTEVTMMTLLTSMADKELVHMIAWAKKLPGFLQLSLHDQVLLLESSWLEVLMI GLIWRSIHCPGKLIFAQDLILDRNEGDCVEGMTEIFDMLLATASRFRLLKLKPEEFLCLKAIILLNSGAFSFCTGTMEPL HDSTAVQNMLDTITDALIHHISQSGYSAQQQARRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHHL HQPV ; 310 2 PDB 9N28 9N28 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9N28 A 8 ? 251 ? D6N7U3 310 ? 553 ? 310 553 2 2 9N28 B 1 ? 13 ? 9N28 -2 ? 10 ? -2 10 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9N28 MET A 1 ? UNP D6N7U3 ? ? 'expression tag' 303 1 1 9N28 HIS A 2 ? UNP D6N7U3 ? ? 'expression tag' 304 2 1 9N28 HIS A 3 ? UNP D6N7U3 ? ? 'expression tag' 305 3 1 9N28 HIS A 4 ? UNP D6N7U3 ? ? 'expression tag' 306 4 1 9N28 HIS A 5 ? UNP D6N7U3 ? ? 'expression tag' 307 5 1 9N28 HIS A 6 ? UNP D6N7U3 ? ? 'expression tag' 308 6 1 9N28 HIS A 7 ? UNP D6N7U3 ? ? 'expression tag' 309 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1550 ? 1 MORE -8 ? 1 'SSA (A^2)' 10970 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 9 ? ALA A 20 ? PRO A 311 ALA A 322 1 ? 12 HELX_P HELX_P2 AA2 THR A 36 ? LYS A 60 ? THR A 338 LYS A 362 1 ? 25 HELX_P HELX_P3 AA3 SER A 69 ? SER A 93 ? SER A 371 SER A 395 1 ? 25 HELX_P HELX_P4 AA4 ASN A 111 ? VAL A 116 ? ASN A 413 VAL A 418 5 ? 6 HELX_P HELX_P5 AA5 GLY A 118 ? LYS A 137 ? GLY A 420 LYS A 439 1 ? 20 HELX_P HELX_P6 AA6 LYS A 139 ? ASN A 153 ? LYS A 441 ASN A 455 1 ? 15 HELX_P HELX_P7 AA7 ASP A 169 ? SER A 189 ? ASP A 471 SER A 491 1 ? 21 HELX_P HELX_P8 AA8 SER A 194 ? LEU A 207 ? SER A 496 LEU A 509 1 ? 14 HELX_P HELX_P9 AA9 LEU A 207 ? MET A 226 ? LEU A 509 MET A 528 1 ? 20 HELX_P HELX_P10 AB1 TYR A 235 ? ALA A 244 ? TYR A 537 ALA A 546 1 ? 10 HELX_P HELX_P11 AB2 SER B 3 ? ALA B 11 ? SER B 0 ALA B 8 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 99 ? ALA A 103 ? LYS A 401 ALA A 405 AA1 2 LEU A 106 ? ASP A 109 ? LEU A 408 ASP A 411 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 100 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 402 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 108 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 410 # _pdbx_entry_details.entry_id 9N28 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 492 ? ? -176.03 -3.49 2 1 LYS A 529 ? ? 65.18 -51.75 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 17.178 -45.462 -8.287 0.5597 0.6519 0.9560 0.1789 -0.0564 0.3187 5.9467 4.2089 7.0133 1.1173 5.1945 -0.2241 0.9776 -0.0303 -0.8317 -0.0867 -1.9875 0.4335 1.0803 1.2230 0.2576 'X-RAY DIFFRACTION' 2 ? refined 28.136 -26.523 1.963 0.7696 0.3889 1.0579 0.2317 -0.2758 0.0669 0.9430 3.0534 3.8941 0.1290 -0.9350 1.7707 -0.2924 0.6578 -0.2807 0.0854 1.0999 0.3081 -1.4523 -1.0981 -0.7493 'X-RAY DIFFRACTION' 3 ? refined 32.774 -26.524 -3.629 0.5792 0.7307 0.7714 0.0969 -0.3330 0.0769 3.8282 6.7490 2.7628 -0.2802 1.1514 0.3958 -0.0400 -0.2849 0.1571 -0.8118 0.4043 -0.1742 0.6492 -0.2621 0.1165 'X-RAY DIFFRACTION' 4 ? refined 26.035 -29.730 -9.133 0.4683 0.6007 0.5191 0.0429 -0.2038 0.1768 3.0777 6.5991 4.0144 0.0678 -0.5460 0.3987 -0.1260 0.4087 -0.2462 -0.1631 0.2827 -0.0882 0.3440 -0.1631 0.0567 'X-RAY DIFFRACTION' 5 ? refined 24.514 -10.445 0.176 1.1223 0.8848 1.2103 0.1827 -0.2788 -0.2288 8.3778 8.4651 2.7516 -2.8675 3.1307 -4.5491 -1.2934 1.5431 -0.5717 -1.4899 1.9569 0.4567 1.9575 -1.7663 -0.9868 'X-RAY DIFFRACTION' 6 ? refined 16.546 -16.825 -7.187 0.6560 0.6580 0.9214 0.2753 -0.1137 0.1499 5.3645 5.3786 3.5519 1.6692 0.6856 -1.0910 -0.9558 1.2126 -0.2353 -0.0657 0.5374 1.0699 0.0249 -0.2784 -0.6518 'X-RAY DIFFRACTION' 7 ? refined 19.532 -34.004 -13.765 0.4454 0.5306 0.6193 0.0257 -0.1540 0.3636 3.2251 6.6419 3.4218 -0.5046 2.2917 2.8682 -0.1520 0.5451 -0.2976 -0.2851 -0.4364 0.6975 0.0583 0.3696 -0.1618 'X-RAY DIFFRACTION' 8 ? refined 13.739 -40.406 -16.993 0.7311 0.6182 0.9973 -0.0434 -0.2101 0.3703 7.7388 6.0763 2.9199 -2.7810 0.8778 1.1738 -0.3183 0.2160 -0.2937 0.0988 -2.6630 2.0147 -0.4692 0.7649 -0.6822 'X-RAY DIFFRACTION' 9 ? refined 18.945 -22.802 -15.646 0.5350 0.5758 0.6068 0.1257 -0.1658 0.2324 6.0555 7.1721 4.6502 0.4493 1.7894 -0.6016 -0.5191 0.3225 0.2190 0.2985 0.5059 0.4284 -0.0113 -0.3940 0.0066 'X-RAY DIFFRACTION' 10 ? refined 38.488 -20.740 -9.996 0.5763 0.7658 0.7781 -0.0940 -0.2794 0.0923 8.4995 4.5883 5.4850 -1.1732 0.4868 -0.6319 -0.4386 0.1432 0.3216 0.2683 0.2725 -1.0483 0.3587 -0.4763 1.0538 'X-RAY DIFFRACTION' 11 ? refined 41.620 -37.397 -10.705 0.6463 0.8335 0.9491 0.2737 -0.2877 0.0239 3.0428 4.9515 3.6708 0.3768 -0.8417 1.2414 -0.6533 0.7314 -0.3944 -0.9960 -1.3081 -1.3384 0.5480 1.2086 0.8153 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 310 A 321 '( CHAIN A AND RESID 310:321 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 322 A 338 '( CHAIN A AND RESID 322:338 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 339 A 363 '( CHAIN A AND RESID 339:363 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 364 A 407 '( CHAIN A AND RESID 364:407 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 408 A 420 '( CHAIN A AND RESID 408:420 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 421 A 437 '( CHAIN A AND RESID 421:437 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 438 A 471 '( CHAIN A AND RESID 438:471 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 472 A 496 '( CHAIN A AND RESID 472:496 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 497 A 530 '( CHAIN A AND RESID 497:530 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 A 531 A 548 '( CHAIN A AND RESID 531:548 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 B -1 B 9 '( CHAIN B AND RESID -1:9 )' ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 303 ? A MET 1 2 1 Y 1 A HIS 304 ? A HIS 2 3 1 Y 1 A HIS 305 ? A HIS 3 4 1 Y 1 A HIS 306 ? A HIS 4 5 1 Y 1 A HIS 307 ? A HIS 5 6 1 Y 1 A HIS 308 ? A HIS 6 7 1 Y 1 A HIS 309 ? A HIS 7 8 1 Y 1 A SER 329 ? A SER 27 9 1 Y 1 A ARG 330 ? A ARG 28 10 1 Y 1 A GLN 331 ? A GLN 29 11 1 Y 1 A LYS 332 ? A LYS 30 12 1 Y 1 A LEU 333 ? A LEU 31 13 1 Y 1 A SER 334 ? A SER 32 14 1 Y 1 A ARG 335 ? A ARG 33 15 1 Y 1 A PRO 336 ? A PRO 34 16 1 Y 1 A SER 456 ? A SER 154 17 1 Y 1 A GLY 457 ? A GLY 155 18 1 Y 1 A ALA 458 ? A ALA 156 19 1 Y 1 A PHE 459 ? A PHE 157 20 1 Y 1 A SER 460 ? A SER 158 21 1 Y 1 A PHE 461 ? A PHE 159 22 1 Y 1 A CYS 462 ? A CYS 160 23 1 Y 1 A THR 463 ? A THR 161 24 1 Y 1 A GLY 464 ? A GLY 162 25 1 Y 1 A THR 465 ? A THR 163 26 1 Y 1 A MET 466 ? A MET 164 27 1 Y 1 A GLU 467 ? A GLU 165 28 1 Y 1 A LEU 549 ? A LEU 247 29 1 Y 1 A HIS 550 ? A HIS 248 30 1 Y 1 A GLN 551 ? A GLN 249 31 1 Y 1 A PRO 552 ? A PRO 250 32 1 Y 1 A VAL 553 ? A VAL 251 33 1 Y 1 B GLU -2 ? B GLU 1 34 1 Y 1 B VAL 10 ? B VAL 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EST C1 C Y N 88 EST C2 C Y N 89 EST C3 C Y N 90 EST O3 O N N 91 EST C4 C Y N 92 EST C5 C Y N 93 EST C6 C N N 94 EST C7 C N N 95 EST C8 C N S 96 EST C9 C N S 97 EST C10 C Y N 98 EST C11 C N N 99 EST C12 C N N 100 EST C13 C N S 101 EST C14 C N S 102 EST C15 C N N 103 EST C16 C N N 104 EST C17 C N S 105 EST O17 O N N 106 EST C18 C N N 107 EST H1 H N N 108 EST H2 H N N 109 EST HO3 H N N 110 EST H4 H N N 111 EST H61 H N N 112 EST H62 H N N 113 EST H71 H N N 114 EST H72 H N N 115 EST H8 H N N 116 EST H9 H N N 117 EST H111 H N N 118 EST H112 H N N 119 EST H121 H N N 120 EST H122 H N N 121 EST H14 H N N 122 EST H151 H N N 123 EST H152 H N N 124 EST H161 H N N 125 EST H162 H N N 126 EST H17 H N N 127 EST HO7 H N N 128 EST H181 H N N 129 EST H182 H N N 130 EST H183 H N N 131 GLN N N N N 132 GLN CA C N S 133 GLN C C N N 134 GLN O O N N 135 GLN CB C N N 136 GLN CG C N N 137 GLN CD C N N 138 GLN OE1 O N N 139 GLN NE2 N N N 140 GLN OXT O N N 141 GLN H H N N 142 GLN H2 H N N 143 GLN HA H N N 144 GLN HB2 H N N 145 GLN HB3 H N N 146 GLN HG2 H N N 147 GLN HG3 H N N 148 GLN HE21 H N N 149 GLN HE22 H N N 150 GLN HXT H N N 151 GLU N N N N 152 GLU CA C N S 153 GLU C C N N 154 GLU O O N N 155 GLU CB C N N 156 GLU CG C N N 157 GLU CD C N N 158 GLU OE1 O N N 159 GLU OE2 O N N 160 GLU OXT O N N 161 GLU H H N N 162 GLU H2 H N N 163 GLU HA H N N 164 GLU HB2 H N N 165 GLU HB3 H N N 166 GLU HG2 H N N 167 GLU HG3 H N N 168 GLU HE2 H N N 169 GLU HXT H N N 170 GLY N N N N 171 GLY CA C N N 172 GLY C C N N 173 GLY O O N N 174 GLY OXT O N N 175 GLY H H N N 176 GLY H2 H N N 177 GLY HA2 H N N 178 GLY HA3 H N N 179 GLY HXT H N N 180 HIS N N N N 181 HIS CA C N S 182 HIS C C N N 183 HIS O O N N 184 HIS CB C N N 185 HIS CG C Y N 186 HIS ND1 N Y N 187 HIS CD2 C Y N 188 HIS CE1 C Y N 189 HIS NE2 N Y N 190 HIS OXT O N N 191 HIS H H N N 192 HIS H2 H N N 193 HIS HA H N N 194 HIS HB2 H N N 195 HIS HB3 H N N 196 HIS HD1 H N N 197 HIS HD2 H N N 198 HIS HE1 H N N 199 HIS HE2 H N N 200 HIS HXT H N N 201 HOH O O N N 202 HOH H1 H N N 203 HOH H2 H N N 204 ILE N N N N 205 ILE CA C N S 206 ILE C C N N 207 ILE O O N N 208 ILE CB C N S 209 ILE CG1 C N N 210 ILE CG2 C N N 211 ILE CD1 C N N 212 ILE OXT O N N 213 ILE H H N N 214 ILE H2 H N N 215 ILE HA H N N 216 ILE HB H N N 217 ILE HG12 H N N 218 ILE HG13 H N N 219 ILE HG21 H N N 220 ILE HG22 H N N 221 ILE HG23 H N N 222 ILE HD11 H N N 223 ILE HD12 H N N 224 ILE HD13 H N N 225 ILE HXT H N N 226 LEU N N N N 227 LEU CA C N S 228 LEU C C N N 229 LEU O O N N 230 LEU CB C N N 231 LEU CG C N N 232 LEU CD1 C N N 233 LEU CD2 C N N 234 LEU OXT O N N 235 LEU H H N N 236 LEU H2 H N N 237 LEU HA H N N 238 LEU HB2 H N N 239 LEU HB3 H N N 240 LEU HG H N N 241 LEU HD11 H N N 242 LEU HD12 H N N 243 LEU HD13 H N N 244 LEU HD21 H N N 245 LEU HD22 H N N 246 LEU HD23 H N N 247 LEU HXT H N N 248 LYS N N N N 249 LYS CA C N S 250 LYS C C N N 251 LYS O O N N 252 LYS CB C N N 253 LYS CG C N N 254 LYS CD C N N 255 LYS CE C N N 256 LYS NZ N N N 257 LYS OXT O N N 258 LYS H H N N 259 LYS H2 H N N 260 LYS HA H N N 261 LYS HB2 H N N 262 LYS HB3 H N N 263 LYS HG2 H N N 264 LYS HG3 H N N 265 LYS HD2 H N N 266 LYS HD3 H N N 267 LYS HE2 H N N 268 LYS HE3 H N N 269 LYS HZ1 H N N 270 LYS HZ2 H N N 271 LYS HZ3 H N N 272 LYS HXT H N N 273 MET N N N N 274 MET CA C N S 275 MET C C N N 276 MET O O N N 277 MET CB C N N 278 MET CG C N N 279 MET SD S N N 280 MET CE C N N 281 MET OXT O N N 282 MET H H N N 283 MET H2 H N N 284 MET HA H N N 285 MET HB2 H N N 286 MET HB3 H N N 287 MET HG2 H N N 288 MET HG3 H N N 289 MET HE1 H N N 290 MET HE2 H N N 291 MET HE3 H N N 292 MET HXT H N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EST C1 C2 doub Y N 83 EST C1 C10 sing Y N 84 EST C1 H1 sing N N 85 EST C2 C3 sing Y N 86 EST C2 H2 sing N N 87 EST C3 O3 sing N N 88 EST C3 C4 doub Y N 89 EST O3 HO3 sing N N 90 EST C4 C5 sing Y N 91 EST C4 H4 sing N N 92 EST C5 C6 sing N N 93 EST C5 C10 doub Y N 94 EST C6 C7 sing N N 95 EST C6 H61 sing N N 96 EST C6 H62 sing N N 97 EST C7 C8 sing N N 98 EST C7 H71 sing N N 99 EST C7 H72 sing N N 100 EST C8 C9 sing N N 101 EST C8 C14 sing N N 102 EST C8 H8 sing N N 103 EST C9 C10 sing N N 104 EST C9 C11 sing N N 105 EST C9 H9 sing N N 106 EST C11 C12 sing N N 107 EST C11 H111 sing N N 108 EST C11 H112 sing N N 109 EST C12 C13 sing N N 110 EST C12 H121 sing N N 111 EST C12 H122 sing N N 112 EST C13 C14 sing N N 113 EST C13 C17 sing N N 114 EST C13 C18 sing N N 115 EST C14 C15 sing N N 116 EST C14 H14 sing N N 117 EST C15 C16 sing N N 118 EST C15 H151 sing N N 119 EST C15 H152 sing N N 120 EST C16 C17 sing N N 121 EST C16 H161 sing N N 122 EST C16 H162 sing N N 123 EST C17 O17 sing N N 124 EST C17 H17 sing N N 125 EST O17 HO7 sing N N 126 EST C18 H181 sing N N 127 EST C18 H182 sing N N 128 EST C18 H183 sing N N 129 GLN N CA sing N N 130 GLN N H sing N N 131 GLN N H2 sing N N 132 GLN CA C sing N N 133 GLN CA CB sing N N 134 GLN CA HA sing N N 135 GLN C O doub N N 136 GLN C OXT sing N N 137 GLN CB CG sing N N 138 GLN CB HB2 sing N N 139 GLN CB HB3 sing N N 140 GLN CG CD sing N N 141 GLN CG HG2 sing N N 142 GLN CG HG3 sing N N 143 GLN CD OE1 doub N N 144 GLN CD NE2 sing N N 145 GLN NE2 HE21 sing N N 146 GLN NE2 HE22 sing N N 147 GLN OXT HXT sing N N 148 GLU N CA sing N N 149 GLU N H sing N N 150 GLU N H2 sing N N 151 GLU CA C sing N N 152 GLU CA CB sing N N 153 GLU CA HA sing N N 154 GLU C O doub N N 155 GLU C OXT sing N N 156 GLU CB CG sing N N 157 GLU CB HB2 sing N N 158 GLU CB HB3 sing N N 159 GLU CG CD sing N N 160 GLU CG HG2 sing N N 161 GLU CG HG3 sing N N 162 GLU CD OE1 doub N N 163 GLU CD OE2 sing N N 164 GLU OE2 HE2 sing N N 165 GLU OXT HXT sing N N 166 GLY N CA sing N N 167 GLY N H sing N N 168 GLY N H2 sing N N 169 GLY CA C sing N N 170 GLY CA HA2 sing N N 171 GLY CA HA3 sing N N 172 GLY C O doub N N 173 GLY C OXT sing N N 174 GLY OXT HXT sing N N 175 HIS N CA sing N N 176 HIS N H sing N N 177 HIS N H2 sing N N 178 HIS CA C sing N N 179 HIS CA CB sing N N 180 HIS CA HA sing N N 181 HIS C O doub N N 182 HIS C OXT sing N N 183 HIS CB CG sing N N 184 HIS CB HB2 sing N N 185 HIS CB HB3 sing N N 186 HIS CG ND1 sing Y N 187 HIS CG CD2 doub Y N 188 HIS ND1 CE1 doub Y N 189 HIS ND1 HD1 sing N N 190 HIS CD2 NE2 sing Y N 191 HIS CD2 HD2 sing N N 192 HIS CE1 NE2 sing Y N 193 HIS CE1 HE1 sing N N 194 HIS NE2 HE2 sing N N 195 HIS OXT HXT sing N N 196 HOH O H1 sing N N 197 HOH O H2 sing N N 198 ILE N CA sing N N 199 ILE N H sing N N 200 ILE N H2 sing N N 201 ILE CA C sing N N 202 ILE CA CB sing N N 203 ILE CA HA sing N N 204 ILE C O doub N N 205 ILE C OXT sing N N 206 ILE CB CG1 sing N N 207 ILE CB CG2 sing N N 208 ILE CB HB sing N N 209 ILE CG1 CD1 sing N N 210 ILE CG1 HG12 sing N N 211 ILE CG1 HG13 sing N N 212 ILE CG2 HG21 sing N N 213 ILE CG2 HG22 sing N N 214 ILE CG2 HG23 sing N N 215 ILE CD1 HD11 sing N N 216 ILE CD1 HD12 sing N N 217 ILE CD1 HD13 sing N N 218 ILE OXT HXT sing N N 219 LEU N CA sing N N 220 LEU N H sing N N 221 LEU N H2 sing N N 222 LEU CA C sing N N 223 LEU CA CB sing N N 224 LEU CA HA sing N N 225 LEU C O doub N N 226 LEU C OXT sing N N 227 LEU CB CG sing N N 228 LEU CB HB2 sing N N 229 LEU CB HB3 sing N N 230 LEU CG CD1 sing N N 231 LEU CG CD2 sing N N 232 LEU CG HG sing N N 233 LEU CD1 HD11 sing N N 234 LEU CD1 HD12 sing N N 235 LEU CD1 HD13 sing N N 236 LEU CD2 HD21 sing N N 237 LEU CD2 HD22 sing N N 238 LEU CD2 HD23 sing N N 239 LEU OXT HXT sing N N 240 LYS N CA sing N N 241 LYS N H sing N N 242 LYS N H2 sing N N 243 LYS CA C sing N N 244 LYS CA CB sing N N 245 LYS CA HA sing N N 246 LYS C O doub N N 247 LYS C OXT sing N N 248 LYS CB CG sing N N 249 LYS CB HB2 sing N N 250 LYS CB HB3 sing N N 251 LYS CG CD sing N N 252 LYS CG HG2 sing N N 253 LYS CG HG3 sing N N 254 LYS CD CE sing N N 255 LYS CD HD2 sing N N 256 LYS CD HD3 sing N N 257 LYS CE NZ sing N N 258 LYS CE HE2 sing N N 259 LYS CE HE3 sing N N 260 LYS NZ HZ1 sing N N 261 LYS NZ HZ2 sing N N 262 LYS NZ HZ3 sing N N 263 LYS OXT HXT sing N N 264 MET N CA sing N N 265 MET N H sing N N 266 MET N H2 sing N N 267 MET CA C sing N N 268 MET CA CB sing N N 269 MET CA HA sing N N 270 MET C O doub N N 271 MET C OXT sing N N 272 MET CB CG sing N N 273 MET CB HB2 sing N N 274 MET CB HB3 sing N N 275 MET CG SD sing N N 276 MET CG HG2 sing N N 277 MET CG HG3 sing N N 278 MET SD CE sing N N 279 MET CE HE1 sing N N 280 MET CE HE2 sing N N 281 MET CE HE3 sing N N 282 MET OXT HXT sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 PRO N CA sing N N 307 PRO N CD sing N N 308 PRO N H sing N N 309 PRO CA C sing N N 310 PRO CA CB sing N N 311 PRO CA HA sing N N 312 PRO C O doub N N 313 PRO C OXT sing N N 314 PRO CB CG sing N N 315 PRO CB HB2 sing N N 316 PRO CB HB3 sing N N 317 PRO CG CD sing N N 318 PRO CG HG2 sing N N 319 PRO CG HG3 sing N N 320 PRO CD HD2 sing N N 321 PRO CD HD3 sing N N 322 PRO OXT HXT sing N N 323 SER N CA sing N N 324 SER N H sing N N 325 SER N H2 sing N N 326 SER CA C sing N N 327 SER CA CB sing N N 328 SER CA HA sing N N 329 SER C O doub N N 330 SER C OXT sing N N 331 SER CB OG sing N N 332 SER CB HB2 sing N N 333 SER CB HB3 sing N N 334 SER OG HG sing N N 335 SER OXT HXT sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TRP N CA sing N N 353 TRP N H sing N N 354 TRP N H2 sing N N 355 TRP CA C sing N N 356 TRP CA CB sing N N 357 TRP CA HA sing N N 358 TRP C O doub N N 359 TRP C OXT sing N N 360 TRP CB CG sing N N 361 TRP CB HB2 sing N N 362 TRP CB HB3 sing N N 363 TRP CG CD1 doub Y N 364 TRP CG CD2 sing Y N 365 TRP CD1 NE1 sing Y N 366 TRP CD1 HD1 sing N N 367 TRP CD2 CE2 doub Y N 368 TRP CD2 CE3 sing Y N 369 TRP NE1 CE2 sing Y N 370 TRP NE1 HE1 sing N N 371 TRP CE2 CZ2 sing Y N 372 TRP CE3 CZ3 doub Y N 373 TRP CE3 HE3 sing N N 374 TRP CZ2 CH2 doub Y N 375 TRP CZ2 HZ2 sing N N 376 TRP CZ3 CH2 sing Y N 377 TRP CZ3 HZ3 sing N N 378 TRP CH2 HH2 sing N N 379 TRP OXT HXT sing N N 380 TYR N CA sing N N 381 TYR N H sing N N 382 TYR N H2 sing N N 383 TYR CA C sing N N 384 TYR CA CB sing N N 385 TYR CA HA sing N N 386 TYR C O doub N N 387 TYR C OXT sing N N 388 TYR CB CG sing N N 389 TYR CB HB2 sing N N 390 TYR CB HB3 sing N N 391 TYR CG CD1 doub Y N 392 TYR CG CD2 sing Y N 393 TYR CD1 CE1 sing Y N 394 TYR CD1 HD1 sing N N 395 TYR CD2 CE2 doub Y N 396 TYR CD2 HD2 sing N N 397 TYR CE1 CZ doub Y N 398 TYR CE1 HE1 sing N N 399 TYR CE2 CZ sing Y N 400 TYR CE2 HE2 sing N N 401 TYR CZ OH sing N N 402 TYR OH HH sing N N 403 TYR OXT HXT sing N N 404 VAL N CA sing N N 405 VAL N H sing N N 406 VAL N H2 sing N N 407 VAL CA C sing N N 408 VAL CA CB sing N N 409 VAL CA HA sing N N 410 VAL C O doub N N 411 VAL C OXT sing N N 412 VAL CB CG1 sing N N 413 VAL CB CG2 sing N N 414 VAL CB HB sing N N 415 VAL CG1 HG11 sing N N 416 VAL CG1 HG12 sing N N 417 VAL CG1 HG13 sing N N 418 VAL CG2 HG21 sing N N 419 VAL CG2 HG22 sing N N 420 VAL CG2 HG23 sing N N 421 VAL OXT HXT sing N N 422 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number DP230100609 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code 9D8Q _pdbx_initial_refinement_model.details ? _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.type 'experimental model' # _atom_sites.entry_id 9N28 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005957 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005957 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005957 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #