data_9NJN # _entry.id 9NJN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9NJN pdb_00009njn 10.2210/pdb9njn/pdb WWPDB D_1000293522 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-08 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9NJN _pdbx_database_status.recvd_initial_deposition_date 2025-02-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email davidhep@buffalo.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Heppner _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0722-5160 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Damghani, T.' 1 ? 'Heppner, D.E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 17917 _citation.page_last 17932 _citation.title 'Profiling and Optimizing Targeted Covalent Inhibitors through EGFR-Guided Studies.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5c01661 _citation.pdbx_database_id_PubMed 40801664 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Damghani, T.' 1 ? primary 'Chitnis, S.P.' 2 0000-0002-5050-2338 primary 'Abidakun, O.A.' 3 0000-0002-2009-947X primary 'Patel, K.B.' 4 ? primary 'Lin, K.S.' 5 ? primary 'Ouellette, E.A.' 6 ? primary 'Lantry, A.M.' 7 ? primary 'Heppner, D.E.' 8 0000-0002-0722-5160 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37304.129 1 2.7.10.1 ? 'kinase domain (UNP residues 696-1022)' ? 2 non-polymer syn ;N-[2-{[2-(dimethylamino)ethyl](methyl)amino}-4-methoxy-5-({(4M)-4-[(4S)-8-methylimidazo[1,2-a]pyridin-3-yl]pyrimidin-2-yl}amino)phenyl]propanamide ; 502.611 1 ? ? ? ? 3 water nat water 18.015 49 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-[2-{[2-(dimethylamino)ethyl](methyl)amino}-4-methoxy-5-({(4M)-4-[(4S)-8-methylimidazo[1,2-a]pyridin-3-yl]pyrimidin-2-yl}amino)phenyl]propanamide ; A1BYS 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 ALA n 1 4 PRO n 1 5 ASN n 1 6 GLN n 1 7 ALA n 1 8 LEU n 1 9 LEU n 1 10 ARG n 1 11 ILE n 1 12 LEU n 1 13 LYS n 1 14 GLU n 1 15 THR n 1 16 GLU n 1 17 PHE n 1 18 LYS n 1 19 LYS n 1 20 ILE n 1 21 LYS n 1 22 VAL n 1 23 LEU n 1 24 GLY n 1 25 SER n 1 26 GLY n 1 27 ALA n 1 28 PHE n 1 29 GLY n 1 30 THR n 1 31 VAL n 1 32 TYR n 1 33 LYS n 1 34 GLY n 1 35 LEU n 1 36 TRP n 1 37 ILE n 1 38 PRO n 1 39 GLU n 1 40 GLY n 1 41 GLU n 1 42 LYS n 1 43 VAL n 1 44 LYS n 1 45 ILE n 1 46 PRO n 1 47 VAL n 1 48 ALA n 1 49 ILE n 1 50 LYS n 1 51 GLU n 1 52 LEU n 1 53 ARG n 1 54 GLU n 1 55 ALA n 1 56 THR n 1 57 SER n 1 58 PRO n 1 59 LYS n 1 60 ALA n 1 61 ASN n 1 62 LYS n 1 63 GLU n 1 64 ILE n 1 65 LEU n 1 66 ASP n 1 67 GLU n 1 68 ALA n 1 69 TYR n 1 70 VAL n 1 71 MET n 1 72 ALA n 1 73 SER n 1 74 VAL n 1 75 ASP n 1 76 ASN n 1 77 PRO n 1 78 HIS n 1 79 VAL n 1 80 CYS n 1 81 ARG n 1 82 LEU n 1 83 LEU n 1 84 GLY n 1 85 ILE n 1 86 CYS n 1 87 LEU n 1 88 THR n 1 89 SER n 1 90 THR n 1 91 VAL n 1 92 GLN n 1 93 LEU n 1 94 ILE n 1 95 THR n 1 96 GLN n 1 97 LEU n 1 98 MET n 1 99 PRO n 1 100 PHE n 1 101 GLY n 1 102 CYS n 1 103 LEU n 1 104 LEU n 1 105 ASP n 1 106 TYR n 1 107 VAL n 1 108 ARG n 1 109 GLU n 1 110 HIS n 1 111 LYS n 1 112 ASP n 1 113 ASN n 1 114 ILE n 1 115 GLY n 1 116 SER n 1 117 GLN n 1 118 TYR n 1 119 LEU n 1 120 LEU n 1 121 ASN n 1 122 TRP n 1 123 CYS n 1 124 VAL n 1 125 GLN n 1 126 ILE n 1 127 ALA n 1 128 LYS n 1 129 GLY n 1 130 MET n 1 131 ASN n 1 132 TYR n 1 133 LEU n 1 134 GLU n 1 135 ASP n 1 136 ARG n 1 137 ARG n 1 138 LEU n 1 139 VAL n 1 140 HIS n 1 141 ARG n 1 142 ASP n 1 143 LEU n 1 144 ALA n 1 145 ALA n 1 146 ARG n 1 147 ASN n 1 148 VAL n 1 149 LEU n 1 150 VAL n 1 151 LYS n 1 152 THR n 1 153 PRO n 1 154 GLN n 1 155 HIS n 1 156 VAL n 1 157 LYS n 1 158 ILE n 1 159 THR n 1 160 ASP n 1 161 PHE n 1 162 GLY n 1 163 LEU n 1 164 ALA n 1 165 LYS n 1 166 LEU n 1 167 LEU n 1 168 GLY n 1 169 ALA n 1 170 GLU n 1 171 GLU n 1 172 LYS n 1 173 GLU n 1 174 TYR n 1 175 HIS n 1 176 ALA n 1 177 GLU n 1 178 GLY n 1 179 GLY n 1 180 LYS n 1 181 VAL n 1 182 PRO n 1 183 ILE n 1 184 LYS n 1 185 TRP n 1 186 MET n 1 187 ALA n 1 188 LEU n 1 189 GLU n 1 190 SER n 1 191 ILE n 1 192 LEU n 1 193 HIS n 1 194 ARG n 1 195 ILE n 1 196 TYR n 1 197 THR n 1 198 HIS n 1 199 GLN n 1 200 SER n 1 201 ASP n 1 202 VAL n 1 203 TRP n 1 204 SER n 1 205 TYR n 1 206 GLY n 1 207 VAL n 1 208 THR n 1 209 VAL n 1 210 TRP n 1 211 GLU n 1 212 LEU n 1 213 MET n 1 214 THR n 1 215 PHE n 1 216 GLY n 1 217 SER n 1 218 LYS n 1 219 PRO n 1 220 TYR n 1 221 ASP n 1 222 GLY n 1 223 ILE n 1 224 PRO n 1 225 ALA n 1 226 SER n 1 227 GLU n 1 228 ILE n 1 229 SER n 1 230 SER n 1 231 ILE n 1 232 LEU n 1 233 GLU n 1 234 LYS n 1 235 GLY n 1 236 GLU n 1 237 ARG n 1 238 LEU n 1 239 PRO n 1 240 GLN n 1 241 PRO n 1 242 PRO n 1 243 ILE n 1 244 CYS n 1 245 THR n 1 246 ILE n 1 247 ASP n 1 248 VAL n 1 249 TYR n 1 250 MET n 1 251 ILE n 1 252 MET n 1 253 VAL n 1 254 LYS n 1 255 CYS n 1 256 TRP n 1 257 MET n 1 258 ILE n 1 259 ASP n 1 260 ALA n 1 261 ASP n 1 262 SER n 1 263 ARG n 1 264 PRO n 1 265 LYS n 1 266 PHE n 1 267 ARG n 1 268 GLU n 1 269 LEU n 1 270 ILE n 1 271 ILE n 1 272 GLU n 1 273 PHE n 1 274 SER n 1 275 LYS n 1 276 MET n 1 277 ALA n 1 278 ARG n 1 279 ASP n 1 280 PRO n 1 281 GLN n 1 282 ARG n 1 283 TYR n 1 284 LEU n 1 285 VAL n 1 286 ILE n 1 287 GLN n 1 288 GLY n 1 289 ASP n 1 290 GLU n 1 291 ARG n 1 292 MET n 1 293 HIS n 1 294 LEU n 1 295 PRO n 1 296 SER n 1 297 PRO n 1 298 THR n 1 299 ASP n 1 300 SER n 1 301 ASN n 1 302 PHE n 1 303 TYR n 1 304 ARG n 1 305 ALA n 1 306 LEU n 1 307 MET n 1 308 ASP n 1 309 GLU n 1 310 GLU n 1 311 ASP n 1 312 MET n 1 313 ASP n 1 314 ASP n 1 315 VAL n 1 316 VAL n 1 317 ASP n 1 318 ALA n 1 319 ASP n 1 320 GLU n 1 321 TYR n 1 322 LEU n 1 323 ILE n 1 324 PRO n 1 325 GLN n 1 326 GLN n 1 327 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 327 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1BYS non-polymer . ;N-[2-{[2-(dimethylamino)ethyl](methyl)amino}-4-methoxy-5-({(4M)-4-[(4S)-8-methylimidazo[1,2-a]pyridin-3-yl]pyrimidin-2-yl}amino)phenyl]propanamide ; ? 'C27 H34 N8 O2' 502.611 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 696 ? ? ? A . n A 1 2 GLU 2 697 ? ? ? A . n A 1 3 ALA 3 698 698 ALA ALA A . n A 1 4 PRO 4 699 699 PRO PRO A . n A 1 5 ASN 5 700 700 ASN ASN A . n A 1 6 GLN 6 701 701 GLN GLN A . n A 1 7 ALA 7 702 702 ALA ALA A . n A 1 8 LEU 8 703 703 LEU LEU A . n A 1 9 LEU 9 704 704 LEU LEU A . n A 1 10 ARG 10 705 705 ARG ARG A . n A 1 11 ILE 11 706 706 ILE ILE A . n A 1 12 LEU 12 707 707 LEU LEU A . n A 1 13 LYS 13 708 708 LYS LYS A . n A 1 14 GLU 14 709 709 GLU GLU A . n A 1 15 THR 15 710 710 THR THR A . n A 1 16 GLU 16 711 711 GLU GLU A . n A 1 17 PHE 17 712 712 PHE PHE A . n A 1 18 LYS 18 713 ? ? ? A . n A 1 19 LYS 19 714 ? ? ? A . n A 1 20 ILE 20 715 ? ? ? A . n A 1 21 LYS 21 716 ? ? ? A . n A 1 22 VAL 22 717 717 VAL VAL A . n A 1 23 LEU 23 718 718 LEU LEU A . n A 1 24 GLY 24 719 719 GLY GLY A . n A 1 25 SER 25 720 720 SER SER A . n A 1 26 GLY 26 721 ? ? ? A . n A 1 27 ALA 27 722 ? ? ? A . n A 1 28 PHE 28 723 ? ? ? A . n A 1 29 GLY 29 724 724 GLY GLY A . n A 1 30 THR 30 725 725 THR THR A . n A 1 31 VAL 31 726 726 VAL VAL A . n A 1 32 TYR 32 727 727 TYR TYR A . n A 1 33 LYS 33 728 728 LYS LYS A . n A 1 34 GLY 34 729 729 GLY GLY A . n A 1 35 LEU 35 730 730 LEU LEU A . n A 1 36 TRP 36 731 731 TRP TRP A . n A 1 37 ILE 37 732 732 ILE ILE A . n A 1 38 PRO 38 733 733 PRO PRO A . n A 1 39 GLU 39 734 734 GLU GLU A . n A 1 40 GLY 40 735 735 GLY GLY A . n A 1 41 GLU 41 736 736 GLU GLU A . n A 1 42 LYS 42 737 737 LYS LYS A . n A 1 43 VAL 43 738 738 VAL VAL A . n A 1 44 LYS 44 739 739 LYS LYS A . n A 1 45 ILE 45 740 740 ILE ILE A . n A 1 46 PRO 46 741 741 PRO PRO A . n A 1 47 VAL 47 742 742 VAL VAL A . n A 1 48 ALA 48 743 743 ALA ALA A . n A 1 49 ILE 49 744 744 ILE ILE A . n A 1 50 LYS 50 745 745 LYS LYS A . n A 1 51 GLU 51 746 ? ? ? A . n A 1 52 LEU 52 747 ? ? ? A . n A 1 53 ARG 53 748 ? ? ? A . n A 1 54 GLU 54 749 ? ? ? A . n A 1 55 ALA 55 750 ? ? ? A . n A 1 56 THR 56 751 ? ? ? A . n A 1 57 SER 57 752 ? ? ? A . n A 1 58 PRO 58 753 753 PRO PRO A . n A 1 59 LYS 59 754 754 LYS LYS A . n A 1 60 ALA 60 755 755 ALA ALA A . n A 1 61 ASN 61 756 756 ASN ASN A . n A 1 62 LYS 62 757 757 LYS LYS A . n A 1 63 GLU 63 758 758 GLU GLU A . n A 1 64 ILE 64 759 759 ILE ILE A . n A 1 65 LEU 65 760 760 LEU LEU A . n A 1 66 ASP 66 761 761 ASP ASP A . n A 1 67 GLU 67 762 762 GLU GLU A . n A 1 68 ALA 68 763 763 ALA ALA A . n A 1 69 TYR 69 764 764 TYR TYR A . n A 1 70 VAL 70 765 765 VAL VAL A . n A 1 71 MET 71 766 766 MET MET A . n A 1 72 ALA 72 767 767 ALA ALA A . n A 1 73 SER 73 768 768 SER SER A . n A 1 74 VAL 74 769 769 VAL VAL A . n A 1 75 ASP 75 770 770 ASP ASP A . n A 1 76 ASN 76 771 771 ASN ASN A . n A 1 77 PRO 77 772 772 PRO PRO A . n A 1 78 HIS 78 773 773 HIS HIS A . n A 1 79 VAL 79 774 774 VAL VAL A . n A 1 80 CYS 80 775 775 CYS CYS A . n A 1 81 ARG 81 776 776 ARG ARG A . n A 1 82 LEU 82 777 777 LEU LEU A . n A 1 83 LEU 83 778 778 LEU LEU A . n A 1 84 GLY 84 779 779 GLY GLY A . n A 1 85 ILE 85 780 780 ILE ILE A . n A 1 86 CYS 86 781 781 CYS CYS A . n A 1 87 LEU 87 782 782 LEU LEU A . n A 1 88 THR 88 783 783 THR THR A . n A 1 89 SER 89 784 784 SER SER A . n A 1 90 THR 90 785 785 THR THR A . n A 1 91 VAL 91 786 786 VAL VAL A . n A 1 92 GLN 92 787 787 GLN GLN A . n A 1 93 LEU 93 788 788 LEU LEU A . n A 1 94 ILE 94 789 789 ILE ILE A . n A 1 95 THR 95 790 790 THR THR A . n A 1 96 GLN 96 791 791 GLN GLN A . n A 1 97 LEU 97 792 792 LEU LEU A . n A 1 98 MET 98 793 793 MET MET A . n A 1 99 PRO 99 794 794 PRO PRO A . n A 1 100 PHE 100 795 795 PHE PHE A . n A 1 101 GLY 101 796 796 GLY GLY A . n A 1 102 CYS 102 797 797 CYS CYS A . n A 1 103 LEU 103 798 798 LEU LEU A . n A 1 104 LEU 104 799 799 LEU LEU A . n A 1 105 ASP 105 800 800 ASP ASP A . n A 1 106 TYR 106 801 801 TYR TYR A . n A 1 107 VAL 107 802 802 VAL VAL A . n A 1 108 ARG 108 803 803 ARG ARG A . n A 1 109 GLU 109 804 804 GLU GLU A . n A 1 110 HIS 110 805 805 HIS HIS A . n A 1 111 LYS 111 806 806 LYS LYS A . n A 1 112 ASP 112 807 807 ASP ASP A . n A 1 113 ASN 113 808 808 ASN ASN A . n A 1 114 ILE 114 809 809 ILE ILE A . n A 1 115 GLY 115 810 810 GLY GLY A . n A 1 116 SER 116 811 811 SER SER A . n A 1 117 GLN 117 812 812 GLN GLN A . n A 1 118 TYR 118 813 813 TYR TYR A . n A 1 119 LEU 119 814 814 LEU LEU A . n A 1 120 LEU 120 815 815 LEU LEU A . n A 1 121 ASN 121 816 816 ASN ASN A . n A 1 122 TRP 122 817 817 TRP TRP A . n A 1 123 CYS 123 818 818 CYS CYS A . n A 1 124 VAL 124 819 819 VAL VAL A . n A 1 125 GLN 125 820 820 GLN GLN A . n A 1 126 ILE 126 821 821 ILE ILE A . n A 1 127 ALA 127 822 822 ALA ALA A . n A 1 128 LYS 128 823 823 LYS LYS A . n A 1 129 GLY 129 824 824 GLY GLY A . n A 1 130 MET 130 825 825 MET MET A . n A 1 131 ASN 131 826 ? ? ? A . n A 1 132 TYR 132 827 827 TYR TYR A . n A 1 133 LEU 133 828 828 LEU LEU A . n A 1 134 GLU 134 829 829 GLU GLU A . n A 1 135 ASP 135 830 830 ASP ASP A . n A 1 136 ARG 136 831 831 ARG ARG A . n A 1 137 ARG 137 832 832 ARG ARG A . n A 1 138 LEU 138 833 833 LEU LEU A . n A 1 139 VAL 139 834 834 VAL VAL A . n A 1 140 HIS 140 835 835 HIS HIS A . n A 1 141 ARG 141 836 836 ARG ARG A . n A 1 142 ASP 142 837 837 ASP ASP A . n A 1 143 LEU 143 838 838 LEU LEU A . n A 1 144 ALA 144 839 839 ALA ALA A . n A 1 145 ALA 145 840 840 ALA ALA A . n A 1 146 ARG 146 841 841 ARG ARG A . n A 1 147 ASN 147 842 842 ASN ASN A . n A 1 148 VAL 148 843 843 VAL VAL A . n A 1 149 LEU 149 844 844 LEU LEU A . n A 1 150 VAL 150 845 845 VAL VAL A . n A 1 151 LYS 151 846 846 LYS LYS A . n A 1 152 THR 152 847 847 THR THR A . n A 1 153 PRO 153 848 848 PRO PRO A . n A 1 154 GLN 154 849 849 GLN GLN A . n A 1 155 HIS 155 850 850 HIS HIS A . n A 1 156 VAL 156 851 851 VAL VAL A . n A 1 157 LYS 157 852 852 LYS LYS A . n A 1 158 ILE 158 853 853 ILE ILE A . n A 1 159 THR 159 854 854 THR THR A . n A 1 160 ASP 160 855 855 ASP ASP A . n A 1 161 PHE 161 856 856 PHE PHE A . n A 1 162 GLY 162 857 857 GLY GLY A . n A 1 163 LEU 163 858 858 LEU LEU A . n A 1 164 ALA 164 859 859 ALA ALA A . n A 1 165 LYS 165 860 860 LYS LYS A . n A 1 166 LEU 166 861 ? ? ? A . n A 1 167 LEU 167 862 ? ? ? A . n A 1 168 GLY 168 863 ? ? ? A . n A 1 169 ALA 169 864 ? ? ? A . n A 1 170 GLU 170 865 ? ? ? A . n A 1 171 GLU 171 866 ? ? ? A . n A 1 172 LYS 172 867 ? ? ? A . n A 1 173 GLU 173 868 868 GLU GLU A . n A 1 174 TYR 174 869 869 TYR TYR A . n A 1 175 HIS 175 870 ? ? ? A . n A 1 176 ALA 176 871 ? ? ? A . n A 1 177 GLU 177 872 ? ? ? A . n A 1 178 GLY 178 873 ? ? ? A . n A 1 179 GLY 179 874 ? ? ? A . n A 1 180 LYS 180 875 ? ? ? A . n A 1 181 VAL 181 876 876 VAL VAL A . n A 1 182 PRO 182 877 877 PRO PRO A . n A 1 183 ILE 183 878 878 ILE ILE A . n A 1 184 LYS 184 879 879 LYS LYS A . n A 1 185 TRP 185 880 880 TRP TRP A . n A 1 186 MET 186 881 881 MET MET A . n A 1 187 ALA 187 882 882 ALA ALA A . n A 1 188 LEU 188 883 883 LEU LEU A . n A 1 189 GLU 189 884 884 GLU GLU A . n A 1 190 SER 190 885 885 SER SER A . n A 1 191 ILE 191 886 886 ILE ILE A . n A 1 192 LEU 192 887 887 LEU LEU A . n A 1 193 HIS 193 888 888 HIS HIS A . n A 1 194 ARG 194 889 889 ARG ARG A . n A 1 195 ILE 195 890 890 ILE ILE A . n A 1 196 TYR 196 891 891 TYR TYR A . n A 1 197 THR 197 892 892 THR THR A . n A 1 198 HIS 198 893 893 HIS HIS A . n A 1 199 GLN 199 894 894 GLN GLN A . n A 1 200 SER 200 895 895 SER SER A . n A 1 201 ASP 201 896 896 ASP ASP A . n A 1 202 VAL 202 897 897 VAL VAL A . n A 1 203 TRP 203 898 898 TRP TRP A . n A 1 204 SER 204 899 899 SER SER A . n A 1 205 TYR 205 900 900 TYR TYR A . n A 1 206 GLY 206 901 901 GLY GLY A . n A 1 207 VAL 207 902 902 VAL VAL A . n A 1 208 THR 208 903 903 THR THR A . n A 1 209 VAL 209 904 904 VAL VAL A . n A 1 210 TRP 210 905 905 TRP TRP A . n A 1 211 GLU 211 906 906 GLU GLU A . n A 1 212 LEU 212 907 907 LEU LEU A . n A 1 213 MET 213 908 908 MET MET A . n A 1 214 THR 214 909 909 THR THR A . n A 1 215 PHE 215 910 910 PHE PHE A . n A 1 216 GLY 216 911 911 GLY GLY A . n A 1 217 SER 217 912 912 SER SER A . n A 1 218 LYS 218 913 913 LYS LYS A . n A 1 219 PRO 219 914 914 PRO PRO A . n A 1 220 TYR 220 915 915 TYR TYR A . n A 1 221 ASP 221 916 916 ASP ASP A . n A 1 222 GLY 222 917 917 GLY GLY A . n A 1 223 ILE 223 918 918 ILE ILE A . n A 1 224 PRO 224 919 919 PRO PRO A . n A 1 225 ALA 225 920 920 ALA ALA A . n A 1 226 SER 226 921 921 SER SER A . n A 1 227 GLU 227 922 922 GLU GLU A . n A 1 228 ILE 228 923 923 ILE ILE A . n A 1 229 SER 229 924 924 SER SER A . n A 1 230 SER 230 925 925 SER SER A . n A 1 231 ILE 231 926 926 ILE ILE A . n A 1 232 LEU 232 927 927 LEU LEU A . n A 1 233 GLU 233 928 928 GLU GLU A . n A 1 234 LYS 234 929 929 LYS LYS A . n A 1 235 GLY 235 930 930 GLY GLY A . n A 1 236 GLU 236 931 931 GLU GLU A . n A 1 237 ARG 237 932 932 ARG ARG A . n A 1 238 LEU 238 933 933 LEU LEU A . n A 1 239 PRO 239 934 934 PRO PRO A . n A 1 240 GLN 240 935 935 GLN GLN A . n A 1 241 PRO 241 936 936 PRO PRO A . n A 1 242 PRO 242 937 937 PRO PRO A . n A 1 243 ILE 243 938 938 ILE ILE A . n A 1 244 CYS 244 939 939 CYS CYS A . n A 1 245 THR 245 940 940 THR THR A . n A 1 246 ILE 246 941 941 ILE ILE A . n A 1 247 ASP 247 942 942 ASP ASP A . n A 1 248 VAL 248 943 943 VAL VAL A . n A 1 249 TYR 249 944 944 TYR TYR A . n A 1 250 MET 250 945 945 MET MET A . n A 1 251 ILE 251 946 946 ILE ILE A . n A 1 252 MET 252 947 947 MET MET A . n A 1 253 VAL 253 948 948 VAL VAL A . n A 1 254 LYS 254 949 949 LYS LYS A . n A 1 255 CYS 255 950 950 CYS CYS A . n A 1 256 TRP 256 951 951 TRP TRP A . n A 1 257 MET 257 952 952 MET MET A . n A 1 258 ILE 258 953 953 ILE ILE A . n A 1 259 ASP 259 954 954 ASP ASP A . n A 1 260 ALA 260 955 955 ALA ALA A . n A 1 261 ASP 261 956 956 ASP ASP A . n A 1 262 SER 262 957 957 SER SER A . n A 1 263 ARG 263 958 958 ARG ARG A . n A 1 264 PRO 264 959 959 PRO PRO A . n A 1 265 LYS 265 960 960 LYS LYS A . n A 1 266 PHE 266 961 961 PHE PHE A . n A 1 267 ARG 267 962 962 ARG ARG A . n A 1 268 GLU 268 963 963 GLU GLU A . n A 1 269 LEU 269 964 964 LEU LEU A . n A 1 270 ILE 270 965 965 ILE ILE A . n A 1 271 ILE 271 966 966 ILE ILE A . n A 1 272 GLU 272 967 967 GLU GLU A . n A 1 273 PHE 273 968 968 PHE PHE A . n A 1 274 SER 274 969 969 SER SER A . n A 1 275 LYS 275 970 970 LYS LYS A . n A 1 276 MET 276 971 971 MET MET A . n A 1 277 ALA 277 972 972 ALA ALA A . n A 1 278 ARG 278 973 973 ARG ARG A . n A 1 279 ASP 279 974 974 ASP ASP A . n A 1 280 PRO 280 975 975 PRO PRO A . n A 1 281 GLN 281 976 976 GLN GLN A . n A 1 282 ARG 282 977 977 ARG ARG A . n A 1 283 TYR 283 978 978 TYR TYR A . n A 1 284 LEU 284 979 979 LEU LEU A . n A 1 285 VAL 285 980 980 VAL VAL A . n A 1 286 ILE 286 981 981 ILE ILE A . n A 1 287 GLN 287 982 982 GLN GLN A . n A 1 288 GLY 288 983 983 GLY GLY A . n A 1 289 ASP 289 984 984 ASP ASP A . n A 1 290 GLU 290 985 ? ? ? A . n A 1 291 ARG 291 986 ? ? ? A . n A 1 292 MET 292 987 ? ? ? A . n A 1 293 HIS 293 988 ? ? ? A . n A 1 294 LEU 294 989 ? ? ? A . n A 1 295 PRO 295 990 ? ? ? A . n A 1 296 SER 296 991 ? ? ? A . n A 1 297 PRO 297 992 ? ? ? A . n A 1 298 THR 298 993 ? ? ? A . n A 1 299 ASP 299 994 ? ? ? A . n A 1 300 SER 300 995 ? ? ? A . n A 1 301 ASN 301 996 ? ? ? A . n A 1 302 PHE 302 997 ? ? ? A . n A 1 303 TYR 303 998 ? ? ? A . n A 1 304 ARG 304 999 ? ? ? A . n A 1 305 ALA 305 1000 ? ? ? A . n A 1 306 LEU 306 1001 ? ? ? A . n A 1 307 MET 307 1002 ? ? ? A . n A 1 308 ASP 308 1003 ? ? ? A . n A 1 309 GLU 309 1004 ? ? ? A . n A 1 310 GLU 310 1005 ? ? ? A . n A 1 311 ASP 311 1006 ? ? ? A . n A 1 312 MET 312 1007 ? ? ? A . n A 1 313 ASP 313 1008 ? ? ? A . n A 1 314 ASP 314 1009 1009 ASP ASP A . n A 1 315 VAL 315 1010 1010 VAL VAL A . n A 1 316 VAL 316 1011 1011 VAL VAL A . n A 1 317 ASP 317 1012 1012 ASP ASP A . n A 1 318 ALA 318 1013 1013 ALA ALA A . n A 1 319 ASP 319 1014 1014 ASP ASP A . n A 1 320 GLU 320 1015 1015 GLU GLU A . n A 1 321 TYR 321 1016 1016 TYR TYR A . n A 1 322 LEU 322 1017 1017 LEU LEU A . n A 1 323 ILE 323 1018 ? ? ? A . n A 1 324 PRO 324 1019 ? ? ? A . n A 1 325 GLN 325 1020 ? ? ? A . n A 1 326 GLN 326 1021 ? ? ? A . n A 1 327 GLY 327 1022 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1BYS _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1BYS _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1BYS 1 1101 1101 A1BYS YK2 A . C 3 HOH 1 1201 22 HOH HOH A . C 3 HOH 2 1202 13 HOH HOH A . C 3 HOH 3 1203 52 HOH HOH A . C 3 HOH 4 1204 5 HOH HOH A . C 3 HOH 5 1205 11 HOH HOH A . C 3 HOH 6 1206 26 HOH HOH A . C 3 HOH 7 1207 28 HOH HOH A . C 3 HOH 8 1208 12 HOH HOH A . C 3 HOH 9 1209 17 HOH HOH A . C 3 HOH 10 1210 4 HOH HOH A . C 3 HOH 11 1211 18 HOH HOH A . C 3 HOH 12 1212 21 HOH HOH A . C 3 HOH 13 1213 3 HOH HOH A . C 3 HOH 14 1214 43 HOH HOH A . C 3 HOH 15 1215 14 HOH HOH A . C 3 HOH 16 1216 50 HOH HOH A . C 3 HOH 17 1217 9 HOH HOH A . C 3 HOH 18 1218 10 HOH HOH A . C 3 HOH 19 1219 23 HOH HOH A . C 3 HOH 20 1220 48 HOH HOH A . C 3 HOH 21 1221 35 HOH HOH A . C 3 HOH 22 1222 34 HOH HOH A . C 3 HOH 23 1223 33 HOH HOH A . C 3 HOH 24 1224 49 HOH HOH A . C 3 HOH 25 1225 41 HOH HOH A . C 3 HOH 26 1226 8 HOH HOH A . C 3 HOH 27 1227 7 HOH HOH A . C 3 HOH 28 1228 15 HOH HOH A . C 3 HOH 29 1229 38 HOH HOH A . C 3 HOH 30 1230 16 HOH HOH A . C 3 HOH 31 1231 44 HOH HOH A . C 3 HOH 32 1232 47 HOH HOH A . C 3 HOH 33 1233 6 HOH HOH A . C 3 HOH 34 1234 1 HOH HOH A . C 3 HOH 35 1235 40 HOH HOH A . C 3 HOH 36 1236 24 HOH HOH A . C 3 HOH 37 1237 42 HOH HOH A . C 3 HOH 38 1238 31 HOH HOH A . C 3 HOH 39 1239 46 HOH HOH A . C 3 HOH 40 1240 20 HOH HOH A . C 3 HOH 41 1241 39 HOH HOH A . C 3 HOH 42 1242 29 HOH HOH A . C 3 HOH 43 1243 2 HOH HOH A . C 3 HOH 44 1244 19 HOH HOH A . C 3 HOH 45 1245 25 HOH HOH A . C 3 HOH 46 1246 27 HOH HOH A . C 3 HOH 47 1247 37 HOH HOH A . C 3 HOH 48 1248 36 HOH HOH A . C 3 HOH 49 1249 45 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21_5207 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'BUILT 20241002' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.8.2 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9NJN _cell.details ? _cell.formula_units_Z ? _cell.length_a 145.864 _cell.length_a_esd ? _cell.length_b 145.864 _cell.length_b_esd ? _cell.length_c 145.864 _cell.length_c_esd ? _cell.volume 3103447.171 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9NJN _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall 'I 2 2 3' _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9NJN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 mM MES, 1.0 M sodium citrate, 0.5 mM TCEP' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-10-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979338 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979338 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 39.77 _reflns.entry_id 9NJN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.235 _reflns.d_resolution_low 103.141 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25109 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.136 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.125 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 6.067 103.141 ? 31.2 ? ? ? ? 1319 ? ? ? ? ? ? ? ? ? ? ? 6.9 ? ? ? 0.040 ? ? 1 1 0.999 ? ? 99.8 ? 0.037 ? ? ? ? ? ? ? ? ? 2.235 2.274 ? ? ? ? ? ? 1245 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.492 ? ? 2 1 0.358 ? ? ? ? 1.377 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 46.45 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9NJN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.24 _refine.ls_d_res_low 72.93 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25101 _refine.ls_number_reflns_R_free 1312 _refine.ls_number_reflns_R_work 23789 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 5.23 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2419 _refine.ls_R_factor_R_free 0.2754 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2401 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.7220 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3573 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.24 _refine_hist.d_res_low 72.93 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 2240 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2154 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0035 ? 2237 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8536 ? 3026 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0463 ? 339 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0047 ? 372 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.3691 ? 831 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.24 2.32 . . 132 2641 99.93 . . . . 0.3199 . . . . . . . . . . . . . . . 0.3726 'X-RAY DIFFRACTION' 2.32 2.43 . . 160 2607 100.00 . . . . 0.2941 . . . . . . . . . . . . . . . 0.3385 'X-RAY DIFFRACTION' 2.43 2.56 . . 130 2621 100.00 . . . . 0.2906 . . . . . . . . . . . . . . . 0.3070 'X-RAY DIFFRACTION' 2.56 2.72 . . 168 2606 100.00 . . . . 0.2806 . . . . . . . . . . . . . . . 0.3177 'X-RAY DIFFRACTION' 2.72 2.93 . . 150 2612 100.00 . . . . 0.2828 . . . . . . . . . . . . . . . 0.2969 'X-RAY DIFFRACTION' 2.93 3.22 . . 141 2646 100.00 . . . . 0.2617 . . . . . . . . . . . . . . . 0.2923 'X-RAY DIFFRACTION' 3.22 3.69 . . 163 2619 100.00 . . . . 0.2332 . . . . . . . . . . . . . . . 0.2761 'X-RAY DIFFRACTION' 3.69 4.65 . . 136 2681 99.93 . . . . 0.1965 . . . . . . . . . . . . . . . 0.2416 'X-RAY DIFFRACTION' 4.65 72.93 . . 132 2756 99.83 . . . . 0.2189 . . . . . . . . . . . . . . . 0.2369 # _struct.entry_id 9NJN _struct.title 'YK-029a in complex with WT EGFR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9NJN _struct_keywords.text 'Drug Discovery, Cancer, Drug Resistance., TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQG ; _struct_ref.pdbx_align_begin 696 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9NJN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 327 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 696 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 696 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 800 ? 1 MORE -4 ? 1 'SSA (A^2)' 14060 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 13 ? PHE A 17 ? LYS A 708 PHE A 712 5 ? 5 HELX_P HELX_P2 AA2 LYS A 59 ? SER A 73 ? LYS A 754 SER A 768 1 ? 15 HELX_P HELX_P3 AA3 CYS A 102 ? HIS A 110 ? CYS A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 AA4 LYS A 111 ? ILE A 114 ? LYS A 806 ILE A 809 5 ? 4 HELX_P HELX_P5 AA5 GLY A 115 ? MET A 130 ? GLY A 810 MET A 825 1 ? 16 HELX_P HELX_P6 AA6 TYR A 132 ? GLU A 134 ? TYR A 827 GLU A 829 5 ? 3 HELX_P HELX_P7 AA7 ALA A 144 ? ARG A 146 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P8 AA8 PRO A 182 ? MET A 186 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P9 AA9 ALA A 187 ? ARG A 194 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P10 AB1 THR A 197 ? THR A 214 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P11 AB2 PRO A 224 ? SER A 226 ? PRO A 919 SER A 921 5 ? 3 HELX_P HELX_P12 AB3 GLU A 227 ? GLY A 235 ? GLU A 922 GLY A 930 1 ? 9 HELX_P HELX_P13 AB4 THR A 245 ? CYS A 255 ? THR A 940 CYS A 950 1 ? 11 HELX_P HELX_P14 AB5 ASP A 259 ? ARG A 263 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P15 AB6 LYS A 265 ? ARG A 278 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P16 AB7 ASP A 279 ? TYR A 283 ? ASP A 974 TYR A 978 5 ? 5 HELX_P HELX_P17 AB8 ASP A 317 ? TYR A 321 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 102 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1BYS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C01 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 797 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1BYS _struct_conn.ptnr2_auth_seq_id 1101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.858 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1BYS _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 102 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1BYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1101 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 797 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C01 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1BYS _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 32 ? TRP A 36 ? TYR A 727 TRP A 731 AA1 2 ILE A 45 ? LYS A 50 ? ILE A 740 LYS A 745 AA1 3 VAL A 91 ? GLN A 96 ? VAL A 786 GLN A 791 AA1 4 LEU A 82 ? LEU A 87 ? LEU A 777 LEU A 782 AA2 1 VAL A 148 ? THR A 152 ? VAL A 843 THR A 847 AA2 2 HIS A 155 ? ILE A 158 ? HIS A 850 ILE A 853 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 32 ? N TYR A 727 O ILE A 49 ? O ILE A 744 AA1 2 3 N LYS A 50 ? N LYS A 745 O LEU A 93 ? O LEU A 788 AA1 3 4 O ILE A 94 ? O ILE A 789 N LEU A 83 ? N LEU A 778 AA2 1 2 N LEU A 149 ? N LEU A 844 O LYS A 157 ? O LYS A 852 # _pdbx_entry_details.entry_id 9NJN _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 783 ? ? -119.72 -144.53 2 1 ASP A 837 ? ? -155.18 42.64 3 1 ASP A 855 ? ? 61.23 82.93 4 1 ASP A 974 ? ? -150.10 69.63 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 z,x,y 3 y,z,x 4 -y,-z,x 5 z,-x,-y 6 -y,z,-x 7 -z,-x,y 8 -z,x,-y 9 y,-z,-x 10 x,-y,-z 11 -x,y,-z 12 -x,-y,z 13 x+1/2,y+1/2,z+1/2 14 z+1/2,x+1/2,y+1/2 15 y+1/2,z+1/2,x+1/2 16 -y+1/2,-z+1/2,x+1/2 17 z+1/2,-x+1/2,-y+1/2 18 -y+1/2,z+1/2,-x+1/2 19 -z+1/2,-x+1/2,y+1/2 20 -z+1/2,x+1/2,-y+1/2 21 y+1/2,-z+1/2,-x+1/2 22 x+1/2,-y+1/2,-z+1/2 23 -x+1/2,y+1/2,-z+1/2 24 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 696 ? A GLY 1 2 1 Y 1 A GLU 697 ? A GLU 2 3 1 Y 1 A LYS 713 ? A LYS 18 4 1 Y 1 A LYS 714 ? A LYS 19 5 1 Y 1 A ILE 715 ? A ILE 20 6 1 Y 1 A LYS 716 ? A LYS 21 7 1 Y 1 A GLY 721 ? A GLY 26 8 1 Y 1 A ALA 722 ? A ALA 27 9 1 Y 1 A PHE 723 ? A PHE 28 10 1 Y 1 A GLU 746 ? A GLU 51 11 1 Y 1 A LEU 747 ? A LEU 52 12 1 Y 1 A ARG 748 ? A ARG 53 13 1 Y 1 A GLU 749 ? A GLU 54 14 1 Y 1 A ALA 750 ? A ALA 55 15 1 Y 1 A THR 751 ? A THR 56 16 1 Y 1 A SER 752 ? A SER 57 17 1 Y 1 A ASN 826 ? A ASN 131 18 1 Y 1 A LEU 861 ? A LEU 166 19 1 Y 1 A LEU 862 ? A LEU 167 20 1 Y 1 A GLY 863 ? A GLY 168 21 1 Y 1 A ALA 864 ? A ALA 169 22 1 Y 1 A GLU 865 ? A GLU 170 23 1 Y 1 A GLU 866 ? A GLU 171 24 1 Y 1 A LYS 867 ? A LYS 172 25 1 Y 1 A HIS 870 ? A HIS 175 26 1 Y 1 A ALA 871 ? A ALA 176 27 1 Y 1 A GLU 872 ? A GLU 177 28 1 Y 1 A GLY 873 ? A GLY 178 29 1 Y 1 A GLY 874 ? A GLY 179 30 1 Y 1 A LYS 875 ? A LYS 180 31 1 Y 1 A GLU 985 ? A GLU 290 32 1 Y 1 A ARG 986 ? A ARG 291 33 1 Y 1 A MET 987 ? A MET 292 34 1 Y 1 A HIS 988 ? A HIS 293 35 1 Y 1 A LEU 989 ? A LEU 294 36 1 Y 1 A PRO 990 ? A PRO 295 37 1 Y 1 A SER 991 ? A SER 296 38 1 Y 1 A PRO 992 ? A PRO 297 39 1 Y 1 A THR 993 ? A THR 298 40 1 Y 1 A ASP 994 ? A ASP 299 41 1 Y 1 A SER 995 ? A SER 300 42 1 Y 1 A ASN 996 ? A ASN 301 43 1 Y 1 A PHE 997 ? A PHE 302 44 1 Y 1 A TYR 998 ? A TYR 303 45 1 Y 1 A ARG 999 ? A ARG 304 46 1 Y 1 A ALA 1000 ? A ALA 305 47 1 Y 1 A LEU 1001 ? A LEU 306 48 1 Y 1 A MET 1002 ? A MET 307 49 1 Y 1 A ASP 1003 ? A ASP 308 50 1 Y 1 A GLU 1004 ? A GLU 309 51 1 Y 1 A GLU 1005 ? A GLU 310 52 1 Y 1 A ASP 1006 ? A ASP 311 53 1 Y 1 A MET 1007 ? A MET 312 54 1 Y 1 A ASP 1008 ? A ASP 313 55 1 Y 1 A ILE 1018 ? A ILE 323 56 1 Y 1 A PRO 1019 ? A PRO 324 57 1 Y 1 A GLN 1020 ? A GLN 325 58 1 Y 1 A GLN 1021 ? A GLN 326 59 1 Y 1 A GLY 1022 ? A GLY 327 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1BYS C01 C N N 1 A1BYS C02 C N N 2 A1BYS C03 C N N 3 A1BYS C05 C Y N 4 A1BYS C06 C Y N 5 A1BYS C07 C Y N 6 A1BYS C09 C Y N 7 A1BYS C11 C Y N 8 A1BYS C12 C Y N 9 A1BYS C13 C Y N 10 A1BYS C14 C Y N 11 A1BYS C15 C Y N 12 A1BYS C17 C Y N 13 A1BYS C18 C Y N 14 A1BYS C19 C N N 15 A1BYS C20 C Y N 16 A1BYS C21 C Y N 17 A1BYS C22 C Y N 18 A1BYS C25 C Y N 19 A1BYS N04 N N N 20 A1BYS N08 N N N 21 A1BYS C27 C N N 22 A1BYS C28 C Y N 23 A1BYS C29 C Y N 24 A1BYS C31 C N N 25 A1BYS C32 C N N 26 A1BYS C34 C N N 27 A1BYS C35 C N N 28 A1BYS C36 C N N 29 A1BYS N10 N Y N 30 A1BYS N16 N Y N 31 A1BYS N23 N Y N 32 A1BYS N24 N Y N 33 A1BYS N30 N N N 34 A1BYS N33 N N N 35 A1BYS O26 O N N 36 A1BYS O37 O N N 37 A1BYS H011 H N N 38 A1BYS H1 H N N 39 A1BYS H012 H N N 40 A1BYS H021 H N N 41 A1BYS H2 H N N 42 A1BYS H061 H N N 43 A1BYS H111 H N N 44 A1BYS H121 H N N 45 A1BYS H151 H N N 46 A1BYS H193 H N N 47 A1BYS H192 H N N 48 A1BYS H191 H N N 49 A1BYS H201 H N N 50 A1BYS H211 H N N 51 A1BYS H221 H N N 52 A1BYS H041 H N N 53 A1BYS H081 H N N 54 A1BYS H273 H N N 55 A1BYS H271 H N N 56 A1BYS H272 H N N 57 A1BYS H281 H N N 58 A1BYS H312 H N N 59 A1BYS H311 H N N 60 A1BYS H321 H N N 61 A1BYS H322 H N N 62 A1BYS H342 H N N 63 A1BYS H343 H N N 64 A1BYS H341 H N N 65 A1BYS H353 H N N 66 A1BYS H351 H N N 67 A1BYS H352 H N N 68 A1BYS H363 H N N 69 A1BYS H361 H N N 70 A1BYS H362 H N N 71 ALA N N N N 72 ALA CA C N S 73 ALA C C N N 74 ALA O O N N 75 ALA CB C N N 76 ALA OXT O N N 77 ALA H H N N 78 ALA H2 H N N 79 ALA HA H N N 80 ALA HB1 H N N 81 ALA HB2 H N N 82 ALA HB3 H N N 83 ALA HXT H N N 84 ARG N N N N 85 ARG CA C N S 86 ARG C C N N 87 ARG O O N N 88 ARG CB C N N 89 ARG CG C N N 90 ARG CD C N N 91 ARG NE N N N 92 ARG CZ C N N 93 ARG NH1 N N N 94 ARG NH2 N N N 95 ARG OXT O N N 96 ARG H H N N 97 ARG H2 H N N 98 ARG HA H N N 99 ARG HB2 H N N 100 ARG HB3 H N N 101 ARG HG2 H N N 102 ARG HG3 H N N 103 ARG HD2 H N N 104 ARG HD3 H N N 105 ARG HE H N N 106 ARG HH11 H N N 107 ARG HH12 H N N 108 ARG HH21 H N N 109 ARG HH22 H N N 110 ARG HXT H N N 111 ASN N N N N 112 ASN CA C N S 113 ASN C C N N 114 ASN O O N N 115 ASN CB C N N 116 ASN CG C N N 117 ASN OD1 O N N 118 ASN ND2 N N N 119 ASN OXT O N N 120 ASN H H N N 121 ASN H2 H N N 122 ASN HA H N N 123 ASN HB2 H N N 124 ASN HB3 H N N 125 ASN HD21 H N N 126 ASN HD22 H N N 127 ASN HXT H N N 128 ASP N N N N 129 ASP CA C N S 130 ASP C C N N 131 ASP O O N N 132 ASP CB C N N 133 ASP CG C N N 134 ASP OD1 O N N 135 ASP OD2 O N N 136 ASP OXT O N N 137 ASP H H N N 138 ASP H2 H N N 139 ASP HA H N N 140 ASP HB2 H N N 141 ASP HB3 H N N 142 ASP HD2 H N N 143 ASP HXT H N N 144 CYS N N N N 145 CYS CA C N R 146 CYS C C N N 147 CYS O O N N 148 CYS CB C N N 149 CYS SG S N N 150 CYS OXT O N N 151 CYS H H N N 152 CYS H2 H N N 153 CYS HA H N N 154 CYS HB2 H N N 155 CYS HB3 H N N 156 CYS HG H N N 157 CYS HXT H N N 158 GLN N N N N 159 GLN CA C N S 160 GLN C C N N 161 GLN O O N N 162 GLN CB C N N 163 GLN CG C N N 164 GLN CD C N N 165 GLN OE1 O N N 166 GLN NE2 N N N 167 GLN OXT O N N 168 GLN H H N N 169 GLN H2 H N N 170 GLN HA H N N 171 GLN HB2 H N N 172 GLN HB3 H N N 173 GLN HG2 H N N 174 GLN HG3 H N N 175 GLN HE21 H N N 176 GLN HE22 H N N 177 GLN HXT H N N 178 GLU N N N N 179 GLU CA C N S 180 GLU C C N N 181 GLU O O N N 182 GLU CB C N N 183 GLU CG C N N 184 GLU CD C N N 185 GLU OE1 O N N 186 GLU OE2 O N N 187 GLU OXT O N N 188 GLU H H N N 189 GLU H2 H N N 190 GLU HA H N N 191 GLU HB2 H N N 192 GLU HB3 H N N 193 GLU HG2 H N N 194 GLU HG3 H N N 195 GLU HE2 H N N 196 GLU HXT H N N 197 GLY N N N N 198 GLY CA C N N 199 GLY C C N N 200 GLY O O N N 201 GLY OXT O N N 202 GLY H H N N 203 GLY H2 H N N 204 GLY HA2 H N N 205 GLY HA3 H N N 206 GLY HXT H N N 207 HIS N N N N 208 HIS CA C N S 209 HIS C C N N 210 HIS O O N N 211 HIS CB C N N 212 HIS CG C Y N 213 HIS ND1 N Y N 214 HIS CD2 C Y N 215 HIS CE1 C Y N 216 HIS NE2 N Y N 217 HIS OXT O N N 218 HIS H H N N 219 HIS H2 H N N 220 HIS HA H N N 221 HIS HB2 H N N 222 HIS HB3 H N N 223 HIS HD1 H N N 224 HIS HD2 H N N 225 HIS HE1 H N N 226 HIS HE2 H N N 227 HIS HXT H N N 228 HOH O O N N 229 HOH H1 H N N 230 HOH H2 H N N 231 ILE N N N N 232 ILE CA C N S 233 ILE C C N N 234 ILE O O N N 235 ILE CB C N S 236 ILE CG1 C N N 237 ILE CG2 C N N 238 ILE CD1 C N N 239 ILE OXT O N N 240 ILE H H N N 241 ILE H2 H N N 242 ILE HA H N N 243 ILE HB H N N 244 ILE HG12 H N N 245 ILE HG13 H N N 246 ILE HG21 H N N 247 ILE HG22 H N N 248 ILE HG23 H N N 249 ILE HD11 H N N 250 ILE HD12 H N N 251 ILE HD13 H N N 252 ILE HXT H N N 253 LEU N N N N 254 LEU CA C N S 255 LEU C C N N 256 LEU O O N N 257 LEU CB C N N 258 LEU CG C N N 259 LEU CD1 C N N 260 LEU CD2 C N N 261 LEU OXT O N N 262 LEU H H N N 263 LEU H2 H N N 264 LEU HA H N N 265 LEU HB2 H N N 266 LEU HB3 H N N 267 LEU HG H N N 268 LEU HD11 H N N 269 LEU HD12 H N N 270 LEU HD13 H N N 271 LEU HD21 H N N 272 LEU HD22 H N N 273 LEU HD23 H N N 274 LEU HXT H N N 275 LYS N N N N 276 LYS CA C N S 277 LYS C C N N 278 LYS O O N N 279 LYS CB C N N 280 LYS CG C N N 281 LYS CD C N N 282 LYS CE C N N 283 LYS NZ N N N 284 LYS OXT O N N 285 LYS H H N N 286 LYS H2 H N N 287 LYS HA H N N 288 LYS HB2 H N N 289 LYS HB3 H N N 290 LYS HG2 H N N 291 LYS HG3 H N N 292 LYS HD2 H N N 293 LYS HD3 H N N 294 LYS HE2 H N N 295 LYS HE3 H N N 296 LYS HZ1 H N N 297 LYS HZ2 H N N 298 LYS HZ3 H N N 299 LYS HXT H N N 300 MET N N N N 301 MET CA C N S 302 MET C C N N 303 MET O O N N 304 MET CB C N N 305 MET CG C N N 306 MET SD S N N 307 MET CE C N N 308 MET OXT O N N 309 MET H H N N 310 MET H2 H N N 311 MET HA H N N 312 MET HB2 H N N 313 MET HB3 H N N 314 MET HG2 H N N 315 MET HG3 H N N 316 MET HE1 H N N 317 MET HE2 H N N 318 MET HE3 H N N 319 MET HXT H N N 320 PHE N N N N 321 PHE CA C N S 322 PHE C C N N 323 PHE O O N N 324 PHE CB C N N 325 PHE CG C Y N 326 PHE CD1 C Y N 327 PHE CD2 C Y N 328 PHE CE1 C Y N 329 PHE CE2 C Y N 330 PHE CZ C Y N 331 PHE OXT O N N 332 PHE H H N N 333 PHE H2 H N N 334 PHE HA H N N 335 PHE HB2 H N N 336 PHE HB3 H N N 337 PHE HD1 H N N 338 PHE HD2 H N N 339 PHE HE1 H N N 340 PHE HE2 H N N 341 PHE HZ H N N 342 PHE HXT H N N 343 PRO N N N N 344 PRO CA C N S 345 PRO C C N N 346 PRO O O N N 347 PRO CB C N N 348 PRO CG C N N 349 PRO CD C N N 350 PRO OXT O N N 351 PRO H H N N 352 PRO HA H N N 353 PRO HB2 H N N 354 PRO HB3 H N N 355 PRO HG2 H N N 356 PRO HG3 H N N 357 PRO HD2 H N N 358 PRO HD3 H N N 359 PRO HXT H N N 360 SER N N N N 361 SER CA C N S 362 SER C C N N 363 SER O O N N 364 SER CB C N N 365 SER OG O N N 366 SER OXT O N N 367 SER H H N N 368 SER H2 H N N 369 SER HA H N N 370 SER HB2 H N N 371 SER HB3 H N N 372 SER HG H N N 373 SER HXT H N N 374 THR N N N N 375 THR CA C N S 376 THR C C N N 377 THR O O N N 378 THR CB C N R 379 THR OG1 O N N 380 THR CG2 C N N 381 THR OXT O N N 382 THR H H N N 383 THR H2 H N N 384 THR HA H N N 385 THR HB H N N 386 THR HG1 H N N 387 THR HG21 H N N 388 THR HG22 H N N 389 THR HG23 H N N 390 THR HXT H N N 391 TRP N N N N 392 TRP CA C N S 393 TRP C C N N 394 TRP O O N N 395 TRP CB C N N 396 TRP CG C Y N 397 TRP CD1 C Y N 398 TRP CD2 C Y N 399 TRP NE1 N Y N 400 TRP CE2 C Y N 401 TRP CE3 C Y N 402 TRP CZ2 C Y N 403 TRP CZ3 C Y N 404 TRP CH2 C Y N 405 TRP OXT O N N 406 TRP H H N N 407 TRP H2 H N N 408 TRP HA H N N 409 TRP HB2 H N N 410 TRP HB3 H N N 411 TRP HD1 H N N 412 TRP HE1 H N N 413 TRP HE3 H N N 414 TRP HZ2 H N N 415 TRP HZ3 H N N 416 TRP HH2 H N N 417 TRP HXT H N N 418 TYR N N N N 419 TYR CA C N S 420 TYR C C N N 421 TYR O O N N 422 TYR CB C N N 423 TYR CG C Y N 424 TYR CD1 C Y N 425 TYR CD2 C Y N 426 TYR CE1 C Y N 427 TYR CE2 C Y N 428 TYR CZ C Y N 429 TYR OH O N N 430 TYR OXT O N N 431 TYR H H N N 432 TYR H2 H N N 433 TYR HA H N N 434 TYR HB2 H N N 435 TYR HB3 H N N 436 TYR HD1 H N N 437 TYR HD2 H N N 438 TYR HE1 H N N 439 TYR HE2 H N N 440 TYR HH H N N 441 TYR HXT H N N 442 VAL N N N N 443 VAL CA C N S 444 VAL C C N N 445 VAL O O N N 446 VAL CB C N N 447 VAL CG1 C N N 448 VAL CG2 C N N 449 VAL OXT O N N 450 VAL H H N N 451 VAL H2 H N N 452 VAL HA H N N 453 VAL HB H N N 454 VAL HG11 H N N 455 VAL HG12 H N N 456 VAL HG13 H N N 457 VAL HG21 H N N 458 VAL HG22 H N N 459 VAL HG23 H N N 460 VAL HXT H N N 461 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1BYS C01 C02 sing N N 1 A1BYS C02 C03 sing N N 2 A1BYS C03 N04 sing N N 3 A1BYS C03 O37 doub N N 4 A1BYS N04 C05 sing N N 5 A1BYS C05 C29 doub Y N 6 A1BYS C05 C06 sing Y N 7 A1BYS C06 C07 doub Y N 8 A1BYS C07 N08 sing N N 9 A1BYS C07 C25 sing Y N 10 A1BYS N08 C09 sing N N 11 A1BYS C09 N24 doub Y N 12 A1BYS C09 N10 sing Y N 13 A1BYS N10 C11 doub Y N 14 A1BYS C11 C12 sing Y N 15 A1BYS C12 C13 doub Y N 16 A1BYS C13 C14 sing N N 17 A1BYS C13 N24 sing Y N 18 A1BYS C14 N23 sing Y N 19 A1BYS C14 C15 doub Y N 20 A1BYS C15 N16 sing Y N 21 A1BYS N16 C17 doub Y N 22 A1BYS C17 C18 sing Y N 23 A1BYS C17 N23 sing Y N 24 A1BYS C18 C19 sing N N 25 A1BYS C18 C20 doub Y N 26 A1BYS C20 C21 sing Y N 27 A1BYS C21 C22 doub Y N 28 A1BYS C22 N23 sing Y N 29 A1BYS C25 O26 sing N N 30 A1BYS C25 C28 doub Y N 31 A1BYS O26 C27 sing N N 32 A1BYS C28 C29 sing Y N 33 A1BYS C29 N30 sing N N 34 A1BYS N30 C31 sing N N 35 A1BYS N30 C36 sing N N 36 A1BYS C31 C32 sing N N 37 A1BYS C32 N33 sing N N 38 A1BYS N33 C34 sing N N 39 A1BYS N33 C35 sing N N 40 A1BYS C01 H011 sing N N 41 A1BYS C01 H1 sing N N 42 A1BYS C01 H012 sing N N 43 A1BYS C02 H021 sing N N 44 A1BYS C02 H2 sing N N 45 A1BYS C06 H061 sing N N 46 A1BYS C11 H111 sing N N 47 A1BYS C12 H121 sing N N 48 A1BYS C15 H151 sing N N 49 A1BYS C19 H193 sing N N 50 A1BYS C19 H192 sing N N 51 A1BYS C19 H191 sing N N 52 A1BYS C20 H201 sing N N 53 A1BYS C21 H211 sing N N 54 A1BYS C22 H221 sing N N 55 A1BYS N04 H041 sing N N 56 A1BYS N08 H081 sing N N 57 A1BYS C27 H273 sing N N 58 A1BYS C27 H271 sing N N 59 A1BYS C27 H272 sing N N 60 A1BYS C28 H281 sing N N 61 A1BYS C31 H312 sing N N 62 A1BYS C31 H311 sing N N 63 A1BYS C32 H321 sing N N 64 A1BYS C32 H322 sing N N 65 A1BYS C34 H342 sing N N 66 A1BYS C34 H343 sing N N 67 A1BYS C34 H341 sing N N 68 A1BYS C35 H353 sing N N 69 A1BYS C35 H351 sing N N 70 A1BYS C35 H352 sing N N 71 A1BYS C36 H363 sing N N 72 A1BYS C36 H361 sing N N 73 A1BYS C36 H362 sing N N 74 ALA N CA sing N N 75 ALA N H sing N N 76 ALA N H2 sing N N 77 ALA CA C sing N N 78 ALA CA CB sing N N 79 ALA CA HA sing N N 80 ALA C O doub N N 81 ALA C OXT sing N N 82 ALA CB HB1 sing N N 83 ALA CB HB2 sing N N 84 ALA CB HB3 sing N N 85 ALA OXT HXT sing N N 86 ARG N CA sing N N 87 ARG N H sing N N 88 ARG N H2 sing N N 89 ARG CA C sing N N 90 ARG CA CB sing N N 91 ARG CA HA sing N N 92 ARG C O doub N N 93 ARG C OXT sing N N 94 ARG CB CG sing N N 95 ARG CB HB2 sing N N 96 ARG CB HB3 sing N N 97 ARG CG CD sing N N 98 ARG CG HG2 sing N N 99 ARG CG HG3 sing N N 100 ARG CD NE sing N N 101 ARG CD HD2 sing N N 102 ARG CD HD3 sing N N 103 ARG NE CZ sing N N 104 ARG NE HE sing N N 105 ARG CZ NH1 sing N N 106 ARG CZ NH2 doub N N 107 ARG NH1 HH11 sing N N 108 ARG NH1 HH12 sing N N 109 ARG NH2 HH21 sing N N 110 ARG NH2 HH22 sing N N 111 ARG OXT HXT sing N N 112 ASN N CA sing N N 113 ASN N H sing N N 114 ASN N H2 sing N N 115 ASN CA C sing N N 116 ASN CA CB sing N N 117 ASN CA HA sing N N 118 ASN C O doub N N 119 ASN C OXT sing N N 120 ASN CB CG sing N N 121 ASN CB HB2 sing N N 122 ASN CB HB3 sing N N 123 ASN CG OD1 doub N N 124 ASN CG ND2 sing N N 125 ASN ND2 HD21 sing N N 126 ASN ND2 HD22 sing N N 127 ASN OXT HXT sing N N 128 ASP N CA sing N N 129 ASP N H sing N N 130 ASP N H2 sing N N 131 ASP CA C sing N N 132 ASP CA CB sing N N 133 ASP CA HA sing N N 134 ASP C O doub N N 135 ASP C OXT sing N N 136 ASP CB CG sing N N 137 ASP CB HB2 sing N N 138 ASP CB HB3 sing N N 139 ASP CG OD1 doub N N 140 ASP CG OD2 sing N N 141 ASP OD2 HD2 sing N N 142 ASP OXT HXT sing N N 143 CYS N CA sing N N 144 CYS N H sing N N 145 CYS N H2 sing N N 146 CYS CA C sing N N 147 CYS CA CB sing N N 148 CYS CA HA sing N N 149 CYS C O doub N N 150 CYS C OXT sing N N 151 CYS CB SG sing N N 152 CYS CB HB2 sing N N 153 CYS CB HB3 sing N N 154 CYS SG HG sing N N 155 CYS OXT HXT sing N N 156 GLN N CA sing N N 157 GLN N H sing N N 158 GLN N H2 sing N N 159 GLN CA C sing N N 160 GLN CA CB sing N N 161 GLN CA HA sing N N 162 GLN C O doub N N 163 GLN C OXT sing N N 164 GLN CB CG sing N N 165 GLN CB HB2 sing N N 166 GLN CB HB3 sing N N 167 GLN CG CD sing N N 168 GLN CG HG2 sing N N 169 GLN CG HG3 sing N N 170 GLN CD OE1 doub N N 171 GLN CD NE2 sing N N 172 GLN NE2 HE21 sing N N 173 GLN NE2 HE22 sing N N 174 GLN OXT HXT sing N N 175 GLU N CA sing N N 176 GLU N H sing N N 177 GLU N H2 sing N N 178 GLU CA C sing N N 179 GLU CA CB sing N N 180 GLU CA HA sing N N 181 GLU C O doub N N 182 GLU C OXT sing N N 183 GLU CB CG sing N N 184 GLU CB HB2 sing N N 185 GLU CB HB3 sing N N 186 GLU CG CD sing N N 187 GLU CG HG2 sing N N 188 GLU CG HG3 sing N N 189 GLU CD OE1 doub N N 190 GLU CD OE2 sing N N 191 GLU OE2 HE2 sing N N 192 GLU OXT HXT sing N N 193 GLY N CA sing N N 194 GLY N H sing N N 195 GLY N H2 sing N N 196 GLY CA C sing N N 197 GLY CA HA2 sing N N 198 GLY CA HA3 sing N N 199 GLY C O doub N N 200 GLY C OXT sing N N 201 GLY OXT HXT sing N N 202 HIS N CA sing N N 203 HIS N H sing N N 204 HIS N H2 sing N N 205 HIS CA C sing N N 206 HIS CA CB sing N N 207 HIS CA HA sing N N 208 HIS C O doub N N 209 HIS C OXT sing N N 210 HIS CB CG sing N N 211 HIS CB HB2 sing N N 212 HIS CB HB3 sing N N 213 HIS CG ND1 sing Y N 214 HIS CG CD2 doub Y N 215 HIS ND1 CE1 doub Y N 216 HIS ND1 HD1 sing N N 217 HIS CD2 NE2 sing Y N 218 HIS CD2 HD2 sing N N 219 HIS CE1 NE2 sing Y N 220 HIS CE1 HE1 sing N N 221 HIS NE2 HE2 sing N N 222 HIS OXT HXT sing N N 223 HOH O H1 sing N N 224 HOH O H2 sing N N 225 ILE N CA sing N N 226 ILE N H sing N N 227 ILE N H2 sing N N 228 ILE CA C sing N N 229 ILE CA CB sing N N 230 ILE CA HA sing N N 231 ILE C O doub N N 232 ILE C OXT sing N N 233 ILE CB CG1 sing N N 234 ILE CB CG2 sing N N 235 ILE CB HB sing N N 236 ILE CG1 CD1 sing N N 237 ILE CG1 HG12 sing N N 238 ILE CG1 HG13 sing N N 239 ILE CG2 HG21 sing N N 240 ILE CG2 HG22 sing N N 241 ILE CG2 HG23 sing N N 242 ILE CD1 HD11 sing N N 243 ILE CD1 HD12 sing N N 244 ILE CD1 HD13 sing N N 245 ILE OXT HXT sing N N 246 LEU N CA sing N N 247 LEU N H sing N N 248 LEU N H2 sing N N 249 LEU CA C sing N N 250 LEU CA CB sing N N 251 LEU CA HA sing N N 252 LEU C O doub N N 253 LEU C OXT sing N N 254 LEU CB CG sing N N 255 LEU CB HB2 sing N N 256 LEU CB HB3 sing N N 257 LEU CG CD1 sing N N 258 LEU CG CD2 sing N N 259 LEU CG HG sing N N 260 LEU CD1 HD11 sing N N 261 LEU CD1 HD12 sing N N 262 LEU CD1 HD13 sing N N 263 LEU CD2 HD21 sing N N 264 LEU CD2 HD22 sing N N 265 LEU CD2 HD23 sing N N 266 LEU OXT HXT sing N N 267 LYS N CA sing N N 268 LYS N H sing N N 269 LYS N H2 sing N N 270 LYS CA C sing N N 271 LYS CA CB sing N N 272 LYS CA HA sing N N 273 LYS C O doub N N 274 LYS C OXT sing N N 275 LYS CB CG sing N N 276 LYS CB HB2 sing N N 277 LYS CB HB3 sing N N 278 LYS CG CD sing N N 279 LYS CG HG2 sing N N 280 LYS CG HG3 sing N N 281 LYS CD CE sing N N 282 LYS CD HD2 sing N N 283 LYS CD HD3 sing N N 284 LYS CE NZ sing N N 285 LYS CE HE2 sing N N 286 LYS CE HE3 sing N N 287 LYS NZ HZ1 sing N N 288 LYS NZ HZ2 sing N N 289 LYS NZ HZ3 sing N N 290 LYS OXT HXT sing N N 291 MET N CA sing N N 292 MET N H sing N N 293 MET N H2 sing N N 294 MET CA C sing N N 295 MET CA CB sing N N 296 MET CA HA sing N N 297 MET C O doub N N 298 MET C OXT sing N N 299 MET CB CG sing N N 300 MET CB HB2 sing N N 301 MET CB HB3 sing N N 302 MET CG SD sing N N 303 MET CG HG2 sing N N 304 MET CG HG3 sing N N 305 MET SD CE sing N N 306 MET CE HE1 sing N N 307 MET CE HE2 sing N N 308 MET CE HE3 sing N N 309 MET OXT HXT sing N N 310 PHE N CA sing N N 311 PHE N H sing N N 312 PHE N H2 sing N N 313 PHE CA C sing N N 314 PHE CA CB sing N N 315 PHE CA HA sing N N 316 PHE C O doub N N 317 PHE C OXT sing N N 318 PHE CB CG sing N N 319 PHE CB HB2 sing N N 320 PHE CB HB3 sing N N 321 PHE CG CD1 doub Y N 322 PHE CG CD2 sing Y N 323 PHE CD1 CE1 sing Y N 324 PHE CD1 HD1 sing N N 325 PHE CD2 CE2 doub Y N 326 PHE CD2 HD2 sing N N 327 PHE CE1 CZ doub Y N 328 PHE CE1 HE1 sing N N 329 PHE CE2 CZ sing Y N 330 PHE CE2 HE2 sing N N 331 PHE CZ HZ sing N N 332 PHE OXT HXT sing N N 333 PRO N CA sing N N 334 PRO N CD sing N N 335 PRO N H sing N N 336 PRO CA C sing N N 337 PRO CA CB sing N N 338 PRO CA HA sing N N 339 PRO C O doub N N 340 PRO C OXT sing N N 341 PRO CB CG sing N N 342 PRO CB HB2 sing N N 343 PRO CB HB3 sing N N 344 PRO CG CD sing N N 345 PRO CG HG2 sing N N 346 PRO CG HG3 sing N N 347 PRO CD HD2 sing N N 348 PRO CD HD3 sing N N 349 PRO OXT HXT sing N N 350 SER N CA sing N N 351 SER N H sing N N 352 SER N H2 sing N N 353 SER CA C sing N N 354 SER CA CB sing N N 355 SER CA HA sing N N 356 SER C O doub N N 357 SER C OXT sing N N 358 SER CB OG sing N N 359 SER CB HB2 sing N N 360 SER CB HB3 sing N N 361 SER OG HG sing N N 362 SER OXT HXT sing N N 363 THR N CA sing N N 364 THR N H sing N N 365 THR N H2 sing N N 366 THR CA C sing N N 367 THR CA CB sing N N 368 THR CA HA sing N N 369 THR C O doub N N 370 THR C OXT sing N N 371 THR CB OG1 sing N N 372 THR CB CG2 sing N N 373 THR CB HB sing N N 374 THR OG1 HG1 sing N N 375 THR CG2 HG21 sing N N 376 THR CG2 HG22 sing N N 377 THR CG2 HG23 sing N N 378 THR OXT HXT sing N N 379 TRP N CA sing N N 380 TRP N H sing N N 381 TRP N H2 sing N N 382 TRP CA C sing N N 383 TRP CA CB sing N N 384 TRP CA HA sing N N 385 TRP C O doub N N 386 TRP C OXT sing N N 387 TRP CB CG sing N N 388 TRP CB HB2 sing N N 389 TRP CB HB3 sing N N 390 TRP CG CD1 doub Y N 391 TRP CG CD2 sing Y N 392 TRP CD1 NE1 sing Y N 393 TRP CD1 HD1 sing N N 394 TRP CD2 CE2 doub Y N 395 TRP CD2 CE3 sing Y N 396 TRP NE1 CE2 sing Y N 397 TRP NE1 HE1 sing N N 398 TRP CE2 CZ2 sing Y N 399 TRP CE3 CZ3 doub Y N 400 TRP CE3 HE3 sing N N 401 TRP CZ2 CH2 doub Y N 402 TRP CZ2 HZ2 sing N N 403 TRP CZ3 CH2 sing Y N 404 TRP CZ3 HZ3 sing N N 405 TRP CH2 HH2 sing N N 406 TRP OXT HXT sing N N 407 TYR N CA sing N N 408 TYR N H sing N N 409 TYR N H2 sing N N 410 TYR CA C sing N N 411 TYR CA CB sing N N 412 TYR CA HA sing N N 413 TYR C O doub N N 414 TYR C OXT sing N N 415 TYR CB CG sing N N 416 TYR CB HB2 sing N N 417 TYR CB HB3 sing N N 418 TYR CG CD1 doub Y N 419 TYR CG CD2 sing Y N 420 TYR CD1 CE1 sing Y N 421 TYR CD1 HD1 sing N N 422 TYR CD2 CE2 doub Y N 423 TYR CD2 HD2 sing N N 424 TYR CE1 CZ doub Y N 425 TYR CE1 HE1 sing N N 426 TYR CE2 CZ sing Y N 427 TYR CE2 HE2 sing N N 428 TYR CZ OH sing N N 429 TYR OH HH sing N N 430 TYR OXT HXT sing N N 431 VAL N CA sing N N 432 VAL N H sing N N 433 VAL N H2 sing N N 434 VAL CA C sing N N 435 VAL CA CB sing N N 436 VAL CA HA sing N N 437 VAL C O doub N N 438 VAL C OXT sing N N 439 VAL CB CG1 sing N N 440 VAL CB CG2 sing N N 441 VAL CB HB sing N N 442 VAL CG1 HG11 sing N N 443 VAL CG1 HG12 sing N N 444 VAL CG1 HG13 sing N N 445 VAL CG2 HG21 sing N N 446 VAL CG2 HG22 sing N N 447 VAL CG2 HG23 sing N N 448 VAL OXT HXT sing N N 449 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R35 GM155353' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2GS2 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 2 3' _space_group.name_Hall 'I 2 2 3' _space_group.IT_number 197 _space_group.crystal_system cubic _space_group.id 1 # _atom_sites.entry_id 9NJN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.006856 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006856 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006856 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #