data_9NVH # _entry.id 9NVH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9NVH pdb_00009nvh 10.2210/pdb9nvh/pdb WWPDB D_1000294342 ? ? BMRB 31235 ? 10.13018/BMR31235 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-14 ? 2 'Structure model' 1 1 2025-05-21 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9NVH _pdbx_database_status.recvd_initial_deposition_date 2025-03-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of conotoxin k-SrXIA' _pdbx_database_related.db_id 31235 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email federico.delrio@gmail.com _pdbx_contact_author.name_first Federico _pdbx_contact_author.name_last 'del Rio Portilla' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8672-0567 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Melchor-Meneses, C.M.' 1 0000-0002-1249-3231 'del Rio-Portilla, F.' 2 0000-0001-8672-0567 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Toxicon _citation.journal_id_ASTM TOXIA6 _citation.journal_id_CSD 2043 _citation.journal_id_ISSN 0041-0101 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 262 _citation.language ? _citation.page_first 108384 _citation.page_last 108384 _citation.title 'Block of Kv1 potassium channels and NMR structure of recombinant conotoxin kappa-SrXIA.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.toxicon.2025.108384 _citation.pdbx_database_id_PubMed 40324600 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Escobar, L.I.' 1 ? primary 'Quezada Suaste, C.D.' 2 ? primary 'Salvador, C.' 3 ? primary 'Aparicio, D.L.' 4 ? primary 'Melchor-Meneses, C.M.' 5 ? primary 'Bravo-Martinez, J.' 6 ? primary 'de la Rosa, V.' 7 ? primary 'Lopez-Gonzalez, Z.' 8 ? primary 'Del Rio-Portilla, F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Kappa-conotoxin SrXIA' _entity.formula_weight 3865.345 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kappa-SrXIA,I2-superfamily conotoxin sr11a' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGSCRTEGMSCEENQQCCWRSCCRGECEAPCRFGP _entity_poly.pdbx_seq_one_letter_code_can GGSCRTEGMSCEENQQCCWRSCCRGECEAPCRFGP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 SER n 1 4 CYS n 1 5 ARG n 1 6 THR n 1 7 GLU n 1 8 GLY n 1 9 MET n 1 10 SER n 1 11 CYS n 1 12 GLU n 1 13 GLU n 1 14 ASN n 1 15 GLN n 1 16 GLN n 1 17 CYS n 1 18 CYS n 1 19 TRP n 1 20 ARG n 1 21 SER n 1 22 CYS n 1 23 CYS n 1 24 ARG n 1 25 GLY n 1 26 GLU n 1 27 CYS n 1 28 GLU n 1 29 ALA n 1 30 PRO n 1 31 CYS n 1 32 ARG n 1 33 PHE n 1 34 GLY n 1 35 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 35 _entity_src_gen.gene_src_common_name 'Alphabet cone' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Conus spurius' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 192919 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PRO 35 35 35 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9NVH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9NVH _struct.title 'NMR structure of conotoxin k-SrXIA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9NVH _struct_keywords.text 'Conotoxin, ion channel, Potassium, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I2BA_CONSP _struct_ref.pdbx_db_accession P0C615 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CRTEGMSCEENQQCCWRSCCRGECEAPCRFGP _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9NVH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0C615 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 32 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 35 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9NVH GLY A 1 ? UNP P0C615 ? ? 'expression tag' 1 1 1 9NVH GLY A 2 ? UNP P0C615 ? ? 'expression tag' 2 2 1 9NVH SER A 3 ? UNP P0C615 ? ? 'expression tag' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 4 A CYS 18 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 11 A CYS 23 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 17 A CYS 27 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf4 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 22 A CYS 31 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 18 ? CYS A 4 ? 1_555 CYS A 18 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 11 ? CYS A 23 ? CYS A 11 ? 1_555 CYS A 23 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 17 ? CYS A 27 ? CYS A 17 ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 22 ? CYS A 31 ? CYS A 22 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9NVH _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 124.29 120.30 3.99 0.50 N 2 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.59 120.30 3.29 0.50 N 3 1 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.37 120.30 3.07 0.50 N 4 1 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH2 A ARG 32 ? ? 117.29 120.30 -3.01 0.50 N 5 2 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.37 120.30 3.07 0.50 N 6 3 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.87 120.30 3.57 0.50 N 7 3 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.01 120.30 3.71 0.50 N 8 4 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.92 120.30 3.62 0.50 N 9 4 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.44 120.30 3.14 0.50 N 10 5 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.92 120.30 3.62 0.50 N 11 5 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 124.67 120.30 4.37 0.50 N 12 5 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.12 120.30 3.82 0.50 N 13 6 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.36 120.30 4.06 0.50 N 14 6 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.39 120.30 3.09 0.50 N 15 6 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.78 120.30 3.48 0.50 N 16 7 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.83 120.30 3.53 0.50 N 17 8 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.65 120.30 3.35 0.50 N 18 8 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.43 120.30 4.13 0.50 N 19 9 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.14 120.30 3.84 0.50 N 20 9 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.77 120.30 3.47 0.50 N 21 10 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.60 120.30 3.30 0.50 N 22 11 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 124.17 120.30 3.87 0.50 N 23 11 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.94 120.30 3.64 0.50 N 24 12 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.43 120.30 3.13 0.50 N 25 12 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.47 120.30 3.17 0.50 N 26 13 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 124.12 120.30 3.82 0.50 N 27 14 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 124.22 120.30 3.92 0.50 N 28 14 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 123.38 120.30 3.08 0.50 N 29 15 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.65 120.30 3.35 0.50 N 30 15 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.47 120.30 3.17 0.50 N 31 15 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.83 120.30 4.53 0.50 N 32 16 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.68 120.30 3.38 0.50 N 33 17 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.24 120.30 3.94 0.50 N 34 17 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.44 120.30 3.14 0.50 N 35 18 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.84 120.30 3.54 0.50 N 36 19 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.42 120.30 3.12 0.50 N 37 19 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.85 120.30 3.55 0.50 N 38 20 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 124.51 120.30 4.21 0.50 N 39 20 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.73 120.30 3.43 0.50 N 40 20 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.72 120.30 4.42 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 31 ? ? -83.41 39.52 2 3 GLU A 13 ? ? 179.15 179.09 3 3 CYS A 31 ? ? -155.45 36.94 4 3 ARG A 32 ? ? -88.26 38.57 5 4 ARG A 24 ? ? -105.24 49.15 6 4 GLU A 28 ? ? -139.03 -152.62 7 4 ALA A 29 ? ? -139.64 -44.92 8 5 CYS A 31 ? ? -73.65 43.50 9 6 CYS A 31 ? ? -81.30 34.72 10 7 ARG A 24 ? ? -140.53 21.21 11 8 ARG A 32 ? ? -79.88 49.29 12 9 ASN A 14 ? ? -38.45 -38.44 13 11 GLU A 12 ? ? -141.58 -10.46 14 15 ARG A 32 ? ? -74.39 35.49 15 18 CYS A 22 ? ? -37.97 135.56 16 18 ARG A 32 ? ? -85.25 45.33 17 19 ARG A 32 ? ? -70.24 25.38 18 20 ARG A 24 ? ? -143.24 43.63 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 16 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 20 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.081 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 9NVH _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9NVH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM Conotoxin k-SrXIA, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 1_Sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Conotoxin k-SrXIA' _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Sample_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 2D-TOCSY 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 9NVH _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'used also for simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, and Kollman' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'peak picking' CARA ? 'Keller and Wuthrich' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 MET N N N N 121 MET CA C N S 122 MET C C N N 123 MET O O N N 124 MET CB C N N 125 MET CG C N N 126 MET SD S N N 127 MET CE C N N 128 MET OXT O N N 129 MET H H N N 130 MET H2 H N N 131 MET HA H N N 132 MET HB2 H N N 133 MET HB3 H N N 134 MET HG2 H N N 135 MET HG3 H N N 136 MET HE1 H N N 137 MET HE2 H N N 138 MET HE3 H N N 139 MET HXT H N N 140 PHE N N N N 141 PHE CA C N S 142 PHE C C N N 143 PHE O O N N 144 PHE CB C N N 145 PHE CG C Y N 146 PHE CD1 C Y N 147 PHE CD2 C Y N 148 PHE CE1 C Y N 149 PHE CE2 C Y N 150 PHE CZ C Y N 151 PHE OXT O N N 152 PHE H H N N 153 PHE H2 H N N 154 PHE HA H N N 155 PHE HB2 H N N 156 PHE HB3 H N N 157 PHE HD1 H N N 158 PHE HD2 H N N 159 PHE HE1 H N N 160 PHE HE2 H N N 161 PHE HZ H N N 162 PHE HXT H N N 163 PRO N N N N 164 PRO CA C N S 165 PRO C C N N 166 PRO O O N N 167 PRO CB C N N 168 PRO CG C N N 169 PRO CD C N N 170 PRO OXT O N N 171 PRO H H N N 172 PRO HA H N N 173 PRO HB2 H N N 174 PRO HB3 H N N 175 PRO HG2 H N N 176 PRO HG3 H N N 177 PRO HD2 H N N 178 PRO HD3 H N N 179 PRO HXT H N N 180 SER N N N N 181 SER CA C N S 182 SER C C N N 183 SER O O N N 184 SER CB C N N 185 SER OG O N N 186 SER OXT O N N 187 SER H H N N 188 SER H2 H N N 189 SER HA H N N 190 SER HB2 H N N 191 SER HB3 H N N 192 SER HG H N N 193 SER HXT H N N 194 THR N N N N 195 THR CA C N S 196 THR C C N N 197 THR O O N N 198 THR CB C N R 199 THR OG1 O N N 200 THR CG2 C N N 201 THR OXT O N N 202 THR H H N N 203 THR H2 H N N 204 THR HA H N N 205 THR HB H N N 206 THR HG1 H N N 207 THR HG21 H N N 208 THR HG22 H N N 209 THR HG23 H N N 210 THR HXT H N N 211 TRP N N N N 212 TRP CA C N S 213 TRP C C N N 214 TRP O O N N 215 TRP CB C N N 216 TRP CG C Y N 217 TRP CD1 C Y N 218 TRP CD2 C Y N 219 TRP NE1 N Y N 220 TRP CE2 C Y N 221 TRP CE3 C Y N 222 TRP CZ2 C Y N 223 TRP CZ3 C Y N 224 TRP CH2 C Y N 225 TRP OXT O N N 226 TRP H H N N 227 TRP H2 H N N 228 TRP HA H N N 229 TRP HB2 H N N 230 TRP HB3 H N N 231 TRP HD1 H N N 232 TRP HE1 H N N 233 TRP HE3 H N N 234 TRP HZ2 H N N 235 TRP HZ3 H N N 236 TRP HH2 H N N 237 TRP HXT H N N 238 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 MET N CA sing N N 114 MET N H sing N N 115 MET N H2 sing N N 116 MET CA C sing N N 117 MET CA CB sing N N 118 MET CA HA sing N N 119 MET C O doub N N 120 MET C OXT sing N N 121 MET CB CG sing N N 122 MET CB HB2 sing N N 123 MET CB HB3 sing N N 124 MET CG SD sing N N 125 MET CG HG2 sing N N 126 MET CG HG3 sing N N 127 MET SD CE sing N N 128 MET CE HE1 sing N N 129 MET CE HE2 sing N N 130 MET CE HE3 sing N N 131 MET OXT HXT sing N N 132 PHE N CA sing N N 133 PHE N H sing N N 134 PHE N H2 sing N N 135 PHE CA C sing N N 136 PHE CA CB sing N N 137 PHE CA HA sing N N 138 PHE C O doub N N 139 PHE C OXT sing N N 140 PHE CB CG sing N N 141 PHE CB HB2 sing N N 142 PHE CB HB3 sing N N 143 PHE CG CD1 doub Y N 144 PHE CG CD2 sing Y N 145 PHE CD1 CE1 sing Y N 146 PHE CD1 HD1 sing N N 147 PHE CD2 CE2 doub Y N 148 PHE CD2 HD2 sing N N 149 PHE CE1 CZ doub Y N 150 PHE CE1 HE1 sing N N 151 PHE CE2 CZ sing Y N 152 PHE CE2 HE2 sing N N 153 PHE CZ HZ sing N N 154 PHE OXT HXT sing N N 155 PRO N CA sing N N 156 PRO N CD sing N N 157 PRO N H sing N N 158 PRO CA C sing N N 159 PRO CA CB sing N N 160 PRO CA HA sing N N 161 PRO C O doub N N 162 PRO C OXT sing N N 163 PRO CB CG sing N N 164 PRO CB HB2 sing N N 165 PRO CB HB3 sing N N 166 PRO CG CD sing N N 167 PRO CG HG2 sing N N 168 PRO CG HG3 sing N N 169 PRO CD HD2 sing N N 170 PRO CD HD3 sing N N 171 PRO OXT HXT sing N N 172 SER N CA sing N N 173 SER N H sing N N 174 SER N H2 sing N N 175 SER CA C sing N N 176 SER CA CB sing N N 177 SER CA HA sing N N 178 SER C O doub N N 179 SER C OXT sing N N 180 SER CB OG sing N N 181 SER CB HB2 sing N N 182 SER CB HB3 sing N N 183 SER OG HG sing N N 184 SER OXT HXT sing N N 185 THR N CA sing N N 186 THR N H sing N N 187 THR N H2 sing N N 188 THR CA C sing N N 189 THR CA CB sing N N 190 THR CA HA sing N N 191 THR C O doub N N 192 THR C OXT sing N N 193 THR CB OG1 sing N N 194 THR CB CG2 sing N N 195 THR CB HB sing N N 196 THR OG1 HG1 sing N N 197 THR CG2 HG21 sing N N 198 THR CG2 HG22 sing N N 199 THR CG2 HG23 sing N N 200 THR OXT HXT sing N N 201 TRP N CA sing N N 202 TRP N H sing N N 203 TRP N H2 sing N N 204 TRP CA C sing N N 205 TRP CA CB sing N N 206 TRP CA HA sing N N 207 TRP C O doub N N 208 TRP C OXT sing N N 209 TRP CB CG sing N N 210 TRP CB HB2 sing N N 211 TRP CB HB3 sing N N 212 TRP CG CD1 doub Y N 213 TRP CG CD2 sing Y N 214 TRP CD1 NE1 sing Y N 215 TRP CD1 HD1 sing N N 216 TRP CD2 CE2 doub Y N 217 TRP CD2 CE3 sing Y N 218 TRP NE1 CE2 sing Y N 219 TRP NE1 HE1 sing N N 220 TRP CE2 CZ2 sing Y N 221 TRP CE3 CZ3 doub Y N 222 TRP CE3 HE3 sing N N 223 TRP CZ2 CH2 doub Y N 224 TRP CZ2 HZ2 sing N N 225 TRP CZ3 CH2 sing Y N 226 TRP CZ3 HZ3 sing N N 227 TRP CH2 HH2 sing N N 228 TRP OXT HXT sing N N 229 # _pdbx_audit_support.funding_organization 'Programa de Apoyo a Proyectos de Investigacion e Innovacion Tecnologica (PAPIIT)' _pdbx_audit_support.country Mexico _pdbx_audit_support.grant_number IN214722 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9NVH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018263 _atom_sites.fract_transf_matrix[1][2] 0.006457 _atom_sites.fract_transf_matrix[1][3] 0.011182 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019371 _atom_sites.fract_transf_matrix[2][3] 0.011182 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022367 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #