data_9OFT # _entry.id 9OFT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9OFT pdb_00009oft 10.2210/pdb9oft/pdb WWPDB D_1000295475 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-08 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9OFT _pdbx_database_status.recvd_initial_deposition_date 2025-04-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email thollis@wakehealth.edu _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Hollis _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4996-6346 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hollis, T.J.' 1 0000-0002-4996-6346 'Nichols, S.L.' 2 0000-0003-2290-947X 'Esstman, S.M.' 3 0000-0002-4004-7343 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biomol.Struct.Dyn. _citation.journal_id_ASTM JBSDD6 _citation.journal_id_CSD 0646 _citation.journal_id_ISSN 1538-0254 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first 1 _citation.page_last 17 _citation.title 'K294E change in the rotavirus factory forming protein NSP2 stabilizes a rare C-terminal conformation.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1080/07391102.2025.2563689 _citation.pdbx_database_id_PubMed 40999894 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nichols, S.L.' 1 ? primary 'Hollis, T.' 2 ? primary 'Salsbury, F.R.' 3 ? primary 'Esstman, S.M.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Non-structural protein 2' 36234.820 1 3.6.4.- ? ? ? 2 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NSP2,NCVP3,Non-structural RNA-binding protein 35,NS35' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAELACFCYPHLENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKV AMLICEALNSLKVTQANVSNVLSRVVSIRHLENLVIRKENPQDILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQ NAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKPISDVHVKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADR VYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQKMKPEKNPFKGLSTDRKMDEVS ; _entity_poly.pdbx_seq_one_letter_code_can ;MAELACFCYPHLENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKV AMLICEALNSLKVTQANVSNVLSRVVSIRHLENLVIRKENPQDILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQ NAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKPISDVHVKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADR VYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQKMKPEKNPFKGLSTDRKMDEVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 LEU n 1 5 ALA n 1 6 CYS n 1 7 PHE n 1 8 CYS n 1 9 TYR n 1 10 PRO n 1 11 HIS n 1 12 LEU n 1 13 GLU n 1 14 ASN n 1 15 ASP n 1 16 SER n 1 17 TYR n 1 18 LYS n 1 19 PHE n 1 20 ILE n 1 21 PRO n 1 22 PHE n 1 23 ASN n 1 24 ASN n 1 25 LEU n 1 26 ALA n 1 27 ILE n 1 28 LYS n 1 29 ALA n 1 30 MET n 1 31 LEU n 1 32 THR n 1 33 ALA n 1 34 LYS n 1 35 VAL n 1 36 ASP n 1 37 LYS n 1 38 LYS n 1 39 ASP n 1 40 MET n 1 41 ASP n 1 42 LYS n 1 43 PHE n 1 44 TYR n 1 45 ASP n 1 46 SER n 1 47 ILE n 1 48 ILE n 1 49 TYR n 1 50 GLY n 1 51 ILE n 1 52 ALA n 1 53 PRO n 1 54 PRO n 1 55 PRO n 1 56 GLN n 1 57 PHE n 1 58 LYS n 1 59 LYS n 1 60 ARG n 1 61 TYR n 1 62 ASN n 1 63 THR n 1 64 ASN n 1 65 ASP n 1 66 ASN n 1 67 SER n 1 68 ARG n 1 69 GLY n 1 70 MET n 1 71 ASN n 1 72 PHE n 1 73 GLU n 1 74 THR n 1 75 ILE n 1 76 MET n 1 77 PHE n 1 78 THR n 1 79 LYS n 1 80 VAL n 1 81 ALA n 1 82 MET n 1 83 LEU n 1 84 ILE n 1 85 CYS n 1 86 GLU n 1 87 ALA n 1 88 LEU n 1 89 ASN n 1 90 SER n 1 91 LEU n 1 92 LYS n 1 93 VAL n 1 94 THR n 1 95 GLN n 1 96 ALA n 1 97 ASN n 1 98 VAL n 1 99 SER n 1 100 ASN n 1 101 VAL n 1 102 LEU n 1 103 SER n 1 104 ARG n 1 105 VAL n 1 106 VAL n 1 107 SER n 1 108 ILE n 1 109 ARG n 1 110 HIS n 1 111 LEU n 1 112 GLU n 1 113 ASN n 1 114 LEU n 1 115 VAL n 1 116 ILE n 1 117 ARG n 1 118 LYS n 1 119 GLU n 1 120 ASN n 1 121 PRO n 1 122 GLN n 1 123 ASP n 1 124 ILE n 1 125 LEU n 1 126 PHE n 1 127 HIS n 1 128 SER n 1 129 LYS n 1 130 ASP n 1 131 LEU n 1 132 LEU n 1 133 LEU n 1 134 LYS n 1 135 SER n 1 136 THR n 1 137 LEU n 1 138 ILE n 1 139 ALA n 1 140 ILE n 1 141 GLY n 1 142 GLN n 1 143 SER n 1 144 LYS n 1 145 GLU n 1 146 ILE n 1 147 GLU n 1 148 THR n 1 149 THR n 1 150 ILE n 1 151 THR n 1 152 ALA n 1 153 GLU n 1 154 GLY n 1 155 GLY n 1 156 GLU n 1 157 ILE n 1 158 VAL n 1 159 PHE n 1 160 GLN n 1 161 ASN n 1 162 ALA n 1 163 ALA n 1 164 PHE n 1 165 THR n 1 166 MET n 1 167 TRP n 1 168 LYS n 1 169 LEU n 1 170 THR n 1 171 TYR n 1 172 LEU n 1 173 GLU n 1 174 HIS n 1 175 GLN n 1 176 LEU n 1 177 MET n 1 178 PRO n 1 179 ILE n 1 180 LEU n 1 181 ASP n 1 182 GLN n 1 183 ASN n 1 184 PHE n 1 185 ILE n 1 186 GLU n 1 187 TYR n 1 188 LYS n 1 189 VAL n 1 190 THR n 1 191 LEU n 1 192 ASN n 1 193 GLU n 1 194 ASP n 1 195 LYS n 1 196 PRO n 1 197 ILE n 1 198 SER n 1 199 ASP n 1 200 VAL n 1 201 HIS n 1 202 VAL n 1 203 LYS n 1 204 GLU n 1 205 LEU n 1 206 VAL n 1 207 ALA n 1 208 GLU n 1 209 LEU n 1 210 ARG n 1 211 TRP n 1 212 GLN n 1 213 TYR n 1 214 ASN n 1 215 LYS n 1 216 PHE n 1 217 ALA n 1 218 VAL n 1 219 ILE n 1 220 THR n 1 221 HIS n 1 222 GLY n 1 223 LYS n 1 224 GLY n 1 225 HIS n 1 226 TYR n 1 227 ARG n 1 228 ILE n 1 229 VAL n 1 230 LYS n 1 231 TYR n 1 232 SER n 1 233 SER n 1 234 VAL n 1 235 ALA n 1 236 ASN n 1 237 HIS n 1 238 ALA n 1 239 ASP n 1 240 ARG n 1 241 VAL n 1 242 TYR n 1 243 ALA n 1 244 THR n 1 245 PHE n 1 246 LYS n 1 247 SER n 1 248 ASN n 1 249 VAL n 1 250 LYS n 1 251 THR n 1 252 GLY n 1 253 VAL n 1 254 ASN n 1 255 ASN n 1 256 ASP n 1 257 PHE n 1 258 ASN n 1 259 LEU n 1 260 LEU n 1 261 ASP n 1 262 GLN n 1 263 ARG n 1 264 ILE n 1 265 ILE n 1 266 TRP n 1 267 GLN n 1 268 ASN n 1 269 TRP n 1 270 TYR n 1 271 ALA n 1 272 PHE n 1 273 THR n 1 274 SER n 1 275 SER n 1 276 MET n 1 277 LYS n 1 278 GLN n 1 279 GLY n 1 280 ASN n 1 281 THR n 1 282 LEU n 1 283 ASP n 1 284 VAL n 1 285 CYS n 1 286 LYS n 1 287 ARG n 1 288 LEU n 1 289 LEU n 1 290 PHE n 1 291 GLN n 1 292 LYS n 1 293 MET n 1 294 LYS n 1 295 PRO n 1 296 GLU n 1 297 LYS n 1 298 ASN n 1 299 PRO n 1 300 PHE n 1 301 LYS n 1 302 GLY n 1 303 LEU n 1 304 SER n 1 305 THR n 1 306 ASP n 1 307 ARG n 1 308 LYS n 1 309 MET n 1 310 ASP n 1 311 GLU n 1 312 VAL n 1 313 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 313 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NSP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain SA11 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rotavirus A' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28875 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 TRP 167 167 167 TRP TRP A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 MET 177 177 177 MET MET A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 HIS 201 201 201 HIS HIS A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 TRP 211 211 211 TRP TRP A . n A 1 212 GLN 212 212 212 GLN GLN A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 ASN 214 214 214 ASN ASN A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 PHE 216 216 216 PHE PHE A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 HIS 221 221 221 HIS HIS A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 LYS 223 223 223 LYS LYS A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 HIS 225 225 225 HIS HIS A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 TYR 231 231 231 TYR TYR A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 ASN 236 236 236 ASN ASN A . n A 1 237 HIS 237 237 237 HIS HIS A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 ARG 240 240 240 ARG ARG A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 THR 244 244 244 THR THR A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 ASN 248 248 248 ASN ASN A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LYS 250 250 250 LYS LYS A . n A 1 251 THR 251 251 251 THR THR A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 ASN 255 255 255 ASN ASN A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 GLN 262 262 262 GLN GLN A . n A 1 263 ARG 263 263 263 ARG ARG A . n A 1 264 ILE 264 264 264 ILE ILE A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 TRP 266 266 266 TRP TRP A . n A 1 267 GLN 267 267 267 GLN GLN A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 TRP 269 269 269 TRP TRP A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 PHE 272 272 272 PHE PHE A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 MET 276 276 276 MET MET A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 GLN 278 278 278 GLN GLN A . n A 1 279 GLY 279 279 279 GLY GLY A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 THR 281 281 281 THR THR A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 VAL 284 284 284 VAL VAL A . n A 1 285 CYS 285 285 285 CYS CYS A . n A 1 286 LYS 286 286 286 LYS LYS A . n A 1 287 ARG 287 287 287 ARG ARG A . n A 1 288 LEU 288 288 288 LEU LEU A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 PHE 290 290 290 PHE PHE A . n A 1 291 GLN 291 291 291 GLN GLN A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 MET 293 293 293 MET MET A . n A 1 294 LYS 294 294 294 LYS LYS A . n A 1 295 PRO 295 295 295 PRO PRO A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 ASN 298 298 298 ASN ASN A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 PHE 300 300 300 PHE PHE A . n A 1 301 LYS 301 301 301 LYS LYS A . n A 1 302 GLY 302 302 302 GLY GLY A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 SER 304 304 304 SER SER A . n A 1 305 THR 305 305 305 THR THR A . n A 1 306 ASP 306 306 306 ASP ASP A . n A 1 307 ARG 307 307 307 ARG ARG A . n A 1 308 LYS 308 308 308 LYS LYS A . n A 1 309 MET 309 309 309 MET MET A . n A 1 310 ASP 310 310 310 ASP ASP A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 VAL 312 312 312 VAL VAL A . n A 1 313 SER 313 313 313 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 1 HOH HOH A . B 2 HOH 2 402 3 HOH HOH A . B 2 HOH 3 403 5 HOH HOH A . B 2 HOH 4 404 2 HOH HOH A . B 2 HOH 5 405 6 HOH HOH A . B 2 HOH 6 406 4 HOH HOH A . B 2 HOH 7 407 7 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 1.20.1_4487 ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9OFT _cell.details ? _cell.formula_units_Z ? _cell.length_a 108.673 _cell.length_a_esd ? _cell.length_b 108.673 _cell.length_b_esd ? _cell.length_c 153.416 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9OFT _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9OFT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Tris-HCl pH 7.5, 0.2M MgAc, 12% PEG6K' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'VariMax HF' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-04-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9OFT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.95 _reflns.d_resolution_low 35.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10045 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.113 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.179 _reflns.pdbx_Rpim_I_all 0.051 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 121329 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.172 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.95 3.04 ? ? ? ? ? ? 822 ? ? ? ? ? ? ? ? ? ? ? 13.3 1.061 ? ? 0.625 0.170 ? 1 1 0.934 0.983 ? 100.0 ? 0.601 ? ? ? ? ? ? ? ? ? 3.04 3.13 ? ? ? ? ? ? 822 ? ? ? ? ? ? ? ? ? ? ? 13.3 0.980 ? ? 0.605 0.164 ? 2 1 0.958 0.989 ? 100.0 ? 0.582 ? ? ? ? ? ? ? ? ? 3.13 3.25 ? ? ? ? ? ? 806 ? ? ? ? ? ? ? ? ? ? ? 13.2 0.968 ? ? 0.414 0.113 ? 3 1 0.972 0.993 ? 100.0 ? 0.398 ? ? ? ? ? ? ? ? ? 3.25 3.38 ? ? ? ? ? ? 821 ? ? ? ? ? ? ? ? ? ? ? 13.0 1.280 ? ? 0.326 0.090 ? 4 1 0.979 0.995 ? 100.0 ? 0.313 ? ? ? ? ? ? ? ? ? 3.38 3.53 ? ? ? ? ? ? 821 ? ? ? ? ? ? ? ? ? ? ? 13.0 1.109 ? ? 0.222 0.061 ? 5 1 0.991 0.998 ? 100.0 ? 0.213 ? ? ? ? ? ? ? ? ? 3.53 3.72 ? ? ? ? ? ? 820 ? ? ? ? ? ? ? ? ? ? ? 13.0 1.181 ? ? 0.177 0.049 ? 6 1 0.993 0.998 ? 100.0 ? 0.170 ? ? ? ? ? ? ? ? ? 3.72 3.95 ? ? ? ? ? ? 824 ? ? ? ? ? ? ? ? ? ? ? 12.7 1.168 ? ? 0.181 0.050 ? 7 1 0.992 0.998 ? 100.0 ? 0.173 ? ? ? ? ? ? ? ? ? 3.95 4.25 ? ? ? ? ? ? 832 ? ? ? ? ? ? ? ? ? ? ? 12.4 1.168 ? ? 0.163 0.046 ? 8 1 0.994 0.999 ? 100.0 ? 0.156 ? ? ? ? ? ? ? ? ? 4.25 4.68 ? ? ? ? ? ? 845 ? ? ? ? ? ? ? ? ? ? ? 11.7 1.214 ? ? 0.149 0.043 ? 9 1 0.993 0.998 ? 100.0 ? 0.143 ? ? ? ? ? ? ? ? ? 4.68 5.36 ? ? ? ? ? ? 843 ? ? ? ? ? ? ? ? ? ? ? 10.1 1.093 ? ? 0.114 0.036 ? 10 1 0.995 0.999 ? 99.9 ? 0.108 ? ? ? ? ? ? ? ? ? 5.36 6.74 ? ? ? ? ? ? 870 ? ? ? ? ? ? ? ? ? ? ? 10.0 1.077 ? ? 0.114 0.035 ? 11 1 0.996 0.999 ? 99.9 ? 0.109 ? ? ? ? ? ? ? ? ? 6.74 35.00 ? ? ? ? ? ? 919 ? ? ? ? ? ? ? ? ? ? ? 9.7 1.051 ? ? 0.063 0.019 ? 12 1 0.998 1.000 ? 100.0 ? 0.059 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.73 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.73 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.47 _refine.B_iso_max ? _refine.B_iso_mean 47.251 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.911 _refine.correlation_coeff_Fo_to_Fc_free 0.883 _refine.details ;U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : RESIDUAL ONLY ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9OFT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.95 _refine.ls_d_res_low 34.39 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8873 _refine.ls_number_reflns_R_free 1001 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.18 _refine.ls_percent_reflns_R_free 10.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23186 _refine.ls_R_factor_R_free 0.26608 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22810 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.439 _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 35.130 _refine.overall_SU_ML 0.281 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.95 _refine_hist.d_res_low 34.39 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2553 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2546 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.017 2600 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2511 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 0.822 1.819 3511 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.323 1.568 5783 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.584 5.170 323 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.968 10.000 487 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.040 0.200 392 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2974 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 602 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 2.036 2.960 1251 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 2.035 2.960 1251 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 3.439 5.330 1562 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 3.438 5.330 1563 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 1.985 3.014 1349 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.985 3.014 1349 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 3.378 5.502 1950 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 6.820 34.350 10524 ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? 6.819 34.350 10525 ? r_long_range_B_other ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.95 _refine_ls_shell.d_res_low 3.023 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 95 _refine_ls_shell.number_reflns_R_work 610 _refine_ls_shell.percent_reflns_obs 98.33 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.368 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.463 # _struct.entry_id 9OFT _struct.title 'Rotavirus NSP2 WT' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9OFT _struct_keywords.text 'Rotavirus, NSP2, viral factory, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A2T3N6_9REOV _struct_ref.pdbx_db_accession A2T3N6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAELACFCYPHLENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKV AMLICEALNSLKVTQANVSNVLSRVVSIRHLENLVIRKENPQDILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQ NAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKPISDVHVKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADR VYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQKMKPEKNPFKGLSTDRKMDEVS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9OFT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 313 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A2T3N6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 313 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 313 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details octameric _pdbx_struct_assembly.oligomeric_count 8 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 18770 ? 1 MORE -77 ? 1 'SSA (A^2)' 118220 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 108.6730000000 0.0000000000 -1.0000000000 0.0000000000 108.6730000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 108.6730000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 108.6730000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 108.6730000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 108.6730000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 8 'crystal symmetry operation' 8_665 -y+1,-x+1,-z 0.0000000000 -1.0000000000 0.0000000000 108.6730000000 -1.0000000000 0.0000000000 0.0000000000 108.6730000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 23 ? THR A 32 ? ASN A 23 THR A 32 1 ? 10 HELX_P HELX_P2 AA2 PRO A 54 ? TYR A 61 ? PRO A 54 TYR A 61 5 ? 8 HELX_P HELX_P3 AA3 THR A 74 ? SER A 90 ? THR A 74 SER A 90 1 ? 17 HELX_P HELX_P4 AA4 ASN A 97 ? SER A 103 ? ASN A 97 SER A 103 1 ? 7 HELX_P HELX_P5 AA5 SER A 107 ? GLU A 119 ? SER A 107 GLU A 119 1 ? 13 HELX_P HELX_P6 AA6 ASP A 123 ? SER A 128 ? ASP A 123 SER A 128 1 ? 6 HELX_P HELX_P7 AA7 SER A 128 ? GLY A 141 ? SER A 128 GLY A 141 1 ? 14 HELX_P HELX_P8 AA8 THR A 170 ? HIS A 174 ? THR A 170 HIS A 174 5 ? 5 HELX_P HELX_P9 AA9 SER A 198 ? TYR A 213 ? SER A 198 TYR A 213 1 ? 16 HELX_P HELX_P10 AB1 SER A 233 ? GLY A 252 ? SER A 233 GLY A 252 1 ? 20 HELX_P HELX_P11 AB2 TRP A 266 ? GLN A 278 ? TRP A 266 GLN A 278 1 ? 13 HELX_P HELX_P12 AB3 THR A 281 ? PHE A 290 ? THR A 281 PHE A 290 1 ? 10 HELX_P HELX_P13 AB4 GLY A 302 ? SER A 313 ? GLY A 302 SER A 313 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 298 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 298 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 299 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 299 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.97 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 2 ? GLU A 3 ? ALA A 2 GLU A 3 AA1 2 VAL A 105 ? VAL A 106 ? VAL A 105 VAL A 106 AA2 1 CYS A 8 ? GLU A 13 ? CYS A 8 GLU A 13 AA2 2 SER A 16 ? PRO A 21 ? SER A 16 PRO A 21 AA3 1 TYR A 44 ? ASP A 45 ? TYR A 44 ASP A 45 AA3 2 ILE A 51 ? ALA A 52 ? ILE A 51 ALA A 52 AA4 1 GLU A 156 ? GLN A 160 ? GLU A 156 GLN A 160 AA4 2 PHE A 164 ? LYS A 168 ? PHE A 164 LYS A 168 AA4 3 GLU A 186 ? LEU A 191 ? GLU A 186 LEU A 191 AA4 4 HIS A 225 ? LYS A 230 ? HIS A 225 LYS A 230 AA4 5 PHE A 216 ? ILE A 219 ? PHE A 216 ILE A 219 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 2 ? N ALA A 2 O VAL A 106 ? O VAL A 106 AA2 1 2 N TYR A 9 ? N TYR A 9 O ILE A 20 ? O ILE A 20 AA3 1 2 N TYR A 44 ? N TYR A 44 O ALA A 52 ? O ALA A 52 AA4 1 2 N PHE A 159 ? N PHE A 159 O MET A 166 ? O MET A 166 AA4 2 3 N TRP A 167 ? N TRP A 167 O LYS A 188 ? O LYS A 188 AA4 3 4 N TYR A 187 ? N TYR A 187 O ILE A 228 ? O ILE A 228 AA4 4 5 O VAL A 229 ? O VAL A 229 N ALA A 217 ? N ALA A 217 # _pdbx_entry_details.entry_id 9OFT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 47 ? ? 76.26 -61.54 2 1 THR A 170 ? ? -95.31 53.16 3 1 LEU A 260 ? ? 67.52 178.42 4 1 GLU A 296 ? ? -57.27 175.03 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 227 ? ? 0.077 'SIDE CHAIN' 2 1 ARG A 240 ? ? 0.085 'SIDE CHAIN' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 42.7310 _pdbx_refine_tls.origin_y 20.4340 _pdbx_refine_tls.origin_z 18.7230 _pdbx_refine_tls.T[1][1] 0.2277 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0114 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0052 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0626 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0230 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0888 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.2624 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1483 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.1593 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.5233 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.0790 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.7487 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0821 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0630 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.4153 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0783 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0383 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0357 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.2236 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0614 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0438 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 313 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number DM _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1L9V _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9OFT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009202 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009202 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006518 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #