data_9OSL # _entry.id 9OSL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9OSL pdb_00009osl 10.2210/pdb9osl/pdb WWPDB D_1000296263 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-03 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9OSL _pdbx_database_status.recvd_initial_deposition_date 2025-05-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email cdavies@southalabama.edu _pdbx_contact_author.name_first Christopher _pdbx_contact_author.name_last Davies _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6687-4064 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stratton, C.M.' 1 ? 'Bala, S.' 2 0000-0001-6673-0055 'Davies, C.' 3 0000-0002-6687-4064 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Tyrosine-422 plays a crucial role in acylation and transpeptidation in penicillin-binding protein 2 from Neisseria gonorrhoeae' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stratton, C.M.' 1 0000-0002-6687-4064 primary 'Bala, S.' 2 0000-0001-6673-0055 primary 'Bivins, M.M.' 3 ? primary 'Nicholas, R.A.' 4 ? primary 'Davies, C.' 5 0000-0002-6687-4064 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable peptidoglycan D,D-transpeptidase PenA' 35269.398 1 3.4.16.4 ? ? ? 2 non-polymer nat ;CEFOTAXIME, C3' cleaved, open, bound form ; 397.429 1 ? ? ? ? 3 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 12 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Penicillin-binding protein 2,PBP-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGGALSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALVNTPGRNRAVTDMIEPGSVMKPFPIAKALDSGK VDTTDTFNTLPYKIGPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVGVRMHSGFPGESAGVLR NWRKWRPIEQATMSFGAGLQLSLLQLARAYTVLTHDGELLPVSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGSGI AGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTANGYYSGVVTGPVFKQVMGGSLNILG VSPTKPLTNV ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGGALSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALVNTPGRNRAVTDMIEPGSVMKPFPIAKALDSGK VDTTDTFNTLPYKIGPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVGVRMHSGFPGESAGVLR NWRKWRPIEQATMSFGAGLQLSLLQLARAYTVLTHDGELLPVSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGSGI AGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTANGYYSGVVTGPVFKQVMGGSLNILG VSPTKPLTNV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;CEFOTAXIME, C3' cleaved, open, bound form ; CEF 3 'TRIETHYLENE GLYCOL' PGE 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 GLY n 1 5 ALA n 1 6 LEU n 1 7 SER n 1 8 LEU n 1 9 ASP n 1 10 GLN n 1 11 ARG n 1 12 ILE n 1 13 GLN n 1 14 THR n 1 15 LEU n 1 16 ALA n 1 17 TYR n 1 18 GLU n 1 19 GLU n 1 20 LEU n 1 21 ASN n 1 22 LYS n 1 23 ALA n 1 24 VAL n 1 25 GLU n 1 26 TYR n 1 27 HIS n 1 28 GLN n 1 29 ALA n 1 30 LYS n 1 31 ALA n 1 32 GLY n 1 33 THR n 1 34 VAL n 1 35 VAL n 1 36 VAL n 1 37 LEU n 1 38 ASP n 1 39 ALA n 1 40 ARG n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 ILE n 1 45 LEU n 1 46 ALA n 1 47 LEU n 1 48 VAL n 1 49 ASN n 1 50 THR n 1 51 PRO n 1 52 GLY n 1 53 ARG n 1 54 ASN n 1 55 ARG n 1 56 ALA n 1 57 VAL n 1 58 THR n 1 59 ASP n 1 60 MET n 1 61 ILE n 1 62 GLU n 1 63 PRO n 1 64 GLY n 1 65 SER n 1 66 VAL n 1 67 MET n 1 68 LYS n 1 69 PRO n 1 70 PHE n 1 71 PRO n 1 72 ILE n 1 73 ALA n 1 74 LYS n 1 75 ALA n 1 76 LEU n 1 77 ASP n 1 78 SER n 1 79 GLY n 1 80 LYS n 1 81 VAL n 1 82 ASP n 1 83 THR n 1 84 THR n 1 85 ASP n 1 86 THR n 1 87 PHE n 1 88 ASN n 1 89 THR n 1 90 LEU n 1 91 PRO n 1 92 TYR n 1 93 LYS n 1 94 ILE n 1 95 GLY n 1 96 PRO n 1 97 ALA n 1 98 THR n 1 99 VAL n 1 100 GLN n 1 101 ASP n 1 102 THR n 1 103 HIS n 1 104 VAL n 1 105 TYR n 1 106 PRO n 1 107 THR n 1 108 LEU n 1 109 ASP n 1 110 VAL n 1 111 ARG n 1 112 GLY n 1 113 ILE n 1 114 MET n 1 115 GLN n 1 116 LYS n 1 117 SER n 1 118 SER n 1 119 ASN n 1 120 VAL n 1 121 GLY n 1 122 THR n 1 123 SER n 1 124 LYS n 1 125 LEU n 1 126 SER n 1 127 ALA n 1 128 MET n 1 129 PHE n 1 130 THR n 1 131 PRO n 1 132 LYS n 1 133 GLU n 1 134 MET n 1 135 TYR n 1 136 ASP n 1 137 PHE n 1 138 TYR n 1 139 HIS n 1 140 ASP n 1 141 LEU n 1 142 GLY n 1 143 VAL n 1 144 GLY n 1 145 VAL n 1 146 ARG n 1 147 MET n 1 148 HIS n 1 149 SER n 1 150 GLY n 1 151 PHE n 1 152 PRO n 1 153 GLY n 1 154 GLU n 1 155 SER n 1 156 ALA n 1 157 GLY n 1 158 VAL n 1 159 LEU n 1 160 ARG n 1 161 ASN n 1 162 TRP n 1 163 ARG n 1 164 LYS n 1 165 TRP n 1 166 ARG n 1 167 PRO n 1 168 ILE n 1 169 GLU n 1 170 GLN n 1 171 ALA n 1 172 THR n 1 173 MET n 1 174 SER n 1 175 PHE n 1 176 GLY n 1 177 ALA n 1 178 GLY n 1 179 LEU n 1 180 GLN n 1 181 LEU n 1 182 SER n 1 183 LEU n 1 184 LEU n 1 185 GLN n 1 186 LEU n 1 187 ALA n 1 188 ARG n 1 189 ALA n 1 190 TYR n 1 191 THR n 1 192 VAL n 1 193 LEU n 1 194 THR n 1 195 HIS n 1 196 ASP n 1 197 GLY n 1 198 GLU n 1 199 LEU n 1 200 LEU n 1 201 PRO n 1 202 VAL n 1 203 SER n 1 204 PHE n 1 205 GLU n 1 206 LYS n 1 207 GLN n 1 208 ALA n 1 209 VAL n 1 210 ALA n 1 211 PRO n 1 212 LYS n 1 213 GLY n 1 214 LYS n 1 215 ARG n 1 216 VAL n 1 217 ILE n 1 218 LYS n 1 219 ALA n 1 220 SER n 1 221 THR n 1 222 ALA n 1 223 LYS n 1 224 LYS n 1 225 VAL n 1 226 ARG n 1 227 GLU n 1 228 LEU n 1 229 MET n 1 230 VAL n 1 231 SER n 1 232 VAL n 1 233 THR n 1 234 GLU n 1 235 ALA n 1 236 GLY n 1 237 GLY n 1 238 SER n 1 239 GLY n 1 240 ILE n 1 241 ALA n 1 242 GLY n 1 243 ALA n 1 244 VAL n 1 245 ASP n 1 246 GLY n 1 247 PHE n 1 248 ASP n 1 249 VAL n 1 250 GLY n 1 251 ALA n 1 252 LYS n 1 253 THR n 1 254 GLY n 1 255 THR n 1 256 ALA n 1 257 ARG n 1 258 LYS n 1 259 LEU n 1 260 VAL n 1 261 ASN n 1 262 GLY n 1 263 ARG n 1 264 TYR n 1 265 VAL n 1 266 ASP n 1 267 TYR n 1 268 LYS n 1 269 HIS n 1 270 VAL n 1 271 ALA n 1 272 THR n 1 273 PHE n 1 274 ILE n 1 275 GLY n 1 276 PHE n 1 277 ALA n 1 278 PRO n 1 279 ALA n 1 280 LYS n 1 281 ASN n 1 282 PRO n 1 283 ARG n 1 284 VAL n 1 285 ILE n 1 286 VAL n 1 287 ALA n 1 288 VAL n 1 289 THR n 1 290 ILE n 1 291 ASP n 1 292 GLU n 1 293 PRO n 1 294 THR n 1 295 ALA n 1 296 ASN n 1 297 GLY n 1 298 TYR n 1 299 TYR n 1 300 SER n 1 301 GLY n 1 302 VAL n 1 303 VAL n 1 304 THR n 1 305 GLY n 1 306 PRO n 1 307 VAL n 1 308 PHE n 1 309 LYS n 1 310 GLN n 1 311 VAL n 1 312 MET n 1 313 GLY n 1 314 GLY n 1 315 SER n 1 316 LEU n 1 317 ASN n 1 318 ILE n 1 319 LEU n 1 320 GLY n 1 321 VAL n 1 322 SER n 1 323 PRO n 1 324 THR n 1 325 LYS n 1 326 PRO n 1 327 LEU n 1 328 THR n 1 329 ASN n 1 330 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 330 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene penA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain H041 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria gonorrhoeae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 485 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CEF non-polymer . ;CEFOTAXIME, C3' cleaved, open, bound form ; ? 'C14 H15 N5 O5 S2' 397.429 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 232 ? ? ? A . n A 1 2 SER 2 233 ? ? ? A . n A 1 3 GLY 3 234 ? ? ? A . n A 1 4 GLY 4 235 ? ? ? A . n A 1 5 ALA 5 236 236 ALA ALA A . n A 1 6 LEU 6 237 237 LEU LEU A . n A 1 7 SER 7 238 238 SER SER A . n A 1 8 LEU 8 239 239 LEU LEU A . n A 1 9 ASP 9 240 240 ASP ASP A . n A 1 10 GLN 10 241 241 GLN GLN A . n A 1 11 ARG 11 242 242 ARG ARG A . n A 1 12 ILE 12 243 243 ILE ILE A . n A 1 13 GLN 13 244 244 GLN GLN A . n A 1 14 THR 14 245 245 THR THR A . n A 1 15 LEU 15 246 246 LEU LEU A . n A 1 16 ALA 16 247 247 ALA ALA A . n A 1 17 TYR 17 248 248 TYR TYR A . n A 1 18 GLU 18 249 249 GLU GLU A . n A 1 19 GLU 19 250 250 GLU GLU A . n A 1 20 LEU 20 251 251 LEU LEU A . n A 1 21 ASN 21 252 252 ASN ASN A . n A 1 22 LYS 22 253 253 LYS LYS A . n A 1 23 ALA 23 254 254 ALA ALA A . n A 1 24 VAL 24 255 255 VAL VAL A . n A 1 25 GLU 25 256 256 GLU GLU A . n A 1 26 TYR 26 257 257 TYR TYR A . n A 1 27 HIS 27 258 258 HIS HIS A . n A 1 28 GLN 28 259 259 GLN GLN A . n A 1 29 ALA 29 260 260 ALA ALA A . n A 1 30 LYS 30 261 261 LYS LYS A . n A 1 31 ALA 31 262 262 ALA ALA A . n A 1 32 GLY 32 263 263 GLY GLY A . n A 1 33 THR 33 264 264 THR THR A . n A 1 34 VAL 34 265 265 VAL VAL A . n A 1 35 VAL 35 266 266 VAL VAL A . n A 1 36 VAL 36 267 267 VAL VAL A . n A 1 37 LEU 37 268 268 LEU LEU A . n A 1 38 ASP 38 269 269 ASP ASP A . n A 1 39 ALA 39 270 270 ALA ALA A . n A 1 40 ARG 40 271 271 ARG ARG A . n A 1 41 THR 41 272 272 THR THR A . n A 1 42 GLY 42 273 273 GLY GLY A . n A 1 43 GLU 43 274 274 GLU GLU A . n A 1 44 ILE 44 275 275 ILE ILE A . n A 1 45 LEU 45 276 276 LEU LEU A . n A 1 46 ALA 46 277 277 ALA ALA A . n A 1 47 LEU 47 278 278 LEU LEU A . n A 1 48 VAL 48 279 279 VAL VAL A . n A 1 49 ASN 49 280 280 ASN ASN A . n A 1 50 THR 50 281 281 THR THR A . n A 1 51 PRO 51 282 282 PRO PRO A . n A 1 52 GLY 52 297 297 GLY GLY A . n A 1 53 ARG 53 298 298 ARG ARG A . n A 1 54 ASN 54 299 299 ASN ASN A . n A 1 55 ARG 55 300 300 ARG ARG A . n A 1 56 ALA 56 301 301 ALA ALA A . n A 1 57 VAL 57 302 302 VAL VAL A . n A 1 58 THR 58 303 303 THR THR A . n A 1 59 ASP 59 304 304 ASP ASP A . n A 1 60 MET 60 305 305 MET MET A . n A 1 61 ILE 61 306 306 ILE ILE A . n A 1 62 GLU 62 307 307 GLU GLU A . n A 1 63 PRO 63 308 308 PRO PRO A . n A 1 64 GLY 64 309 309 GLY GLY A . n A 1 65 SER 65 310 310 SER SER A . n A 1 66 VAL 66 311 311 VAL VAL A . n A 1 67 MET 67 312 312 MET MET A . n A 1 68 LYS 68 313 313 LYS LYS A . n A 1 69 PRO 69 314 314 PRO PRO A . n A 1 70 PHE 70 315 315 PHE PHE A . n A 1 71 PRO 71 316 316 PRO PRO A . n A 1 72 ILE 72 317 317 ILE ILE A . n A 1 73 ALA 73 318 318 ALA ALA A . n A 1 74 LYS 74 319 319 LYS LYS A . n A 1 75 ALA 75 320 320 ALA ALA A . n A 1 76 LEU 76 321 321 LEU LEU A . n A 1 77 ASP 77 322 322 ASP ASP A . n A 1 78 SER 78 323 323 SER SER A . n A 1 79 GLY 79 324 324 GLY GLY A . n A 1 80 LYS 80 325 325 LYS LYS A . n A 1 81 VAL 81 326 326 VAL VAL A . n A 1 82 ASP 82 327 327 ASP ASP A . n A 1 83 THR 83 328 328 THR THR A . n A 1 84 THR 84 329 329 THR THR A . n A 1 85 ASP 85 330 330 ASP ASP A . n A 1 86 THR 86 331 331 THR THR A . n A 1 87 PHE 87 332 332 PHE PHE A . n A 1 88 ASN 88 333 333 ASN ASN A . n A 1 89 THR 89 334 334 THR THR A . n A 1 90 LEU 90 335 335 LEU LEU A . n A 1 91 PRO 91 336 336 PRO PRO A . n A 1 92 TYR 92 337 337 TYR TYR A . n A 1 93 LYS 93 338 338 LYS LYS A . n A 1 94 ILE 94 339 339 ILE ILE A . n A 1 95 GLY 95 340 340 GLY GLY A . n A 1 96 PRO 96 341 341 PRO PRO A . n A 1 97 ALA 97 342 342 ALA ALA A . n A 1 98 THR 98 343 343 THR THR A . n A 1 99 VAL 99 344 344 VAL VAL A . n A 1 100 GLN 100 345 345 GLN GLN A . n A 1 101 ASP 101 346 346 ASP ASP A . n A 1 102 THR 102 347 347 THR THR A . n A 1 103 HIS 103 348 348 HIS HIS A . n A 1 104 VAL 104 349 349 VAL VAL A . n A 1 105 TYR 105 350 350 TYR TYR A . n A 1 106 PRO 106 351 351 PRO PRO A . n A 1 107 THR 107 352 352 THR THR A . n A 1 108 LEU 108 353 353 LEU LEU A . n A 1 109 ASP 109 354 354 ASP ASP A . n A 1 110 VAL 110 355 355 VAL VAL A . n A 1 111 ARG 111 356 356 ARG ARG A . n A 1 112 GLY 112 357 357 GLY GLY A . n A 1 113 ILE 113 358 358 ILE ILE A . n A 1 114 MET 114 359 359 MET MET A . n A 1 115 GLN 115 360 360 GLN GLN A . n A 1 116 LYS 116 361 361 LYS LYS A . n A 1 117 SER 117 362 362 SER SER A . n A 1 118 SER 118 363 363 SER SER A . n A 1 119 ASN 119 364 364 ASN ASN A . n A 1 120 VAL 120 365 365 VAL VAL A . n A 1 121 GLY 121 366 366 GLY GLY A . n A 1 122 THR 122 367 367 THR THR A . n A 1 123 SER 123 368 368 SER SER A . n A 1 124 LYS 124 369 369 LYS LYS A . n A 1 125 LEU 125 370 370 LEU LEU A . n A 1 126 SER 126 371 371 SER SER A . n A 1 127 ALA 127 372 372 ALA ALA A . n A 1 128 MET 128 373 373 MET MET A . n A 1 129 PHE 129 374 374 PHE PHE A . n A 1 130 THR 130 375 375 THR THR A . n A 1 131 PRO 131 376 376 PRO PRO A . n A 1 132 LYS 132 377 377 LYS LYS A . n A 1 133 GLU 133 378 378 GLU GLU A . n A 1 134 MET 134 379 379 MET MET A . n A 1 135 TYR 135 380 380 TYR TYR A . n A 1 136 ASP 136 381 381 ASP ASP A . n A 1 137 PHE 137 382 382 PHE PHE A . n A 1 138 TYR 138 383 383 TYR TYR A . n A 1 139 HIS 139 384 384 HIS HIS A . n A 1 140 ASP 140 385 385 ASP ASP A . n A 1 141 LEU 141 386 386 LEU LEU A . n A 1 142 GLY 142 387 387 GLY GLY A . n A 1 143 VAL 143 388 388 VAL VAL A . n A 1 144 GLY 144 389 389 GLY GLY A . n A 1 145 VAL 145 390 390 VAL VAL A . n A 1 146 ARG 146 391 391 ARG ARG A . n A 1 147 MET 147 392 392 MET MET A . n A 1 148 HIS 148 393 393 HIS HIS A . n A 1 149 SER 149 394 394 SER SER A . n A 1 150 GLY 150 395 395 GLY GLY A . n A 1 151 PHE 151 396 396 PHE PHE A . n A 1 152 PRO 152 397 397 PRO PRO A . n A 1 153 GLY 153 398 398 GLY GLY A . n A 1 154 GLU 154 399 399 GLU GLU A . n A 1 155 SER 155 400 400 SER SER A . n A 1 156 ALA 156 401 401 ALA ALA A . n A 1 157 GLY 157 402 402 GLY GLY A . n A 1 158 VAL 158 403 403 VAL VAL A . n A 1 159 LEU 159 404 404 LEU LEU A . n A 1 160 ARG 160 405 405 ARG ARG A . n A 1 161 ASN 161 406 406 ASN ASN A . n A 1 162 TRP 162 407 407 TRP TRP A . n A 1 163 ARG 163 408 408 ARG ARG A . n A 1 164 LYS 164 409 409 LYS LYS A . n A 1 165 TRP 165 410 410 TRP TRP A . n A 1 166 ARG 166 411 411 ARG ARG A . n A 1 167 PRO 167 412 412 PRO PRO A . n A 1 168 ILE 168 413 413 ILE ILE A . n A 1 169 GLU 169 414 414 GLU GLU A . n A 1 170 GLN 170 415 415 GLN GLN A . n A 1 171 ALA 171 416 416 ALA ALA A . n A 1 172 THR 172 417 417 THR THR A . n A 1 173 MET 173 418 418 MET MET A . n A 1 174 SER 174 419 419 SER SER A . n A 1 175 PHE 175 420 420 PHE PHE A . n A 1 176 GLY 176 421 421 GLY GLY A . n A 1 177 ALA 177 422 422 ALA ALA A . n A 1 178 GLY 178 423 423 GLY GLY A . n A 1 179 LEU 179 424 424 LEU LEU A . n A 1 180 GLN 180 425 425 GLN GLN A . n A 1 181 LEU 181 426 426 LEU LEU A . n A 1 182 SER 182 427 427 SER SER A . n A 1 183 LEU 183 428 428 LEU LEU A . n A 1 184 LEU 184 429 429 LEU LEU A . n A 1 185 GLN 185 430 430 GLN GLN A . n A 1 186 LEU 186 431 431 LEU LEU A . n A 1 187 ALA 187 432 432 ALA ALA A . n A 1 188 ARG 188 433 433 ARG ARG A . n A 1 189 ALA 189 434 434 ALA ALA A . n A 1 190 TYR 190 435 435 TYR TYR A . n A 1 191 THR 191 436 436 THR THR A . n A 1 192 VAL 192 437 437 VAL VAL A . n A 1 193 LEU 193 438 438 LEU LEU A . n A 1 194 THR 194 439 439 THR THR A . n A 1 195 HIS 195 440 440 HIS HIS A . n A 1 196 ASP 196 441 441 ASP ASP A . n A 1 197 GLY 197 442 442 GLY GLY A . n A 1 198 GLU 198 443 443 GLU GLU A . n A 1 199 LEU 199 444 444 LEU LEU A . n A 1 200 LEU 200 445 445 LEU LEU A . n A 1 201 PRO 201 446 446 PRO PRO A . n A 1 202 VAL 202 447 447 VAL VAL A . n A 1 203 SER 203 448 448 SER SER A . n A 1 204 PHE 204 449 449 PHE PHE A . n A 1 205 GLU 205 450 450 GLU GLU A . n A 1 206 LYS 206 451 451 LYS LYS A . n A 1 207 GLN 207 452 452 GLN GLN A . n A 1 208 ALA 208 453 453 ALA ALA A . n A 1 209 VAL 209 454 454 VAL VAL A . n A 1 210 ALA 210 455 455 ALA ALA A . n A 1 211 PRO 211 456 456 PRO PRO A . n A 1 212 LYS 212 457 457 LYS LYS A . n A 1 213 GLY 213 458 458 GLY GLY A . n A 1 214 LYS 214 459 459 LYS LYS A . n A 1 215 ARG 215 460 460 ARG ARG A . n A 1 216 VAL 216 461 461 VAL VAL A . n A 1 217 ILE 217 462 462 ILE ILE A . n A 1 218 LYS 218 463 463 LYS LYS A . n A 1 219 ALA 219 464 464 ALA ALA A . n A 1 220 SER 220 465 465 SER SER A . n A 1 221 THR 221 466 466 THR THR A . n A 1 222 ALA 222 467 467 ALA ALA A . n A 1 223 LYS 223 468 468 LYS LYS A . n A 1 224 LYS 224 469 469 LYS LYS A . n A 1 225 VAL 225 470 470 VAL VAL A . n A 1 226 ARG 226 471 471 ARG ARG A . n A 1 227 GLU 227 472 472 GLU GLU A . n A 1 228 LEU 228 473 473 LEU LEU A . n A 1 229 MET 229 474 474 MET MET A . n A 1 230 VAL 230 475 475 VAL VAL A . n A 1 231 SER 231 476 476 SER SER A . n A 1 232 VAL 232 477 477 VAL VAL A . n A 1 233 THR 233 478 478 THR THR A . n A 1 234 GLU 234 479 479 GLU GLU A . n A 1 235 ALA 235 480 480 ALA ALA A . n A 1 236 GLY 236 481 481 GLY GLY A . n A 1 237 GLY 237 482 482 GLY GLY A . n A 1 238 SER 238 483 483 SER SER A . n A 1 239 GLY 239 484 484 GLY GLY A . n A 1 240 ILE 240 485 485 ILE ILE A . n A 1 241 ALA 241 486 486 ALA ALA A . n A 1 242 GLY 242 487 487 GLY GLY A . n A 1 243 ALA 243 488 488 ALA ALA A . n A 1 244 VAL 244 489 489 VAL VAL A . n A 1 245 ASP 245 490 490 ASP ASP A . n A 1 246 GLY 246 491 491 GLY GLY A . n A 1 247 PHE 247 492 492 PHE PHE A . n A 1 248 ASP 248 493 493 ASP ASP A . n A 1 249 VAL 249 494 494 VAL VAL A . n A 1 250 GLY 250 495 495 GLY GLY A . n A 1 251 ALA 251 496 496 ALA ALA A . n A 1 252 LYS 252 497 497 LYS LYS A . n A 1 253 THR 253 498 498 THR THR A . n A 1 254 GLY 254 499 499 GLY GLY A . n A 1 255 THR 255 500 500 THR THR A . n A 1 256 ALA 256 501 501 ALA ALA A . n A 1 257 ARG 257 502 502 ARG ARG A . n A 1 258 LYS 258 503 503 LYS LYS A . n A 1 259 LEU 259 504 504 LEU LEU A . n A 1 260 VAL 260 505 505 VAL VAL A . n A 1 261 ASN 261 506 506 ASN ASN A . n A 1 262 GLY 262 507 507 GLY GLY A . n A 1 263 ARG 263 508 508 ARG ARG A . n A 1 264 TYR 264 509 509 TYR TYR A . n A 1 265 VAL 265 510 510 VAL VAL A . n A 1 266 ASP 266 511 511 ASP ASP A . n A 1 267 TYR 267 512 512 TYR TYR A . n A 1 268 LYS 268 513 513 LYS LYS A . n A 1 269 HIS 269 514 514 HIS HIS A . n A 1 270 VAL 270 515 515 VAL VAL A . n A 1 271 ALA 271 516 516 ALA ALA A . n A 1 272 THR 272 517 517 THR THR A . n A 1 273 PHE 273 518 518 PHE PHE A . n A 1 274 ILE 274 519 519 ILE ILE A . n A 1 275 GLY 275 520 520 GLY GLY A . n A 1 276 PHE 276 521 521 PHE PHE A . n A 1 277 ALA 277 522 522 ALA ALA A . n A 1 278 PRO 278 523 523 PRO PRO A . n A 1 279 ALA 279 524 524 ALA ALA A . n A 1 280 LYS 280 525 525 LYS LYS A . n A 1 281 ASN 281 526 526 ASN ASN A . n A 1 282 PRO 282 527 527 PRO PRO A . n A 1 283 ARG 283 528 528 ARG ARG A . n A 1 284 VAL 284 529 529 VAL VAL A . n A 1 285 ILE 285 530 530 ILE ILE A . n A 1 286 VAL 286 531 531 VAL VAL A . n A 1 287 ALA 287 532 532 ALA ALA A . n A 1 288 VAL 288 533 533 VAL VAL A . n A 1 289 THR 289 534 534 THR THR A . n A 1 290 ILE 290 535 535 ILE ILE A . n A 1 291 ASP 291 536 536 ASP ASP A . n A 1 292 GLU 292 537 537 GLU GLU A . n A 1 293 PRO 293 538 538 PRO PRO A . n A 1 294 THR 294 539 539 THR THR A . n A 1 295 ALA 295 540 540 ALA ALA A . n A 1 296 ASN 296 541 541 ASN ASN A . n A 1 297 GLY 297 542 542 GLY GLY A . n A 1 298 TYR 298 543 543 TYR TYR A . n A 1 299 TYR 299 544 544 TYR TYR A . n A 1 300 SER 300 545 545 SER SER A . n A 1 301 GLY 301 546 546 GLY GLY A . n A 1 302 VAL 302 547 547 VAL VAL A . n A 1 303 VAL 303 548 548 VAL VAL A . n A 1 304 THR 304 549 549 THR THR A . n A 1 305 GLY 305 550 550 GLY GLY A . n A 1 306 PRO 306 551 551 PRO PRO A . n A 1 307 VAL 307 552 552 VAL VAL A . n A 1 308 PHE 308 553 553 PHE PHE A . n A 1 309 LYS 309 554 554 LYS LYS A . n A 1 310 GLN 310 555 555 GLN GLN A . n A 1 311 VAL 311 556 556 VAL VAL A . n A 1 312 MET 312 557 557 MET MET A . n A 1 313 GLY 313 558 558 GLY GLY A . n A 1 314 GLY 314 559 559 GLY GLY A . n A 1 315 SER 315 560 560 SER SER A . n A 1 316 LEU 316 561 561 LEU LEU A . n A 1 317 ASN 317 562 562 ASN ASN A . n A 1 318 ILE 318 563 563 ILE ILE A . n A 1 319 LEU 319 564 564 LEU LEU A . n A 1 320 GLY 320 565 565 GLY GLY A . n A 1 321 VAL 321 566 566 VAL VAL A . n A 1 322 SER 322 567 567 SER SER A . n A 1 323 PRO 323 568 568 PRO PRO A . n A 1 324 THR 324 569 569 THR THR A . n A 1 325 LYS 325 570 570 LYS LYS A . n A 1 326 PRO 326 571 571 PRO PRO A . n A 1 327 LEU 327 572 572 LEU LEU A . n A 1 328 THR 328 573 573 THR THR A . n A 1 329 ASN 329 574 ? ? ? A . n A 1 330 VAL 330 575 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CEF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CEF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CEF 1 601 601 CEF CEF A . C 3 PGE 1 602 602 PGE PGE A . D 4 GOL 1 603 603 GOL GOL A . E 5 HOH 1 701 11 HOH HOH A . E 5 HOH 2 702 5 HOH HOH A . E 5 HOH 3 703 10 HOH HOH A . E 5 HOH 4 704 7 HOH HOH A . E 5 HOH 5 705 6 HOH HOH A . E 5 HOH 6 706 3 HOH HOH A . E 5 HOH 7 707 2 HOH HOH A . E 5 HOH 8 708 1 HOH HOH A . E 5 HOH 9 709 4 HOH HOH A . E 5 HOH 10 710 9 HOH HOH A . E 5 HOH 11 711 12 HOH HOH A . E 5 HOH 12 712 8 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9OSL _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.771 _cell.length_a_esd ? _cell.length_b 59.450 _cell.length_b_esd ? _cell.length_c 112.933 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9OSL _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9OSL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.3 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.5 _exptl_crystal.description Plates _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CHES buffer, pH 9.1 to 10.1, and 32-42% PEG 600.' _exptl_crystal_grow.pdbx_pH_range 9.3-10.1 _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-08-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9OSL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.40 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13460 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.511 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.052 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_CC_star 0.966 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.130 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 613 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.7 _reflns_shell.pdbx_chi_squared 0.320 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.139 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.902 _reflns_shell.pdbx_CC_star 0.974 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 90.3 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.341 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.97 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -1.84 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 4.81 _refine.B_iso_max ? _refine.B_iso_mean 35.2 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9OSL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 40.98 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12720 _refine.ls_number_reflns_R_free 689 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.18 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.199 _refine.ls_R_factor_R_free 0.243 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.190 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.448 _refine.pdbx_overall_ESU_R_Free 0.265 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.047 _refine.overall_SU_ML 0.240 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 40.98 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 2500 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2446 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 2537 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2471 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.928 1.832 3436 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.570 1.751 5687 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.073 5.000 323 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.603 5.000 15 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.466 10.000 419 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.076 0.200 396 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2938 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 547 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? 2.655 3.232 1295 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 2.635 3.233 1295 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 4.198 5.796 1617 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 4.197 5.801 1618 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 3.786 3.824 1242 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 3.784 3.824 1243 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 6.119 6.797 1820 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 7.681 30.64 2731 ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? 7.680 30.63 2732 ? r_long_range_B_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.40 _refine_ls_shell.d_res_low 2.455 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.number_reflns_R_work 831 _refine_ls_shell.percent_reflns_obs 86.85 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.265 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.304 # _struct.entry_id 9OSL _struct.title ;Crystal structure of the transpeptidase domain of a Y422A mutant of PBP2 from Neisseria gonorrhoeae strain H041 acylated by ceftriaxone ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9OSL _struct_keywords.text 'penicillin-binding protein, peptidoglycan transpeptidase, ceftriaxone, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F2Z7K9_NEIGO _struct_ref.pdbx_db_accession F2Z7K9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSVMKPFP IAKALDSGKVDTTDTFNTLPYKIGPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVGVRMHSGF PGESAGVLRNWRKWRPIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSFEKQAVAPKGKRVIKASTAKKVRELMVS VTEAGGSGIAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTANGYYSGVVTGPVFKQV MGGSLNILGVSPTKPLTNV ; _struct_ref.pdbx_align_begin 237 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9OSL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 330 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F2Z7K9 _struct_ref_seq.db_align_beg 237 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 575 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 237 _struct_ref_seq.pdbx_auth_seq_align_end 575 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9OSL GLY A 1 ? UNP F2Z7K9 ? ? 'expression tag' 232 1 1 9OSL SER A 2 ? UNP F2Z7K9 ? ? 'expression tag' 233 2 1 9OSL GLY A 3 ? UNP F2Z7K9 ? ? 'expression tag' 234 3 1 9OSL GLY A 4 ? UNP F2Z7K9 ? ? 'expression tag' 235 4 1 9OSL ALA A 5 ? UNP F2Z7K9 ? ? 'expression tag' 236 5 1 9OSL GLY A 52 ? UNP F2Z7K9 ALA 283 conflict 297 6 1 9OSL ? A ? ? UNP F2Z7K9 TYR 284 deletion ? 7 1 9OSL ? A ? ? UNP F2Z7K9 GLU 285 deletion ? 8 1 9OSL ? A ? ? UNP F2Z7K9 PRO 286 deletion ? 9 1 9OSL ? A ? ? UNP F2Z7K9 ASN 287 deletion ? 10 1 9OSL ? A ? ? UNP F2Z7K9 LYS 288 deletion ? 11 1 9OSL ? A ? ? UNP F2Z7K9 PRO 289 deletion ? 12 1 9OSL ? A ? ? UNP F2Z7K9 GLY 290 deletion ? 13 1 9OSL ? A ? ? UNP F2Z7K9 GLN 291 deletion ? 14 1 9OSL ? A ? ? UNP F2Z7K9 ALA 292 deletion ? 15 1 9OSL ? A ? ? UNP F2Z7K9 ASP 293 deletion ? 16 1 9OSL ? A ? ? UNP F2Z7K9 SER 294 deletion ? 17 1 9OSL ? A ? ? UNP F2Z7K9 GLU 295 deletion ? 18 1 9OSL ? A ? ? UNP F2Z7K9 GLN 296 deletion ? 19 1 9OSL ? A ? ? UNP F2Z7K9 ARG 297 deletion ? 20 1 9OSL ALA A 177 ? UNP F2Z7K9 TYR 422 'engineered mutation' 422 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 9 ? GLN A 28 ? ASP A 240 GLN A 259 1 ? 20 HELX_P HELX_P2 AA2 ASN A 54 ? ASP A 59 ? ASN A 299 ASP A 304 1 ? 6 HELX_P HELX_P3 AA3 PRO A 63 ? MET A 67 ? PRO A 308 MET A 312 5 ? 5 HELX_P HELX_P4 AA4 LYS A 68 ? SER A 78 ? LYS A 313 SER A 323 1 ? 11 HELX_P HELX_P5 AA5 VAL A 110 ? SER A 117 ? VAL A 355 SER A 362 1 ? 8 HELX_P HELX_P6 AA6 SER A 118 ? ALA A 127 ? SER A 363 ALA A 372 1 ? 10 HELX_P HELX_P7 AA7 THR A 130 ? LEU A 141 ? THR A 375 LEU A 386 1 ? 12 HELX_P HELX_P8 AA8 ASN A 161 ? TRP A 165 ? ASN A 406 TRP A 410 5 ? 5 HELX_P HELX_P9 AA9 ARG A 166 ? PHE A 175 ? ARG A 411 PHE A 420 1 ? 10 HELX_P HELX_P10 AB1 SER A 182 ? TYR A 190 ? SER A 427 TYR A 435 1 ? 9 HELX_P HELX_P11 AB2 TYR A 190 ? HIS A 195 ? TYR A 435 HIS A 440 1 ? 6 HELX_P HELX_P12 AB3 LYS A 218 ? SER A 231 ? LYS A 463 SER A 476 1 ? 14 HELX_P HELX_P13 AB4 VAL A 232 ? GLU A 234 ? VAL A 477 GLU A 479 5 ? 3 HELX_P HELX_P14 AB5 GLY A 239 ? ALA A 243 ? GLY A 484 ALA A 488 5 ? 5 HELX_P HELX_P15 AB6 TYR A 299 ? THR A 304 ? TYR A 544 THR A 549 1 ? 6 HELX_P HELX_P16 AB7 THR A 304 ? GLY A 320 ? THR A 549 GLY A 565 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 65 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CEF _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C8 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 310 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CEF _struct_conn.ptnr2_auth_seq_id 601 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.333 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CEF _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id SER _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 65 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CEF _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 601 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id SER _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 310 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C8 _pdbx_modification_feature.modified_residue_id_linking_atom OG _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CEF _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 277 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 522 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 278 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 523 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.85 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 44 ? ASN A 49 ? ILE A 275 ASN A 280 AA1 2 ALA A 31 ? ASP A 38 ? ALA A 262 ASP A 269 AA1 3 VAL A 284 ? ASP A 291 ? VAL A 529 ASP A 536 AA1 4 ARG A 263 ? ALA A 277 ? ARG A 508 ALA A 522 AA1 5 GLY A 250 ? VAL A 260 ? GLY A 495 VAL A 505 AA2 1 THR A 86 ? ASN A 88 ? THR A 331 ASN A 333 AA2 2 THR A 107 ? ASP A 109 ? THR A 352 ASP A 354 AA3 1 TYR A 92 ? ILE A 94 ? TYR A 337 ILE A 339 AA3 2 ALA A 97 ? VAL A 99 ? ALA A 342 VAL A 344 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 48 ? O VAL A 279 N VAL A 34 ? N VAL A 265 AA1 2 3 N ALA A 31 ? N ALA A 262 O ASP A 291 ? O ASP A 536 AA1 3 4 O VAL A 288 ? O VAL A 533 N PHE A 273 ? N PHE A 518 AA1 4 5 O ARG A 263 ? O ARG A 508 N VAL A 260 ? N VAL A 505 AA2 1 2 N PHE A 87 ? N PHE A 332 O LEU A 108 ? O LEU A 353 AA3 1 2 N TYR A 92 ? N TYR A 337 O VAL A 99 ? O VAL A 344 # _pdbx_entry_details.entry_id 9OSL _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 310 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O3 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CEF _pdbx_validate_close_contact.auth_seq_id_2 601 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.01 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 278 ? ? -165.14 113.41 2 1 SER A 362 ? ? 76.64 70.20 3 1 ALA A 480 ? ? -34.79 125.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 232 ? A GLY 1 2 1 Y 1 A SER 233 ? A SER 2 3 1 Y 1 A GLY 234 ? A GLY 3 4 1 Y 1 A GLY 235 ? A GLY 4 5 1 Y 1 A ASN 574 ? A ASN 329 6 1 Y 1 A VAL 575 ? A VAL 330 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CEF S1 S N N 74 CEF C1 C N N 75 CEF C2 C N N 76 CEF C3 C N N 77 CEF C4 C N N 78 CEF C5 C N N 79 CEF O1 O N N 80 CEF O2 O N N 81 CEF N1 N N N 82 CEF C6 C N R 83 CEF C7 C N R 84 CEF C8 C N N 85 CEF O3 O N N 86 CEF N2 N N N 87 CEF C9 C N N 88 CEF O4 O N N 89 CEF C10 C N N 90 CEF N3 N N N 91 CEF O5 O N N 92 CEF C11 C N N 93 CEF C12 C Y N 94 CEF C13 C Y N 95 CEF S2 S Y N 96 CEF C14 C Y N 97 CEF N4 N N N 98 CEF N5 N Y N 99 CEF H1 H N N 100 CEF H2 H N N 101 CEF H3 H N N 102 CEF H4 H N N 103 CEF H5 H N N 104 CEF H6 H N N 105 CEF H7 H N N 106 CEF H8 H N N 107 CEF H9 H N N 108 CEF H10 H N N 109 CEF H11 H N N 110 CEF H12 H N N 111 CEF H13 H N N 112 CEF H14 H N N 113 CEF H15 H N N 114 GLN N N N N 115 GLN CA C N S 116 GLN C C N N 117 GLN O O N N 118 GLN CB C N N 119 GLN CG C N N 120 GLN CD C N N 121 GLN OE1 O N N 122 GLN NE2 N N N 123 GLN OXT O N N 124 GLN H H N N 125 GLN H2 H N N 126 GLN HA H N N 127 GLN HB2 H N N 128 GLN HB3 H N N 129 GLN HG2 H N N 130 GLN HG3 H N N 131 GLN HE21 H N N 132 GLN HE22 H N N 133 GLN HXT H N N 134 GLU N N N N 135 GLU CA C N S 136 GLU C C N N 137 GLU O O N N 138 GLU CB C N N 139 GLU CG C N N 140 GLU CD C N N 141 GLU OE1 O N N 142 GLU OE2 O N N 143 GLU OXT O N N 144 GLU H H N N 145 GLU H2 H N N 146 GLU HA H N N 147 GLU HB2 H N N 148 GLU HB3 H N N 149 GLU HG2 H N N 150 GLU HG3 H N N 151 GLU HE2 H N N 152 GLU HXT H N N 153 GLY N N N N 154 GLY CA C N N 155 GLY C C N N 156 GLY O O N N 157 GLY OXT O N N 158 GLY H H N N 159 GLY H2 H N N 160 GLY HA2 H N N 161 GLY HA3 H N N 162 GLY HXT H N N 163 GOL C1 C N N 164 GOL O1 O N N 165 GOL C2 C N N 166 GOL O2 O N N 167 GOL C3 C N N 168 GOL O3 O N N 169 GOL H11 H N N 170 GOL H12 H N N 171 GOL HO1 H N N 172 GOL H2 H N N 173 GOL HO2 H N N 174 GOL H31 H N N 175 GOL H32 H N N 176 GOL HO3 H N N 177 HIS N N N N 178 HIS CA C N S 179 HIS C C N N 180 HIS O O N N 181 HIS CB C N N 182 HIS CG C Y N 183 HIS ND1 N Y N 184 HIS CD2 C Y N 185 HIS CE1 C Y N 186 HIS NE2 N Y N 187 HIS OXT O N N 188 HIS H H N N 189 HIS H2 H N N 190 HIS HA H N N 191 HIS HB2 H N N 192 HIS HB3 H N N 193 HIS HD1 H N N 194 HIS HD2 H N N 195 HIS HE1 H N N 196 HIS HE2 H N N 197 HIS HXT H N N 198 HOH O O N N 199 HOH H1 H N N 200 HOH H2 H N N 201 ILE N N N N 202 ILE CA C N S 203 ILE C C N N 204 ILE O O N N 205 ILE CB C N S 206 ILE CG1 C N N 207 ILE CG2 C N N 208 ILE CD1 C N N 209 ILE OXT O N N 210 ILE H H N N 211 ILE H2 H N N 212 ILE HA H N N 213 ILE HB H N N 214 ILE HG12 H N N 215 ILE HG13 H N N 216 ILE HG21 H N N 217 ILE HG22 H N N 218 ILE HG23 H N N 219 ILE HD11 H N N 220 ILE HD12 H N N 221 ILE HD13 H N N 222 ILE HXT H N N 223 LEU N N N N 224 LEU CA C N S 225 LEU C C N N 226 LEU O O N N 227 LEU CB C N N 228 LEU CG C N N 229 LEU CD1 C N N 230 LEU CD2 C N N 231 LEU OXT O N N 232 LEU H H N N 233 LEU H2 H N N 234 LEU HA H N N 235 LEU HB2 H N N 236 LEU HB3 H N N 237 LEU HG H N N 238 LEU HD11 H N N 239 LEU HD12 H N N 240 LEU HD13 H N N 241 LEU HD21 H N N 242 LEU HD22 H N N 243 LEU HD23 H N N 244 LEU HXT H N N 245 LYS N N N N 246 LYS CA C N S 247 LYS C C N N 248 LYS O O N N 249 LYS CB C N N 250 LYS CG C N N 251 LYS CD C N N 252 LYS CE C N N 253 LYS NZ N N N 254 LYS OXT O N N 255 LYS H H N N 256 LYS H2 H N N 257 LYS HA H N N 258 LYS HB2 H N N 259 LYS HB3 H N N 260 LYS HG2 H N N 261 LYS HG3 H N N 262 LYS HD2 H N N 263 LYS HD3 H N N 264 LYS HE2 H N N 265 LYS HE3 H N N 266 LYS HZ1 H N N 267 LYS HZ2 H N N 268 LYS HZ3 H N N 269 LYS HXT H N N 270 MET N N N N 271 MET CA C N S 272 MET C C N N 273 MET O O N N 274 MET CB C N N 275 MET CG C N N 276 MET SD S N N 277 MET CE C N N 278 MET OXT O N N 279 MET H H N N 280 MET H2 H N N 281 MET HA H N N 282 MET HB2 H N N 283 MET HB3 H N N 284 MET HG2 H N N 285 MET HG3 H N N 286 MET HE1 H N N 287 MET HE2 H N N 288 MET HE3 H N N 289 MET HXT H N N 290 PGE C1 C N N 291 PGE O1 O N N 292 PGE C2 C N N 293 PGE O2 O N N 294 PGE C3 C N N 295 PGE C4 C N N 296 PGE O4 O N N 297 PGE C6 C N N 298 PGE C5 C N N 299 PGE O3 O N N 300 PGE H1 H N N 301 PGE H12 H N N 302 PGE HO1 H N N 303 PGE H2 H N N 304 PGE H22 H N N 305 PGE H3 H N N 306 PGE H32 H N N 307 PGE H4 H N N 308 PGE H42 H N N 309 PGE HO4 H N N 310 PGE H6 H N N 311 PGE H62 H N N 312 PGE H5 H N N 313 PGE H52 H N N 314 PHE N N N N 315 PHE CA C N S 316 PHE C C N N 317 PHE O O N N 318 PHE CB C N N 319 PHE CG C Y N 320 PHE CD1 C Y N 321 PHE CD2 C Y N 322 PHE CE1 C Y N 323 PHE CE2 C Y N 324 PHE CZ C Y N 325 PHE OXT O N N 326 PHE H H N N 327 PHE H2 H N N 328 PHE HA H N N 329 PHE HB2 H N N 330 PHE HB3 H N N 331 PHE HD1 H N N 332 PHE HD2 H N N 333 PHE HE1 H N N 334 PHE HE2 H N N 335 PHE HZ H N N 336 PHE HXT H N N 337 PRO N N N N 338 PRO CA C N S 339 PRO C C N N 340 PRO O O N N 341 PRO CB C N N 342 PRO CG C N N 343 PRO CD C N N 344 PRO OXT O N N 345 PRO H H N N 346 PRO HA H N N 347 PRO HB2 H N N 348 PRO HB3 H N N 349 PRO HG2 H N N 350 PRO HG3 H N N 351 PRO HD2 H N N 352 PRO HD3 H N N 353 PRO HXT H N N 354 SER N N N N 355 SER CA C N S 356 SER C C N N 357 SER O O N N 358 SER CB C N N 359 SER OG O N N 360 SER OXT O N N 361 SER H H N N 362 SER H2 H N N 363 SER HA H N N 364 SER HB2 H N N 365 SER HB3 H N N 366 SER HG H N N 367 SER HXT H N N 368 THR N N N N 369 THR CA C N S 370 THR C C N N 371 THR O O N N 372 THR CB C N R 373 THR OG1 O N N 374 THR CG2 C N N 375 THR OXT O N N 376 THR H H N N 377 THR H2 H N N 378 THR HA H N N 379 THR HB H N N 380 THR HG1 H N N 381 THR HG21 H N N 382 THR HG22 H N N 383 THR HG23 H N N 384 THR HXT H N N 385 TRP N N N N 386 TRP CA C N S 387 TRP C C N N 388 TRP O O N N 389 TRP CB C N N 390 TRP CG C Y N 391 TRP CD1 C Y N 392 TRP CD2 C Y N 393 TRP NE1 N Y N 394 TRP CE2 C Y N 395 TRP CE3 C Y N 396 TRP CZ2 C Y N 397 TRP CZ3 C Y N 398 TRP CH2 C Y N 399 TRP OXT O N N 400 TRP H H N N 401 TRP H2 H N N 402 TRP HA H N N 403 TRP HB2 H N N 404 TRP HB3 H N N 405 TRP HD1 H N N 406 TRP HE1 H N N 407 TRP HE3 H N N 408 TRP HZ2 H N N 409 TRP HZ3 H N N 410 TRP HH2 H N N 411 TRP HXT H N N 412 TYR N N N N 413 TYR CA C N S 414 TYR C C N N 415 TYR O O N N 416 TYR CB C N N 417 TYR CG C Y N 418 TYR CD1 C Y N 419 TYR CD2 C Y N 420 TYR CE1 C Y N 421 TYR CE2 C Y N 422 TYR CZ C Y N 423 TYR OH O N N 424 TYR OXT O N N 425 TYR H H N N 426 TYR H2 H N N 427 TYR HA H N N 428 TYR HB2 H N N 429 TYR HB3 H N N 430 TYR HD1 H N N 431 TYR HD2 H N N 432 TYR HE1 H N N 433 TYR HE2 H N N 434 TYR HH H N N 435 TYR HXT H N N 436 VAL N N N N 437 VAL CA C N S 438 VAL C C N N 439 VAL O O N N 440 VAL CB C N N 441 VAL CG1 C N N 442 VAL CG2 C N N 443 VAL OXT O N N 444 VAL H H N N 445 VAL H2 H N N 446 VAL HA H N N 447 VAL HB H N N 448 VAL HG11 H N N 449 VAL HG12 H N N 450 VAL HG13 H N N 451 VAL HG21 H N N 452 VAL HG22 H N N 453 VAL HG23 H N N 454 VAL HXT H N N 455 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CEF S1 C1 sing N N 70 CEF S1 C6 sing N N 71 CEF C1 C2 sing N N 72 CEF C1 H1 sing N N 73 CEF C1 H2 sing N N 74 CEF C2 C3 doub N N 75 CEF C2 C4 sing N N 76 CEF C3 H3 sing N N 77 CEF C3 H4 sing N N 78 CEF C4 C5 sing N N 79 CEF C4 N1 doub N N 80 CEF C5 O1 doub N N 81 CEF C5 O2 sing N N 82 CEF O2 H5 sing N N 83 CEF N1 C6 sing N N 84 CEF C6 C7 sing N N 85 CEF C6 H6 sing N N 86 CEF C7 C8 sing N N 87 CEF C7 N2 sing N N 88 CEF C7 H7 sing N N 89 CEF C8 O3 doub N N 90 CEF C8 H8 sing N N 91 CEF N2 C9 sing N N 92 CEF N2 H9 sing N N 93 CEF C9 O4 doub N N 94 CEF C9 C10 sing N N 95 CEF C10 N3 doub N Z 96 CEF C10 C12 sing N N 97 CEF N3 O5 sing N N 98 CEF O5 C11 sing N N 99 CEF C11 H10 sing N N 100 CEF C11 H11 sing N N 101 CEF C11 H12 sing N N 102 CEF C12 C13 doub Y N 103 CEF C12 N5 sing Y N 104 CEF C13 S2 sing Y N 105 CEF C13 H13 sing N N 106 CEF S2 C14 sing Y N 107 CEF C14 N4 sing N N 108 CEF C14 N5 doub Y N 109 CEF N4 H14 sing N N 110 CEF N4 H15 sing N N 111 GLN N CA sing N N 112 GLN N H sing N N 113 GLN N H2 sing N N 114 GLN CA C sing N N 115 GLN CA CB sing N N 116 GLN CA HA sing N N 117 GLN C O doub N N 118 GLN C OXT sing N N 119 GLN CB CG sing N N 120 GLN CB HB2 sing N N 121 GLN CB HB3 sing N N 122 GLN CG CD sing N N 123 GLN CG HG2 sing N N 124 GLN CG HG3 sing N N 125 GLN CD OE1 doub N N 126 GLN CD NE2 sing N N 127 GLN NE2 HE21 sing N N 128 GLN NE2 HE22 sing N N 129 GLN OXT HXT sing N N 130 GLU N CA sing N N 131 GLU N H sing N N 132 GLU N H2 sing N N 133 GLU CA C sing N N 134 GLU CA CB sing N N 135 GLU CA HA sing N N 136 GLU C O doub N N 137 GLU C OXT sing N N 138 GLU CB CG sing N N 139 GLU CB HB2 sing N N 140 GLU CB HB3 sing N N 141 GLU CG CD sing N N 142 GLU CG HG2 sing N N 143 GLU CG HG3 sing N N 144 GLU CD OE1 doub N N 145 GLU CD OE2 sing N N 146 GLU OE2 HE2 sing N N 147 GLU OXT HXT sing N N 148 GLY N CA sing N N 149 GLY N H sing N N 150 GLY N H2 sing N N 151 GLY CA C sing N N 152 GLY CA HA2 sing N N 153 GLY CA HA3 sing N N 154 GLY C O doub N N 155 GLY C OXT sing N N 156 GLY OXT HXT sing N N 157 GOL C1 O1 sing N N 158 GOL C1 C2 sing N N 159 GOL C1 H11 sing N N 160 GOL C1 H12 sing N N 161 GOL O1 HO1 sing N N 162 GOL C2 O2 sing N N 163 GOL C2 C3 sing N N 164 GOL C2 H2 sing N N 165 GOL O2 HO2 sing N N 166 GOL C3 O3 sing N N 167 GOL C3 H31 sing N N 168 GOL C3 H32 sing N N 169 GOL O3 HO3 sing N N 170 HIS N CA sing N N 171 HIS N H sing N N 172 HIS N H2 sing N N 173 HIS CA C sing N N 174 HIS CA CB sing N N 175 HIS CA HA sing N N 176 HIS C O doub N N 177 HIS C OXT sing N N 178 HIS CB CG sing N N 179 HIS CB HB2 sing N N 180 HIS CB HB3 sing N N 181 HIS CG ND1 sing Y N 182 HIS CG CD2 doub Y N 183 HIS ND1 CE1 doub Y N 184 HIS ND1 HD1 sing N N 185 HIS CD2 NE2 sing Y N 186 HIS CD2 HD2 sing N N 187 HIS CE1 NE2 sing Y N 188 HIS CE1 HE1 sing N N 189 HIS NE2 HE2 sing N N 190 HIS OXT HXT sing N N 191 HOH O H1 sing N N 192 HOH O H2 sing N N 193 ILE N CA sing N N 194 ILE N H sing N N 195 ILE N H2 sing N N 196 ILE CA C sing N N 197 ILE CA CB sing N N 198 ILE CA HA sing N N 199 ILE C O doub N N 200 ILE C OXT sing N N 201 ILE CB CG1 sing N N 202 ILE CB CG2 sing N N 203 ILE CB HB sing N N 204 ILE CG1 CD1 sing N N 205 ILE CG1 HG12 sing N N 206 ILE CG1 HG13 sing N N 207 ILE CG2 HG21 sing N N 208 ILE CG2 HG22 sing N N 209 ILE CG2 HG23 sing N N 210 ILE CD1 HD11 sing N N 211 ILE CD1 HD12 sing N N 212 ILE CD1 HD13 sing N N 213 ILE OXT HXT sing N N 214 LEU N CA sing N N 215 LEU N H sing N N 216 LEU N H2 sing N N 217 LEU CA C sing N N 218 LEU CA CB sing N N 219 LEU CA HA sing N N 220 LEU C O doub N N 221 LEU C OXT sing N N 222 LEU CB CG sing N N 223 LEU CB HB2 sing N N 224 LEU CB HB3 sing N N 225 LEU CG CD1 sing N N 226 LEU CG CD2 sing N N 227 LEU CG HG sing N N 228 LEU CD1 HD11 sing N N 229 LEU CD1 HD12 sing N N 230 LEU CD1 HD13 sing N N 231 LEU CD2 HD21 sing N N 232 LEU CD2 HD22 sing N N 233 LEU CD2 HD23 sing N N 234 LEU OXT HXT sing N N 235 LYS N CA sing N N 236 LYS N H sing N N 237 LYS N H2 sing N N 238 LYS CA C sing N N 239 LYS CA CB sing N N 240 LYS CA HA sing N N 241 LYS C O doub N N 242 LYS C OXT sing N N 243 LYS CB CG sing N N 244 LYS CB HB2 sing N N 245 LYS CB HB3 sing N N 246 LYS CG CD sing N N 247 LYS CG HG2 sing N N 248 LYS CG HG3 sing N N 249 LYS CD CE sing N N 250 LYS CD HD2 sing N N 251 LYS CD HD3 sing N N 252 LYS CE NZ sing N N 253 LYS CE HE2 sing N N 254 LYS CE HE3 sing N N 255 LYS NZ HZ1 sing N N 256 LYS NZ HZ2 sing N N 257 LYS NZ HZ3 sing N N 258 LYS OXT HXT sing N N 259 MET N CA sing N N 260 MET N H sing N N 261 MET N H2 sing N N 262 MET CA C sing N N 263 MET CA CB sing N N 264 MET CA HA sing N N 265 MET C O doub N N 266 MET C OXT sing N N 267 MET CB CG sing N N 268 MET CB HB2 sing N N 269 MET CB HB3 sing N N 270 MET CG SD sing N N 271 MET CG HG2 sing N N 272 MET CG HG3 sing N N 273 MET SD CE sing N N 274 MET CE HE1 sing N N 275 MET CE HE2 sing N N 276 MET CE HE3 sing N N 277 MET OXT HXT sing N N 278 PGE C1 O1 sing N N 279 PGE C1 C2 sing N N 280 PGE C1 H1 sing N N 281 PGE C1 H12 sing N N 282 PGE O1 HO1 sing N N 283 PGE C2 O2 sing N N 284 PGE C2 H2 sing N N 285 PGE C2 H22 sing N N 286 PGE O2 C3 sing N N 287 PGE C3 C4 sing N N 288 PGE C3 H3 sing N N 289 PGE C3 H32 sing N N 290 PGE C4 O3 sing N N 291 PGE C4 H4 sing N N 292 PGE C4 H42 sing N N 293 PGE O4 C6 sing N N 294 PGE O4 HO4 sing N N 295 PGE C6 C5 sing N N 296 PGE C6 H6 sing N N 297 PGE C6 H62 sing N N 298 PGE C5 O3 sing N N 299 PGE C5 H5 sing N N 300 PGE C5 H52 sing N N 301 PHE N CA sing N N 302 PHE N H sing N N 303 PHE N H2 sing N N 304 PHE CA C sing N N 305 PHE CA CB sing N N 306 PHE CA HA sing N N 307 PHE C O doub N N 308 PHE C OXT sing N N 309 PHE CB CG sing N N 310 PHE CB HB2 sing N N 311 PHE CB HB3 sing N N 312 PHE CG CD1 doub Y N 313 PHE CG CD2 sing Y N 314 PHE CD1 CE1 sing Y N 315 PHE CD1 HD1 sing N N 316 PHE CD2 CE2 doub Y N 317 PHE CD2 HD2 sing N N 318 PHE CE1 CZ doub Y N 319 PHE CE1 HE1 sing N N 320 PHE CE2 CZ sing Y N 321 PHE CE2 HE2 sing N N 322 PHE CZ HZ sing N N 323 PHE OXT HXT sing N N 324 PRO N CA sing N N 325 PRO N CD sing N N 326 PRO N H sing N N 327 PRO CA C sing N N 328 PRO CA CB sing N N 329 PRO CA HA sing N N 330 PRO C O doub N N 331 PRO C OXT sing N N 332 PRO CB CG sing N N 333 PRO CB HB2 sing N N 334 PRO CB HB3 sing N N 335 PRO CG CD sing N N 336 PRO CG HG2 sing N N 337 PRO CG HG3 sing N N 338 PRO CD HD2 sing N N 339 PRO CD HD3 sing N N 340 PRO OXT HXT sing N N 341 SER N CA sing N N 342 SER N H sing N N 343 SER N H2 sing N N 344 SER CA C sing N N 345 SER CA CB sing N N 346 SER CA HA sing N N 347 SER C O doub N N 348 SER C OXT sing N N 349 SER CB OG sing N N 350 SER CB HB2 sing N N 351 SER CB HB3 sing N N 352 SER OG HG sing N N 353 SER OXT HXT sing N N 354 THR N CA sing N N 355 THR N H sing N N 356 THR N H2 sing N N 357 THR CA C sing N N 358 THR CA CB sing N N 359 THR CA HA sing N N 360 THR C O doub N N 361 THR C OXT sing N N 362 THR CB OG1 sing N N 363 THR CB CG2 sing N N 364 THR CB HB sing N N 365 THR OG1 HG1 sing N N 366 THR CG2 HG21 sing N N 367 THR CG2 HG22 sing N N 368 THR CG2 HG23 sing N N 369 THR OXT HXT sing N N 370 TRP N CA sing N N 371 TRP N H sing N N 372 TRP N H2 sing N N 373 TRP CA C sing N N 374 TRP CA CB sing N N 375 TRP CA HA sing N N 376 TRP C O doub N N 377 TRP C OXT sing N N 378 TRP CB CG sing N N 379 TRP CB HB2 sing N N 380 TRP CB HB3 sing N N 381 TRP CG CD1 doub Y N 382 TRP CG CD2 sing Y N 383 TRP CD1 NE1 sing Y N 384 TRP CD1 HD1 sing N N 385 TRP CD2 CE2 doub Y N 386 TRP CD2 CE3 sing Y N 387 TRP NE1 CE2 sing Y N 388 TRP NE1 HE1 sing N N 389 TRP CE2 CZ2 sing Y N 390 TRP CE3 CZ3 doub Y N 391 TRP CE3 HE3 sing N N 392 TRP CZ2 CH2 doub Y N 393 TRP CZ2 HZ2 sing N N 394 TRP CZ3 CH2 sing Y N 395 TRP CZ3 HZ3 sing N N 396 TRP CH2 HH2 sing N N 397 TRP OXT HXT sing N N 398 TYR N CA sing N N 399 TYR N H sing N N 400 TYR N H2 sing N N 401 TYR CA C sing N N 402 TYR CA CB sing N N 403 TYR CA HA sing N N 404 TYR C O doub N N 405 TYR C OXT sing N N 406 TYR CB CG sing N N 407 TYR CB HB2 sing N N 408 TYR CB HB3 sing N N 409 TYR CG CD1 doub Y N 410 TYR CG CD2 sing Y N 411 TYR CD1 CE1 sing Y N 412 TYR CD1 HD1 sing N N 413 TYR CD2 CE2 doub Y N 414 TYR CD2 HD2 sing N N 415 TYR CE1 CZ doub Y N 416 TYR CE1 HE1 sing N N 417 TYR CE2 CZ sing Y N 418 TYR CE2 HE2 sing N N 419 TYR CZ OH sing N N 420 TYR OH HH sing N N 421 TYR OXT HXT sing N N 422 VAL N CA sing N N 423 VAL N H sing N N 424 VAL N H2 sing N N 425 VAL CA C sing N N 426 VAL CA CB sing N N 427 VAL CA HA sing N N 428 VAL C O doub N N 429 VAL C OXT sing N N 430 VAL CB CG1 sing N N 431 VAL CB CG2 sing N N 432 VAL CB HB sing N N 433 VAL CG1 HG11 sing N N 434 VAL CG1 HG12 sing N N 435 VAL CG1 HG13 sing N N 436 VAL CG2 HG21 sing N N 437 VAL CG2 HG22 sing N N 438 VAL CG2 HG23 sing N N 439 VAL OXT HXT sing N N 440 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI164794 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6VBC _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9OSL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.020092 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016821 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008855 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #