data_9P0P # _entry.id 9P0P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9P0P pdb_00009p0p 10.2210/pdb9p0p/pdb WWPDB D_1000296835 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-07-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9P0P _pdbx_database_status.recvd_initial_deposition_date 2025-06-07 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id IDP91785 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_contact_author.id 2 _pdbx_contact_author.email alexei.savchenko@ucalgary.ca _pdbx_contact_author.name_first Alexei _pdbx_contact_author.name_last Savchenko _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5256-9237 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stogios, P.J.' 1 ? 'Skarina, T.' 2 ? 'Kim, Y.' 3 ? 'Di Leo, R.' 4 ? 'Savchenko, A.' 5 ? 'Joachimiak, A.' 6 ? 'Satchell, K.J.F.' 7 ? 'Center for Structural Biology of Infectious Diseases (CSBID)' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of 23S rRNA methyltransferase Cfr, apoenzyme' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Stogios, P.J.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribosomal RNA large subunit methyltransferase Cfr' 39911.598 1 2.1.1.224 N2K,N4G,F15W,I26M,S39T,K45T,V46N,L50Q,L68I,K86D,N87G,N94I,S172V,I200L,H243Y,L246K,N269K,H323N ? ? 2 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '23S rRNA (adenine(2503)-C(8))-methyltransferase,23S rRNA m8A2503 methyltransferase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKFGNKTKYGKIQEWLRSNNEPDYRMKQITNAIFKQRITRFEDMTNLPKQLREDLINNFGETVLNIKILAEQNSEQVTKV LFEVSDGERVETVIMKYKAGWESFCISSQCGCNFGCKFCATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEA LANRQVFDALDVFTDPNLFALSPRRLSISTIGIIPSIKKLTQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNIL DEYIRKTSRKVYIAYIMLPGVNDSLEHAKEVVSLLKSRYKSGKLYHVNLIRYNPTISAPEMYGEANEGQVEAFYKVLKSA GINVTIRSQFGIDIDAACGQLYGNYQNSQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MKFGNKTKYGKIQEWLRSNNEPDYRMKQITNAIFKQRITRFEDMTNLPKQLREDLINNFGETVLNIKILAEQNSEQVTKV LFEVSDGERVETVIMKYKAGWESFCISSQCGCNFGCKFCATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEA LANRQVFDALDVFTDPNLFALSPRRLSISTIGIIPSIKKLTQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNIL DEYIRKTSRKVYIAYIMLPGVNDSLEHAKEVVSLLKSRYKSGKLYHVNLIRYNPTISAPEMYGEANEGQVEAFYKVLKSA GINVTIRSQFGIDIDAACGQLYGNYQNSQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier IDP91785 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 PHE n 1 4 GLY n 1 5 ASN n 1 6 LYS n 1 7 THR n 1 8 LYS n 1 9 TYR n 1 10 GLY n 1 11 LYS n 1 12 ILE n 1 13 GLN n 1 14 GLU n 1 15 TRP n 1 16 LEU n 1 17 ARG n 1 18 SER n 1 19 ASN n 1 20 ASN n 1 21 GLU n 1 22 PRO n 1 23 ASP n 1 24 TYR n 1 25 ARG n 1 26 MET n 1 27 LYS n 1 28 GLN n 1 29 ILE n 1 30 THR n 1 31 ASN n 1 32 ALA n 1 33 ILE n 1 34 PHE n 1 35 LYS n 1 36 GLN n 1 37 ARG n 1 38 ILE n 1 39 THR n 1 40 ARG n 1 41 PHE n 1 42 GLU n 1 43 ASP n 1 44 MET n 1 45 THR n 1 46 ASN n 1 47 LEU n 1 48 PRO n 1 49 LYS n 1 50 GLN n 1 51 LEU n 1 52 ARG n 1 53 GLU n 1 54 ASP n 1 55 LEU n 1 56 ILE n 1 57 ASN n 1 58 ASN n 1 59 PHE n 1 60 GLY n 1 61 GLU n 1 62 THR n 1 63 VAL n 1 64 LEU n 1 65 ASN n 1 66 ILE n 1 67 LYS n 1 68 ILE n 1 69 LEU n 1 70 ALA n 1 71 GLU n 1 72 GLN n 1 73 ASN n 1 74 SER n 1 75 GLU n 1 76 GLN n 1 77 VAL n 1 78 THR n 1 79 LYS n 1 80 VAL n 1 81 LEU n 1 82 PHE n 1 83 GLU n 1 84 VAL n 1 85 SER n 1 86 ASP n 1 87 GLY n 1 88 GLU n 1 89 ARG n 1 90 VAL n 1 91 GLU n 1 92 THR n 1 93 VAL n 1 94 ILE n 1 95 MET n 1 96 LYS n 1 97 TYR n 1 98 LYS n 1 99 ALA n 1 100 GLY n 1 101 TRP n 1 102 GLU n 1 103 SER n 1 104 PHE n 1 105 CYS n 1 106 ILE n 1 107 SER n 1 108 SER n 1 109 GLN n 1 110 CYS n 1 111 GLY n 1 112 CYS n 1 113 ASN n 1 114 PHE n 1 115 GLY n 1 116 CYS n 1 117 LYS n 1 118 PHE n 1 119 CYS n 1 120 ALA n 1 121 THR n 1 122 GLY n 1 123 ASP n 1 124 ILE n 1 125 GLY n 1 126 LEU n 1 127 LYS n 1 128 LYS n 1 129 ASN n 1 130 LEU n 1 131 THR n 1 132 VAL n 1 133 ASP n 1 134 GLU n 1 135 ILE n 1 136 THR n 1 137 ASP n 1 138 GLN n 1 139 VAL n 1 140 LEU n 1 141 TYR n 1 142 PHE n 1 143 HIS n 1 144 LEU n 1 145 LEU n 1 146 GLY n 1 147 HIS n 1 148 GLN n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ILE n 1 153 SER n 1 154 PHE n 1 155 MET n 1 156 GLY n 1 157 MET n 1 158 GLY n 1 159 GLU n 1 160 ALA n 1 161 LEU n 1 162 ALA n 1 163 ASN n 1 164 ARG n 1 165 GLN n 1 166 VAL n 1 167 PHE n 1 168 ASP n 1 169 ALA n 1 170 LEU n 1 171 ASP n 1 172 VAL n 1 173 PHE n 1 174 THR n 1 175 ASP n 1 176 PRO n 1 177 ASN n 1 178 LEU n 1 179 PHE n 1 180 ALA n 1 181 LEU n 1 182 SER n 1 183 PRO n 1 184 ARG n 1 185 ARG n 1 186 LEU n 1 187 SER n 1 188 ILE n 1 189 SER n 1 190 THR n 1 191 ILE n 1 192 GLY n 1 193 ILE n 1 194 ILE n 1 195 PRO n 1 196 SER n 1 197 ILE n 1 198 LYS n 1 199 LYS n 1 200 LEU n 1 201 THR n 1 202 GLN n 1 203 GLU n 1 204 TYR n 1 205 PRO n 1 206 GLN n 1 207 VAL n 1 208 ASN n 1 209 LEU n 1 210 THR n 1 211 PHE n 1 212 SER n 1 213 LEU n 1 214 HIS n 1 215 SER n 1 216 PRO n 1 217 TYR n 1 218 SER n 1 219 GLU n 1 220 GLU n 1 221 ARG n 1 222 SER n 1 223 LYS n 1 224 LEU n 1 225 MET n 1 226 PRO n 1 227 ILE n 1 228 ASN n 1 229 ASP n 1 230 ARG n 1 231 TYR n 1 232 PRO n 1 233 ILE n 1 234 ASP n 1 235 GLU n 1 236 VAL n 1 237 MET n 1 238 ASN n 1 239 ILE n 1 240 LEU n 1 241 ASP n 1 242 GLU n 1 243 TYR n 1 244 ILE n 1 245 ARG n 1 246 LYS n 1 247 THR n 1 248 SER n 1 249 ARG n 1 250 LYS n 1 251 VAL n 1 252 TYR n 1 253 ILE n 1 254 ALA n 1 255 TYR n 1 256 ILE n 1 257 MET n 1 258 LEU n 1 259 PRO n 1 260 GLY n 1 261 VAL n 1 262 ASN n 1 263 ASP n 1 264 SER n 1 265 LEU n 1 266 GLU n 1 267 HIS n 1 268 ALA n 1 269 LYS n 1 270 GLU n 1 271 VAL n 1 272 VAL n 1 273 SER n 1 274 LEU n 1 275 LEU n 1 276 LYS n 1 277 SER n 1 278 ARG n 1 279 TYR n 1 280 LYS n 1 281 SER n 1 282 GLY n 1 283 LYS n 1 284 LEU n 1 285 TYR n 1 286 HIS n 1 287 VAL n 1 288 ASN n 1 289 LEU n 1 290 ILE n 1 291 ARG n 1 292 TYR n 1 293 ASN n 1 294 PRO n 1 295 THR n 1 296 ILE n 1 297 SER n 1 298 ALA n 1 299 PRO n 1 300 GLU n 1 301 MET n 1 302 TYR n 1 303 GLY n 1 304 GLU n 1 305 ALA n 1 306 ASN n 1 307 GLU n 1 308 GLY n 1 309 GLN n 1 310 VAL n 1 311 GLU n 1 312 ALA n 1 313 PHE n 1 314 TYR n 1 315 LYS n 1 316 VAL n 1 317 LEU n 1 318 LYS n 1 319 SER n 1 320 ALA n 1 321 GLY n 1 322 ILE n 1 323 ASN n 1 324 VAL n 1 325 THR n 1 326 ILE n 1 327 ARG n 1 328 SER n 1 329 GLN n 1 330 PHE n 1 331 GLY n 1 332 ILE n 1 333 ASP n 1 334 ILE n 1 335 ASP n 1 336 ALA n 1 337 ALA n 1 338 CYS n 1 339 GLY n 1 340 GLN n 1 341 LEU n 1 342 TYR n 1 343 GLY n 1 344 ASN n 1 345 TYR n 1 346 GLN n 1 347 ASN n 1 348 SER n 1 349 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 349 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene cfr _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3 Gold' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG53 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 GLY 111 111 ? ? ? A . n A 1 112 CYS 112 112 ? ? ? A . n A 1 113 ASN 113 113 ? ? ? A . n A 1 114 PHE 114 114 ? ? ? A . n A 1 115 GLY 115 115 ? ? ? A . n A 1 116 CYS 116 116 ? ? ? A . n A 1 117 LYS 117 117 ? ? ? A . n A 1 118 PHE 118 118 ? ? ? A . n A 1 119 CYS 119 119 ? ? ? A . n A 1 120 ALA 120 120 ? ? ? A . n A 1 121 THR 121 121 ? ? ? A . n A 1 122 GLY 122 122 ? ? ? A . n A 1 123 ASP 123 123 ? ? ? A . n A 1 124 ILE 124 124 ? ? ? A . n A 1 125 GLY 125 125 ? ? ? A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 GLN 206 206 206 GLN GLN A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 ASN 208 208 208 ASN ASN A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 HIS 214 214 214 HIS HIS A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 LYS 223 223 223 LYS LYS A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 MET 225 225 225 MET MET A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 ILE 227 227 227 ILE ILE A . n A 1 228 ASN 228 228 228 ASN ASN A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 TYR 231 231 231 TYR TYR A . n A 1 232 PRO 232 232 232 PRO PRO A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 GLU 235 235 235 GLU GLU A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 MET 237 237 237 MET MET A . n A 1 238 ASN 238 238 238 ASN ASN A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 TYR 243 243 243 TYR TYR A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 LYS 250 250 250 LYS LYS A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 TYR 252 252 252 TYR TYR A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 TYR 255 255 255 TYR TYR A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 MET 257 257 257 MET MET A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 ASN 262 262 262 ASN ASN A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 SER 264 264 264 SER SER A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 HIS 267 267 267 HIS HIS A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 LYS 276 276 276 LYS LYS A . n A 1 277 SER 277 277 277 SER SER A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 TYR 279 279 279 TYR TYR A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 LYS 283 283 283 LYS LYS A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 TYR 285 285 285 TYR TYR A . n A 1 286 HIS 286 286 286 HIS HIS A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 ASN 288 288 288 ASN ASN A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 ARG 291 291 291 ARG ARG A . n A 1 292 TYR 292 292 292 TYR TYR A . n A 1 293 ASN 293 293 293 ASN ASN A . n A 1 294 PRO 294 294 294 PRO PRO A . n A 1 295 THR 295 295 ? ? ? A . n A 1 296 ILE 296 296 ? ? ? A . n A 1 297 SER 297 297 ? ? ? A . n A 1 298 ALA 298 298 ? ? ? A . n A 1 299 PRO 299 299 ? ? ? A . n A 1 300 GLU 300 300 ? ? ? A . n A 1 301 MET 301 301 ? ? ? A . n A 1 302 TYR 302 302 ? ? ? A . n A 1 303 GLY 303 303 ? ? ? A . n A 1 304 GLU 304 304 304 GLU GLU A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 ASN 306 306 306 ASN ASN A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 GLY 308 308 308 GLY GLY A . n A 1 309 GLN 309 309 309 GLN GLN A . n A 1 310 VAL 310 310 310 VAL VAL A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 PHE 313 313 313 PHE PHE A . n A 1 314 TYR 314 314 314 TYR TYR A . n A 1 315 LYS 315 315 315 LYS LYS A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 LEU 317 317 317 LEU LEU A . n A 1 318 LYS 318 318 318 LYS LYS A . n A 1 319 SER 319 319 319 SER SER A . n A 1 320 ALA 320 320 320 ALA ALA A . n A 1 321 GLY 321 321 321 GLY GLY A . n A 1 322 ILE 322 322 322 ILE ILE A . n A 1 323 ASN 323 323 323 ASN ASN A . n A 1 324 VAL 324 324 324 VAL VAL A . n A 1 325 THR 325 325 325 THR THR A . n A 1 326 ILE 326 326 326 ILE ILE A . n A 1 327 ARG 327 327 327 ARG ARG A . n A 1 328 SER 328 328 328 SER SER A . n A 1 329 GLN 329 329 329 GLN GLN A . n A 1 330 PHE 330 330 ? ? ? A . n A 1 331 GLY 331 331 ? ? ? A . n A 1 332 ILE 332 332 ? ? ? A . n A 1 333 ASP 333 333 ? ? ? A . n A 1 334 ILE 334 334 ? ? ? A . n A 1 335 ASP 335 335 ? ? ? A . n A 1 336 ALA 336 336 ? ? ? A . n A 1 337 ALA 337 337 ? ? ? A . n A 1 338 CYS 338 338 ? ? ? A . n A 1 339 GLY 339 339 ? ? ? A . n A 1 340 GLN 340 340 ? ? ? A . n A 1 341 LEU 341 341 ? ? ? A . n A 1 342 TYR 342 342 ? ? ? A . n A 1 343 GLY 343 343 ? ? ? A . n A 1 344 ASN 344 344 ? ? ? A . n A 1 345 TYR 345 345 ? ? ? A . n A 1 346 GLN 346 346 ? ? ? A . n A 1 347 ASN 347 347 ? ? ? A . n A 1 348 SER 348 348 ? ? ? A . n A 1 349 GLN 349 349 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HOH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id HOH _pdbx_nonpoly_scheme.auth_mon_id HOH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MrBUMP ? ? ? . ? 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . ? 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9P0P _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.319 _cell.length_a_esd ? _cell.length_b 58.612 _cell.length_b_esd ? _cell.length_c 115.945 _cell.length_c_esd ? _cell.volume 307977.425 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9P0P _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9P0P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '40% v/v PEG400, 0.1 M HEPES pH 7.5, 7 mM beta-mercaptoethanol, 0.1 M NDSB211' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 64.83 _reflns.entry_id 9P0P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10556 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.42 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 401 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.3 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.325 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.687 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 72.6 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.882 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 84.89 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9P0P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 42.21 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10493 _refine.ls_number_reflns_R_free 919 _refine.ls_number_reflns_R_work 18015 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.90 _refine.ls_percent_reflns_R_free 4.85 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2568 _refine.ls_R_factor_R_free 0.3093 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2541 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 41.3473 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3782 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 42.21 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 2483 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2482 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0047 ? 2526 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.7328 ? 3404 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0474 ? 382 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0042 ? 434 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 17.5373 ? 969 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.50 2.63 . . 102 1962 70.11 . . . . 0.4031 . . . . . . . . . . . . . . . 0.4850 'X-RAY DIFFRACTION' 2.63 2.80 . . 117 2307 82.53 . . . . 0.3518 . . . . . . . . . . . . . . . 0.4031 'X-RAY DIFFRACTION' 2.80 3.01 . . 131 2567 91.74 . . . . 0.3491 . . . . . . . . . . . . . . . 0.4071 'X-RAY DIFFRACTION' 3.01 3.32 . . 148 2771 99.39 . . . . 0.3233 . . . . . . . . . . . . . . . 0.3638 'X-RAY DIFFRACTION' 3.32 3.80 . . 146 2799 99.90 . . . . 0.2631 . . . . . . . . . . . . . . . 0.3285 'X-RAY DIFFRACTION' 3.80 4.78 . . 137 2803 99.93 . . . . 0.2199 . . . . . . . . . . . . . . . 0.2600 'X-RAY DIFFRACTION' 4.78 42.21 . . 138 2806 99.66 . . . . 0.2172 . . . . . . . . . . . . . . . 0.2825 # _struct.entry_id 9P0P _struct.title 'Crystal structure of 23S rRNA methyltransferase Cfr, apoenzyme' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9P0P _struct_keywords.text ;Cfr, antibiotic resistance, 23S rRNA, antimicrobial resistance, methyltransferase, A2503, Structural Genomics, Center for Structural Biology of Infectious Diseases, CSBID, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CFR_STAAU _struct_ref.pdbx_db_accession A5HBL2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNFNNKTKYGKIQEFLRSNNEPDYRIKQITNAIFKQRISRFEDMKVLPKLLREDLINNFGETVLNIKLLAEQNSEQVTKV LFEVSKNERVETVNMKYKAGWESFCISSQCGCNFGCKFCATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEA LANRQVFDALDSFTDPNLFALSPRRLSISTIGIIPSIKKITQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNIL DEHIRLTSRKVYIAYIMLPGVNDSLEHANEVVSLLKSRYKSGKLYHVNLIRYNPTISAPEMYGEANEGQVEAFYKVLKSA GIHVTIRSQFGIDIDAACGQLYGNYQNSQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9P0P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 349 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A5HBL2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 349 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 349 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9P0P LYS A 2 ? UNP A5HBL2 ASN 2 'engineered mutation' 2 1 1 9P0P GLY A 4 ? UNP A5HBL2 ASN 4 'engineered mutation' 4 2 1 9P0P TRP A 15 ? UNP A5HBL2 PHE 15 'engineered mutation' 15 3 1 9P0P MET A 26 ? UNP A5HBL2 ILE 26 'engineered mutation' 26 4 1 9P0P THR A 39 ? UNP A5HBL2 SER 39 'engineered mutation' 39 5 1 9P0P THR A 45 ? UNP A5HBL2 LYS 45 'engineered mutation' 45 6 1 9P0P ASN A 46 ? UNP A5HBL2 VAL 46 'engineered mutation' 46 7 1 9P0P GLN A 50 ? UNP A5HBL2 LEU 50 'engineered mutation' 50 8 1 9P0P ILE A 68 ? UNP A5HBL2 LEU 68 'engineered mutation' 68 9 1 9P0P ASP A 86 ? UNP A5HBL2 LYS 86 'engineered mutation' 86 10 1 9P0P GLY A 87 ? UNP A5HBL2 ASN 87 'engineered mutation' 87 11 1 9P0P ILE A 94 ? UNP A5HBL2 ASN 94 'engineered mutation' 94 12 1 9P0P VAL A 172 ? UNP A5HBL2 SER 172 'engineered mutation' 172 13 1 9P0P LEU A 200 ? UNP A5HBL2 ILE 200 'engineered mutation' 200 14 1 9P0P TYR A 243 ? UNP A5HBL2 HIS 243 'engineered mutation' 243 15 1 9P0P LYS A 246 ? UNP A5HBL2 LEU 246 'engineered mutation' 246 16 1 9P0P LYS A 269 ? UNP A5HBL2 ASN 269 'engineered mutation' 269 17 1 9P0P ASN A 323 ? UNP A5HBL2 HIS 323 'engineered mutation' 323 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? ARG A 17 ? THR A 7 ARG A 17 1 ? 11 HELX_P HELX_P2 AA2 ASP A 23 ? LYS A 35 ? ASP A 23 LYS A 35 1 ? 13 HELX_P HELX_P3 AA3 ARG A 40 ? MET A 44 ? ARG A 40 MET A 44 5 ? 5 HELX_P HELX_P4 AA4 PRO A 48 ? GLY A 60 ? PRO A 48 GLY A 60 1 ? 13 HELX_P HELX_P5 AA5 THR A 131 ? GLY A 146 ? THR A 131 GLY A 146 1 ? 16 HELX_P HELX_P6 AA6 ARG A 164 ? THR A 174 ? ARG A 164 THR A 174 1 ? 11 HELX_P HELX_P7 AA7 SER A 182 ? ARG A 184 ? SER A 182 ARG A 184 5 ? 3 HELX_P HELX_P8 AA8 ILE A 193 ? GLN A 202 ? ILE A 193 GLN A 202 1 ? 10 HELX_P HELX_P9 AA9 TYR A 217 ? LYS A 223 ? TYR A 217 LYS A 223 1 ? 7 HELX_P HELX_P10 AB1 MET A 225 ? ARG A 230 ? MET A 225 ARG A 230 5 ? 6 HELX_P HELX_P11 AB2 PRO A 232 ? SER A 248 ? PRO A 232 SER A 248 1 ? 17 HELX_P HELX_P12 AB3 SER A 264 ? SER A 277 ? SER A 264 SER A 277 1 ? 14 HELX_P HELX_P13 AB4 ARG A 278 ? LYS A 283 ? ARG A 278 LYS A 283 5 ? 6 HELX_P HELX_P14 AB5 GLY A 308 ? ALA A 320 ? GLY A 308 ALA A 320 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel AA1 9 10 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 67 ? ASN A 73 ? LYS A 67 ASN A 73 AA1 2 THR A 78 ? VAL A 84 ? THR A 78 VAL A 84 AA1 3 GLU A 88 ? LYS A 96 ? GLU A 88 LYS A 96 AA1 4 GLU A 102 ? ILE A 106 ? GLU A 102 ILE A 106 AA1 5 SER A 151 ? PHE A 154 ? SER A 151 PHE A 154 AA1 6 LEU A 186 ? THR A 190 ? LEU A 186 THR A 190 AA1 7 ASN A 208 ? SER A 212 ? ASN A 208 SER A 212 AA1 8 VAL A 251 ? ILE A 256 ? VAL A 251 ILE A 256 AA1 9 TYR A 285 ? ILE A 290 ? TYR A 285 ILE A 290 AA1 10 VAL A 324 ? ARG A 327 ? VAL A 324 ARG A 327 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 70 ? N ALA A 70 O LEU A 81 ? O LEU A 81 AA1 2 3 N VAL A 80 ? N VAL A 80 O THR A 92 ? O THR A 92 AA1 3 4 N VAL A 93 ? N VAL A 93 O CYS A 105 ? O CYS A 105 AA1 4 5 N PHE A 104 ? N PHE A 104 O SER A 153 ? O SER A 153 AA1 5 6 N PHE A 154 ? N PHE A 154 O SER A 187 ? O SER A 187 AA1 6 7 N THR A 190 ? N THR A 190 O THR A 210 ? O THR A 210 AA1 7 8 N PHE A 211 ? N PHE A 211 O TYR A 252 ? O TYR A 252 AA1 8 9 N ILE A 253 ? N ILE A 253 O ASN A 288 ? O ASN A 288 AA1 9 10 N VAL A 287 ? N VAL A 287 O THR A 325 ? O THR A 325 # _pdbx_entry_details.entry_id 9P0P _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 69 ? ? 50.74 -114.07 2 1 SER A 74 ? ? -124.48 -141.08 3 1 GLU A 75 ? ? 55.73 87.11 4 1 GLN A 76 ? ? 80.77 -24.22 5 1 SER A 85 ? ? 44.67 -109.42 6 1 ALA A 99 ? ? -63.65 0.92 7 1 LYS A 127 ? ? 61.36 82.96 8 1 ALA A 160 ? ? -82.45 34.01 9 1 LEU A 178 ? ? -112.39 -112.55 10 1 LEU A 213 ? ? -91.77 -74.01 11 1 HIS A 214 ? ? 76.07 -5.11 12 1 SER A 215 ? ? -174.07 126.29 13 1 ASP A 263 ? ? -108.14 42.94 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Biology of Infectious Diseases' _pdbx_SG_project.initial_of_center CSBID # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -37.3169166173 -19.5827209925 12.308454464 0.578387992181 ? -0.0796827273204 ? 0.113823927513 ? 0.469092042397 ? -0.00965268224362 ? 0.592235907848 ? 9.68642712364 ? 1.56429517638 ? 2.05262623707 ? 7.5522492727 ? 2.53254961387 ? 7.67997411946 ? -0.498836099195 ? 0.209412464922 ? -0.343291666128 ? -0.54935645309 ? 0.129228677247 ? 0.733139588494 ? 0.165052721666 ? -0.278671212357 ? 0.324218073155 ? 2 'X-RAY DIFFRACTION' ? refined -21.189235802 -21.8242784507 15.3231213249 0.67099723381 ? 0.205172860524 ? 0.175380099957 ? 0.455773920623 ? -0.0421254251274 ? 0.556222669537 ? 8.02357916392 ? 2.72800976694 ? 0.407827678556 ? 5.75854970499 ? -0.695382649742 ? 4.13823300069 ? -0.427920458835 ? -0.372935601281 ? -0.901413418059 ? -0.0861259952833 ? -0.0114522327013 ? -0.645207627466 ? 0.597588467912 ? 0.184111545811 ? 0.39432682952 ? 3 'X-RAY DIFFRACTION' ? refined -15.4506366751 -8.21533227497 23.6443618613 0.63642467372 ? 0.0648066633623 ? 0.0824884067518 ? 0.688951376851 ? 0.10363149532 ? 0.607900416583 ? 10.000466946 ? 2.11251071087 ? 3.0560558768 ? 7.91869787998 ? 2.06835799196 ? 6.36563261639 ? -0.812069266666 ? -0.903608096682 ? 0.554223844547 ? 1.11522057448 ? 0.0513636098805 ? -0.70212301918 ? 1.82108348349 ? 0.378748659424 ? 0.163444795267 ? 4 'X-RAY DIFFRACTION' ? refined -19.0846650765 -8.86037519361 14.00484864 0.429710276391 ? -0.113241976721 ? -0.0191938103652 ? 0.439627394597 ? -0.0224586967115 ? 0.477618829728 ? 4.80690976422 ? -0.497233950443 ? 1.60899040768 ? 6.34882016133 ? 1.05612176028 ? 7.46915557476 ? -0.247239562935 ? 0.389840602217 ? -0.0934708125905 ? -0.211159342504 ? 0.544244610703 ? -0.766837183853 ? -0.249934959273 ? 1.013489377 ? -0.116045770002 ? 5 'X-RAY DIFFRACTION' ? refined -19.2784219722 7.27001363247 10.6328302871 0.69826046459 ? -0.0469608246624 ? -0.0159351310745 ? 0.561267025944 ? -0.052606299809 ? 0.391915932275 ? 3.64075510932 ? 2.83458278116 ? 0.573934609951 ? 6.9720729795 ? -0.01923029324 ? 2.32240775333 ? -0.292110535492 ? 0.479391806099 ? 0.215363028017 ? -1.26972699857 ? 0.279391614418 ? 0.229705851097 ? -0.464520666228 ? 0.328014378333 ? 0.095752020679 ? 6 'X-RAY DIFFRACTION' ? refined -7.97535098414 15.4519235342 22.3956146337 0.730755285962 ? -0.246931790722 ? 0.140191093288 ? 0.582268525964 ? -0.0492866769143 ? 0.528787250758 ? 8.3549493141 ? -0.810680570887 ? 2.35055447042 ? 8.52096138871 ? 0.793248012899 ? 7.87750016544 ? -0.104192041512 ? -0.100218595844 ? 0.340923186082 ? -0.311016483718 ? 0.0749682173933 ? -1.12953378764 ? -0.958421918055 ? 0.95146185141 ? 0.0788208584603 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 1 ? A 48 A 48 ? ? ;chain 'A' and (resid 1 through 48 ) ; 2 'X-RAY DIFFRACTION' 2 A 49 A 49 ? A 87 A 87 ? ? ;chain 'A' and (resid 49 through 87 ) ; 3 'X-RAY DIFFRACTION' 3 A 88 A 88 ? A 106 A 106 ? ? ;chain 'A' and (resid 88 through 106 ) ; 4 'X-RAY DIFFRACTION' 4 A 107 A 107 ? A 149 A 164 ? ? ;chain 'A' and (resid 107 through 164 ) ; 5 'X-RAY DIFFRACTION' 5 A 150 A 165 ? A 232 A 247 ? ? ;chain 'A' and (resid 165 through 247 ) ; 6 'X-RAY DIFFRACTION' 6 A 233 A 248 ? A 305 A 329 ? ? ;chain 'A' and (resid 248 through 329 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 111 ? A GLY 111 2 1 Y 1 A CYS 112 ? A CYS 112 3 1 Y 1 A ASN 113 ? A ASN 113 4 1 Y 1 A PHE 114 ? A PHE 114 5 1 Y 1 A GLY 115 ? A GLY 115 6 1 Y 1 A CYS 116 ? A CYS 116 7 1 Y 1 A LYS 117 ? A LYS 117 8 1 Y 1 A PHE 118 ? A PHE 118 9 1 Y 1 A CYS 119 ? A CYS 119 10 1 Y 1 A ALA 120 ? A ALA 120 11 1 Y 1 A THR 121 ? A THR 121 12 1 Y 1 A GLY 122 ? A GLY 122 13 1 Y 1 A ASP 123 ? A ASP 123 14 1 Y 1 A ILE 124 ? A ILE 124 15 1 Y 1 A GLY 125 ? A GLY 125 16 1 Y 1 A THR 295 ? A THR 295 17 1 Y 1 A ILE 296 ? A ILE 296 18 1 Y 1 A SER 297 ? A SER 297 19 1 Y 1 A ALA 298 ? A ALA 298 20 1 Y 1 A PRO 299 ? A PRO 299 21 1 Y 1 A GLU 300 ? A GLU 300 22 1 Y 1 A MET 301 ? A MET 301 23 1 Y 1 A TYR 302 ? A TYR 302 24 1 Y 1 A GLY 303 ? A GLY 303 25 1 Y 1 A PHE 330 ? A PHE 330 26 1 Y 1 A GLY 331 ? A GLY 331 27 1 Y 1 A ILE 332 ? A ILE 332 28 1 Y 1 A ASP 333 ? A ASP 333 29 1 Y 1 A ILE 334 ? A ILE 334 30 1 Y 1 A ASP 335 ? A ASP 335 31 1 Y 1 A ALA 336 ? A ALA 336 32 1 Y 1 A ALA 337 ? A ALA 337 33 1 Y 1 A CYS 338 ? A CYS 338 34 1 Y 1 A GLY 339 ? A GLY 339 35 1 Y 1 A GLN 340 ? A GLN 340 36 1 Y 1 A LEU 341 ? A LEU 341 37 1 Y 1 A TYR 342 ? A TYR 342 38 1 Y 1 A GLY 343 ? A GLY 343 39 1 Y 1 A ASN 344 ? A ASN 344 40 1 Y 1 A TYR 345 ? A TYR 345 41 1 Y 1 A GLN 346 ? A GLN 346 42 1 Y 1 A ASN 347 ? A ASN 347 43 1 Y 1 A SER 348 ? A SER 348 44 1 Y 1 A GLN 349 ? A GLN 349 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272201700060C 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 75N93022C00035 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6FZ6 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9P0P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022066 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017061 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008625 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #