data_9PFE # _entry.id 9PFE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9PFE pdb_00009pfe 10.2210/pdb9pfe/pdb WWPDB D_1000297582 ? ? BMRB 31260 ? 10.13018/BMR31260 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2026-05-13 ? 2 'Structure model' 1 1 2026-06-24 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation_author.identifier_ORCID' 8 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9PFE _pdbx_database_status.recvd_initial_deposition_date 2025-07-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of slow skeletal Myosin Binding Protein-C M-domain tri-helix bundle' _pdbx_database_related.db_id 31260 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 4 akontrogianni@som.umaryland.edu Aikaterini Kontrogianni-Konstantopoulos ? 'principal investigator/group leader' 0000-0003-3948-1959 5 wrightnt@jmu.edu Nathan Wright T 'principal investigator/group leader' 0000-0003-0177-6129 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Iyer, A.' 1 ? 'Wright, N.T.' 2 ? 'Kontrogianni-Konstantopoulos, A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 123 _citation.language ? _citation.page_first e2529897123 _citation.page_last e2529897123 _citation.title 'From bedside to bench: A multimodal approach uncovering the molecular basis of the MYBPC1 -linked Myotrem myopathy.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2529897123 _citation.pdbx_database_id_PubMed 42224599 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Iyer, A.S.' 1 ? primary 'Wright, N.T.' 2 0000-0003-0177-6129 primary 'Cook, M.E.' 3 ? primary 'Takagi, Y.' 4 ? primary 'Johnson, B.A.' 5 0000-0001-8445-5368 primary 'Biancalana, V.' 6 ? primary 'Massier, M.' 7 0009-0002-3535-0847 primary 'Spodenkiewicz, M.' 8 ? primary 'Poirsier, C.' 9 ? primary 'Vallecillo, B.' 10 ? primary 'Constant Boyer, F.' 11 ? primary 'Pineau, C.' 12 ? primary 'Hensley, L.' 13 ? primary 'Sellers, J.R.' 14 0000-0001-6296-564X primary 'Varney, K.M.' 15 ? primary 'Weber, D.J.' 16 0000-0002-8824-1110 primary 'Kontrogianni-Konstantopoulos, A.' 17 0000-0003-3948-1959 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Isoform 4 of Myosin-binding protein C, slow-type' _entity.formula_weight 5507.521 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ;The first methionine is an initiating methionine that is not part of the native sMyBP-C sequence; it was necessary for recombinant expression of the protein. ; # _entity_name_com.entity_id 1 _entity_name_com.name 'Slow MyBP-C,C-protein,skeletal muscle slow isoform' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEK _entity_poly.pdbx_seq_one_letter_code_can MPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 GLN n 1 4 VAL n 1 5 ASP n 1 6 VAL n 1 7 TRP n 1 8 GLU n 1 9 LEU n 1 10 LEU n 1 11 LYS n 1 12 ASN n 1 13 ALA n 1 14 LYS n 1 15 PRO n 1 16 SER n 1 17 GLU n 1 18 TYR n 1 19 GLU n 1 20 LYS n 1 21 ILE n 1 22 ALA n 1 23 PHE n 1 24 GLN n 1 25 TYR n 1 26 GLY n 1 27 ILE n 1 28 THR n 1 29 ASP n 1 30 LEU n 1 31 ARG n 1 32 GLY n 1 33 MET n 1 34 LEU n 1 35 LYS n 1 36 ARG n 1 37 LEU n 1 38 LYS n 1 39 ARG n 1 40 MET n 1 41 ARG n 1 42 ARG n 1 43 GLU n 1 44 GLU n 1 45 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 45 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MYBPC1, MYBPCS' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 230 MET MET A . n A 1 2 PRO 2 231 231 PRO PRO A . n A 1 3 GLN 3 232 232 GLN GLN A . n A 1 4 VAL 4 233 233 VAL VAL A . n A 1 5 ASP 5 234 234 ASP ASP A . n A 1 6 VAL 6 235 235 VAL VAL A . n A 1 7 TRP 7 236 236 TRP TRP A . n A 1 8 GLU 8 237 237 GLU GLU A . n A 1 9 LEU 9 238 238 LEU LEU A . n A 1 10 LEU 10 239 239 LEU LEU A . n A 1 11 LYS 11 240 240 LYS LYS A . n A 1 12 ASN 12 241 241 ASN ASN A . n A 1 13 ALA 13 242 242 ALA ALA A . n A 1 14 LYS 14 243 243 LYS LYS A . n A 1 15 PRO 15 244 244 PRO PRO A . n A 1 16 SER 16 245 245 SER SER A . n A 1 17 GLU 17 246 246 GLU GLU A . n A 1 18 TYR 18 247 247 TYR TYR A . n A 1 19 GLU 19 248 248 GLU GLU A . n A 1 20 LYS 20 249 249 LYS LYS A . n A 1 21 ILE 21 250 250 ILE ILE A . n A 1 22 ALA 22 251 251 ALA ALA A . n A 1 23 PHE 23 252 252 PHE PHE A . n A 1 24 GLN 24 253 253 GLN GLN A . n A 1 25 TYR 25 254 254 TYR TYR A . n A 1 26 GLY 26 255 255 GLY GLY A . n A 1 27 ILE 27 256 256 ILE ILE A . n A 1 28 THR 28 257 257 THR THR A . n A 1 29 ASP 29 258 258 ASP ASP A . n A 1 30 LEU 30 259 259 LEU LEU A . n A 1 31 ARG 31 260 260 ARG ARG A . n A 1 32 GLY 32 261 261 GLY GLY A . n A 1 33 MET 33 262 262 MET MET A . n A 1 34 LEU 34 263 263 LEU LEU A . n A 1 35 LYS 35 264 264 LYS LYS A . n A 1 36 ARG 36 265 265 ARG ARG A . n A 1 37 LEU 37 266 266 LEU LEU A . n A 1 38 LYS 38 267 267 LYS LYS A . n A 1 39 ARG 39 268 268 ARG ARG A . n A 1 40 MET 40 269 269 MET MET A . n A 1 41 ARG 41 270 270 ARG ARG A . n A 1 42 ARG 42 271 271 ARG ARG A . n A 1 43 GLU 43 272 272 GLU GLU A . n A 1 44 GLU 44 273 273 GLU GLU A . n A 1 45 LYS 45 274 274 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9PFE _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9PFE _struct.title 'NMR structure of slow skeletal Myosin Binding Protein-C M-domain tri-helix bundle' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9PFE _struct_keywords.text 'contractility regulator, myosin binding-partner, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYPC1_HUMAN _struct_ref.pdbx_db_accession Q00872 _struct_ref.pdbx_db_isoform Q00872-4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEK _struct_ref.pdbx_align_begin 231 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9PFE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00872 _struct_ref_seq.db_align_beg 231 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 274 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 231 _struct_ref_seq.pdbx_auth_seq_align_end 274 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9PFE _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q00872 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 4 ? ASN A 12 ? VAL A 233 ASN A 241 1 ? 9 HELX_P HELX_P2 AA2 GLU A 17 ? TYR A 25 ? GLU A 246 TYR A 254 1 ? 9 HELX_P HELX_P3 AA3 ASP A 29 ? ARG A 42 ? ASP A 258 ARG A 271 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9PFE _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 11 O A LEU 266 ? ? H A ARG 270 ? ? 1.59 2 17 O A ALA 251 ? ? H A ILE 256 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 243 ? ? -48.60 159.74 2 1 PRO A 244 ? ? -48.78 -11.84 3 1 LEU A 259 ? ? -49.50 -10.17 4 1 ARG A 268 ? ? -51.53 -78.13 5 1 GLU A 272 ? ? -68.03 -99.59 6 1 GLU A 273 ? ? -78.29 -113.91 7 2 LYS A 243 ? ? -55.85 177.91 8 2 PRO A 244 ? ? -69.46 1.22 9 2 TYR A 247 ? ? -33.65 -32.63 10 2 LEU A 259 ? ? -45.60 -8.68 11 2 ARG A 270 ? ? -64.07 3.35 12 2 GLU A 272 ? ? -73.25 -109.52 13 2 GLU A 273 ? ? -114.88 -123.05 14 3 PRO A 244 ? ? -44.47 -9.40 15 3 LEU A 259 ? ? -49.15 -5.04 16 3 GLU A 272 ? ? -65.56 -116.37 17 3 GLU A 273 ? ? -134.17 -93.95 18 4 PRO A 244 ? ? -47.11 -6.95 19 4 LEU A 259 ? ? -39.91 -20.44 20 4 GLU A 272 ? ? -65.90 -119.96 21 4 GLU A 273 ? ? -109.38 -96.70 22 5 PRO A 244 ? ? -44.99 -13.46 23 5 LEU A 259 ? ? -50.15 -4.41 24 5 GLU A 272 ? ? -83.26 -97.98 25 5 GLU A 273 ? ? -100.05 -152.63 26 6 PRO A 244 ? ? -44.01 -11.78 27 6 LEU A 259 ? ? -41.59 -18.28 28 6 GLU A 272 ? ? -67.04 -98.90 29 6 GLU A 273 ? ? -98.25 -91.31 30 7 PRO A 244 ? ? -45.41 -8.71 31 7 LEU A 266 ? ? -72.93 -70.73 32 7 LYS A 267 ? ? -38.71 -31.18 33 7 GLU A 272 ? ? -70.18 -96.49 34 7 GLU A 273 ? ? -116.43 -102.58 35 8 PRO A 244 ? ? -43.89 -12.89 36 8 LEU A 259 ? ? -44.88 -13.12 37 8 GLU A 272 ? ? -66.63 -97.33 38 8 GLU A 273 ? ? -116.07 -129.04 39 9 PRO A 244 ? ? -45.24 -10.48 40 9 LEU A 259 ? ? -42.69 -13.89 41 9 GLU A 272 ? ? -74.94 -97.90 42 9 GLU A 273 ? ? -106.13 -95.62 43 10 PRO A 244 ? ? -44.98 -11.47 44 10 TYR A 247 ? ? -38.18 -36.93 45 10 ARG A 268 ? ? -52.89 -75.78 46 10 GLU A 272 ? ? -63.71 -116.21 47 10 GLU A 273 ? ? -125.55 -153.80 48 11 PRO A 244 ? ? -46.75 -6.36 49 11 TYR A 247 ? ? -35.56 -30.27 50 11 LEU A 259 ? ? -45.67 -13.49 51 11 ARG A 270 ? ? -62.97 5.28 52 11 GLU A 272 ? ? -76.43 -122.52 53 11 GLU A 273 ? ? -93.66 -148.58 54 12 PRO A 244 ? ? -44.87 -7.59 55 12 LEU A 259 ? ? -46.90 -7.14 56 12 GLU A 272 ? ? -65.91 -156.30 57 12 GLU A 273 ? ? -72.58 -154.81 58 13 PRO A 244 ? ? -46.54 -5.31 59 13 TYR A 247 ? ? -38.61 -33.40 60 13 LEU A 259 ? ? -57.80 -7.82 61 13 ARG A 268 ? ? -56.10 -74.92 62 13 GLU A 272 ? ? -85.94 -105.65 63 13 GLU A 273 ? ? -92.14 -90.88 64 14 PRO A 244 ? ? -47.49 -4.58 65 14 ARG A 268 ? ? -64.30 -70.55 66 14 GLU A 272 ? ? -64.03 -156.18 67 14 GLU A 273 ? ? -76.36 -88.81 68 15 PRO A 244 ? ? -43.34 -13.33 69 15 LEU A 259 ? ? -45.33 -13.64 70 15 GLU A 272 ? ? -67.05 -99.43 71 15 GLU A 273 ? ? -131.26 -119.20 72 16 PRO A 244 ? ? -45.46 -8.36 73 16 LEU A 259 ? ? -51.50 -2.75 74 16 LEU A 266 ? ? -84.52 -70.23 75 16 GLU A 272 ? ? -70.68 -101.28 76 16 GLU A 273 ? ? -82.17 -154.52 77 17 PRO A 244 ? ? -47.45 -7.91 78 17 TYR A 247 ? ? -32.77 -32.20 79 17 GLU A 272 ? ? -67.16 -158.34 80 17 GLU A 273 ? ? -85.09 -94.16 81 18 PRO A 244 ? ? -44.53 -9.02 82 18 LYS A 249 ? ? -47.36 -70.02 83 18 LEU A 259 ? ? -51.63 -7.80 84 18 ARG A 260 ? ? -65.78 -74.75 85 18 GLU A 272 ? ? -66.66 -152.11 86 18 GLU A 273 ? ? -119.52 -95.54 87 19 PRO A 244 ? ? -43.78 -8.23 88 19 GLU A 272 ? ? -67.68 -117.53 89 19 GLU A 273 ? ? -83.16 -114.88 90 20 PRO A 244 ? ? -46.12 -7.58 91 20 TYR A 247 ? ? -35.40 -33.17 92 20 LEU A 259 ? ? -41.82 -17.18 93 20 GLU A 272 ? ? -69.58 -108.47 94 20 GLU A 273 ? ? -133.78 -136.65 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 260 ? ? 0.271 'SIDE CHAIN' 2 1 ARG A 265 ? ? 0.099 'SIDE CHAIN' 3 1 ARG A 268 ? ? 0.308 'SIDE CHAIN' 4 1 ARG A 270 ? ? 0.104 'SIDE CHAIN' 5 2 ARG A 260 ? ? 0.251 'SIDE CHAIN' 6 2 ARG A 265 ? ? 0.303 'SIDE CHAIN' 7 2 ARG A 268 ? ? 0.301 'SIDE CHAIN' 8 2 ARG A 270 ? ? 0.285 'SIDE CHAIN' 9 2 ARG A 271 ? ? 0.305 'SIDE CHAIN' 10 3 ARG A 265 ? ? 0.081 'SIDE CHAIN' 11 3 ARG A 268 ? ? 0.256 'SIDE CHAIN' 12 3 ARG A 270 ? ? 0.079 'SIDE CHAIN' 13 3 ARG A 271 ? ? 0.273 'SIDE CHAIN' 14 4 ARG A 260 ? ? 0.271 'SIDE CHAIN' 15 4 ARG A 268 ? ? 0.176 'SIDE CHAIN' 16 4 ARG A 270 ? ? 0.283 'SIDE CHAIN' 17 5 ARG A 260 ? ? 0.102 'SIDE CHAIN' 18 5 ARG A 265 ? ? 0.251 'SIDE CHAIN' 19 5 ARG A 268 ? ? 0.221 'SIDE CHAIN' 20 5 ARG A 270 ? ? 0.302 'SIDE CHAIN' 21 5 ARG A 271 ? ? 0.309 'SIDE CHAIN' 22 6 ARG A 260 ? ? 0.291 'SIDE CHAIN' 23 6 ARG A 265 ? ? 0.231 'SIDE CHAIN' 24 6 ARG A 268 ? ? 0.293 'SIDE CHAIN' 25 6 ARG A 270 ? ? 0.088 'SIDE CHAIN' 26 6 ARG A 271 ? ? 0.095 'SIDE CHAIN' 27 7 ARG A 260 ? ? 0.300 'SIDE CHAIN' 28 7 ARG A 265 ? ? 0.205 'SIDE CHAIN' 29 7 ARG A 270 ? ? 0.306 'SIDE CHAIN' 30 8 ARG A 260 ? ? 0.131 'SIDE CHAIN' 31 8 ARG A 265 ? ? 0.308 'SIDE CHAIN' 32 8 ARG A 268 ? ? 0.309 'SIDE CHAIN' 33 8 ARG A 270 ? ? 0.303 'SIDE CHAIN' 34 8 ARG A 271 ? ? 0.257 'SIDE CHAIN' 35 9 ARG A 260 ? ? 0.307 'SIDE CHAIN' 36 9 ARG A 265 ? ? 0.283 'SIDE CHAIN' 37 9 ARG A 268 ? ? 0.285 'SIDE CHAIN' 38 9 ARG A 270 ? ? 0.145 'SIDE CHAIN' 39 9 ARG A 271 ? ? 0.241 'SIDE CHAIN' 40 10 ARG A 265 ? ? 0.242 'SIDE CHAIN' 41 10 ARG A 268 ? ? 0.137 'SIDE CHAIN' 42 10 ARG A 270 ? ? 0.083 'SIDE CHAIN' 43 10 ARG A 271 ? ? 0.310 'SIDE CHAIN' 44 11 ARG A 265 ? ? 0.300 'SIDE CHAIN' 45 11 ARG A 268 ? ? 0.279 'SIDE CHAIN' 46 11 ARG A 270 ? ? 0.249 'SIDE CHAIN' 47 11 ARG A 271 ? ? 0.309 'SIDE CHAIN' 48 12 ARG A 260 ? ? 0.176 'SIDE CHAIN' 49 12 ARG A 265 ? ? 0.226 'SIDE CHAIN' 50 12 ARG A 268 ? ? 0.247 'SIDE CHAIN' 51 12 ARG A 270 ? ? 0.183 'SIDE CHAIN' 52 12 ARG A 271 ? ? 0.303 'SIDE CHAIN' 53 13 ARG A 260 ? ? 0.094 'SIDE CHAIN' 54 13 ARG A 265 ? ? 0.208 'SIDE CHAIN' 55 13 ARG A 268 ? ? 0.269 'SIDE CHAIN' 56 13 ARG A 270 ? ? 0.088 'SIDE CHAIN' 57 13 ARG A 271 ? ? 0.229 'SIDE CHAIN' 58 14 ARG A 260 ? ? 0.112 'SIDE CHAIN' 59 14 ARG A 265 ? ? 0.158 'SIDE CHAIN' 60 14 ARG A 268 ? ? 0.299 'SIDE CHAIN' 61 14 ARG A 270 ? ? 0.201 'SIDE CHAIN' 62 15 ARG A 265 ? ? 0.295 'SIDE CHAIN' 63 15 ARG A 268 ? ? 0.305 'SIDE CHAIN' 64 15 ARG A 270 ? ? 0.220 'SIDE CHAIN' 65 15 ARG A 271 ? ? 0.300 'SIDE CHAIN' 66 16 ARG A 260 ? ? 0.228 'SIDE CHAIN' 67 16 ARG A 265 ? ? 0.272 'SIDE CHAIN' 68 16 ARG A 270 ? ? 0.230 'SIDE CHAIN' 69 16 ARG A 271 ? ? 0.239 'SIDE CHAIN' 70 17 ARG A 260 ? ? 0.278 'SIDE CHAIN' 71 17 ARG A 265 ? ? 0.299 'SIDE CHAIN' 72 17 ARG A 268 ? ? 0.227 'SIDE CHAIN' 73 17 ARG A 270 ? ? 0.250 'SIDE CHAIN' 74 17 ARG A 271 ? ? 0.297 'SIDE CHAIN' 75 18 ARG A 260 ? ? 0.275 'SIDE CHAIN' 76 18 ARG A 268 ? ? 0.311 'SIDE CHAIN' 77 18 ARG A 270 ? ? 0.106 'SIDE CHAIN' 78 18 ARG A 271 ? ? 0.183 'SIDE CHAIN' 79 19 ARG A 260 ? ? 0.257 'SIDE CHAIN' 80 19 ARG A 265 ? ? 0.105 'SIDE CHAIN' 81 19 ARG A 268 ? ? 0.301 'SIDE CHAIN' 82 19 ARG A 270 ? ? 0.171 'SIDE CHAIN' 83 20 ARG A 260 ? ? 0.306 'SIDE CHAIN' 84 20 ARG A 265 ? ? 0.271 'SIDE CHAIN' 85 20 ARG A 270 ? ? 0.289 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 9PFE _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9PFE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 3 ;2 mM [U-15N] M-domain tri-helix bundle of slow skeletal MyBP-C, 20 mM d-11 TRIS, 50 mM sodium chloride, 350 uM sodium azide, 10 % D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N-sample solution ? 4 ;2 mM [U-13C; U-15N] M-domain tri-helix bundle of slow skeletal MyBP-C, 20 mM d-11 TRIS, 50 mM sodium chloride, 350 uM sodium azide, 10 % D20, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N-13C-sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 3 'M-domain tri-helix bundle of slow skeletal MyBP-C' 2 ? mM '[U-15N]' 3 TRIS 20 ? mM d-11 3 'sodium chloride' 50 ? mM 'natural abundance' 3 'sodium azide' 350 ? uM 'natural abundance' 3 D2O 10 ? % 'natural abundance' 4 'M-domain tri-helix bundle of slow skeletal MyBP-C' 2 ? mM '[U-13C; U-15N]' 4 TRIS 20 ? mM d-11 4 'sodium chloride' 50 ? mM 'natural abundance' 4 'sodium azide' 350 ? uM 'natural abundance' 4 D20 10 ? % 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 2 289 atm 1 7.5 70 ? ? mM 15N-13C-sample ? pH ? ? K 3 289 atm 1 7.5 70 ? ? mM 15N-sample ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 2 4 '2D 1H-15N HSQC' 1 isotropic 2 2 4 '3D CBCA(CO)NH' 1 isotropic 3 2 4 '3D HNCACB' 1 isotropic 4 2 4 '3D HNCO' 1 isotropic 5 2 4 '3D H(CCO)NH' 1 isotropic 6 2 4 '3D C(CO)NH' 1 isotropic 7 3 3 '3D 1H-15N NOESY' 1 isotropic 8 2 4 '3D 1H-13C NOESY' 1 isotropic 9 3 3 '3D 1H-15N TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 9PFE _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'peak picking' NMRFAM-SPARKY ? 'Lee, Tonelli, and Markley' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' PINE ? 'Bahrami, Markley, Assadi, and Eghbalnia' 4 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TRP N N N N 283 TRP CA C N S 284 TRP C C N N 285 TRP O O N N 286 TRP CB C N N 287 TRP CG C Y N 288 TRP CD1 C Y N 289 TRP CD2 C Y N 290 TRP NE1 N Y N 291 TRP CE2 C Y N 292 TRP CE3 C Y N 293 TRP CZ2 C Y N 294 TRP CZ3 C Y N 295 TRP CH2 C Y N 296 TRP OXT O N N 297 TRP H H N N 298 TRP H2 H N N 299 TRP HA H N N 300 TRP HB2 H N N 301 TRP HB3 H N N 302 TRP HD1 H N N 303 TRP HE1 H N N 304 TRP HE3 H N N 305 TRP HZ2 H N N 306 TRP HZ3 H N N 307 TRP HH2 H N N 308 TRP HXT H N N 309 TYR N N N N 310 TYR CA C N S 311 TYR C C N N 312 TYR O O N N 313 TYR CB C N N 314 TYR CG C Y N 315 TYR CD1 C Y N 316 TYR CD2 C Y N 317 TYR CE1 C Y N 318 TYR CE2 C Y N 319 TYR CZ C Y N 320 TYR OH O N N 321 TYR OXT O N N 322 TYR H H N N 323 TYR H2 H N N 324 TYR HA H N N 325 TYR HB2 H N N 326 TYR HB3 H N N 327 TYR HD1 H N N 328 TYR HD2 H N N 329 TYR HE1 H N N 330 TYR HE2 H N N 331 TYR HH H N N 332 TYR HXT H N N 333 VAL N N N N 334 VAL CA C N S 335 VAL C C N N 336 VAL O O N N 337 VAL CB C N N 338 VAL CG1 C N N 339 VAL CG2 C N N 340 VAL OXT O N N 341 VAL H H N N 342 VAL H2 H N N 343 VAL HA H N N 344 VAL HB H N N 345 VAL HG11 H N N 346 VAL HG12 H N N 347 VAL HG13 H N N 348 VAL HG21 H N N 349 VAL HG22 H N N 350 VAL HG23 H N N 351 VAL HXT H N N 352 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 TYR N CA sing N N 298 TYR N H sing N N 299 TYR N H2 sing N N 300 TYR CA C sing N N 301 TYR CA CB sing N N 302 TYR CA HA sing N N 303 TYR C O doub N N 304 TYR C OXT sing N N 305 TYR CB CG sing N N 306 TYR CB HB2 sing N N 307 TYR CB HB3 sing N N 308 TYR CG CD1 doub Y N 309 TYR CG CD2 sing Y N 310 TYR CD1 CE1 sing Y N 311 TYR CD1 HD1 sing N N 312 TYR CD2 CE2 doub Y N 313 TYR CD2 HD2 sing N N 314 TYR CE1 CZ doub Y N 315 TYR CE1 HE1 sing N N 316 TYR CE2 CZ sing Y N 317 TYR CE2 HE2 sing N N 318 TYR CZ OH sing N N 319 TYR OH HH sing N N 320 TYR OXT HXT sing N N 321 VAL N CA sing N N 322 VAL N H sing N N 323 VAL N H2 sing N N 324 VAL CA C sing N N 325 VAL CA CB sing N N 326 VAL CA HA sing N N 327 VAL C O doub N N 328 VAL C OXT sing N N 329 VAL CB CG1 sing N N 330 VAL CB CG2 sing N N 331 VAL CB HB sing N N 332 VAL CG1 HG11 sing N N 333 VAL CG1 HG12 sing N N 334 VAL CG1 HG13 sing N N 335 VAL CG2 HG21 sing N N 336 VAL CG2 HG22 sing N N 337 VAL CG2 HG23 sing N N 338 VAL OXT HXT sing N N 339 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Arthritis and Musculoskeletal and Skin Diseases (NIH/NIAMS)' 'United States' AR076373 1 'National Science Foundation (NSF, United States)' 'United States' 2024182 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'room temperature TXI probe' # _atom_sites.entry_id 9PFE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #