data_9PG4 # _entry.id 9PG4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9PG4 pdb_00009pg4 10.2210/pdb9pg4/pdb WWPDB D_1000297710 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-20 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9PG4 _pdbx_database_status.recvd_initial_deposition_date 2025-07-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 9DNO unspecified PDB . 9DNQ unspecified PDB . 9DNR unspecified # _pdbx_contact_author.id 4 _pdbx_contact_author.email yuc020@health.ucsd.edu _pdbx_contact_author.name_first Yuan _pdbx_contact_author.name_last Chen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1510-182X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huang, S.' 1 0000-0003-3862-564X 'Wu, J.' 2 0000-0002-8031-9462 'Taylor, S.' 3 0000-0002-7702-6108 'Chen, Y.' 4 0000-0002-1510-182X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Development of High-Affinity Ligands for Human UBR2.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5c02881 _citation.pdbx_database_id_PubMed 42102356 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, S.T.' 1 0000-0003-3862-564X primary 'Faouzi, A.' 2 0000-0002-9059-4791 primary 'Thomas, N.' 3 ? primary 'Wu, J.' 4 ? primary 'Pestonjamasp, K.' 5 ? primary 'Chen, D.H.' 6 ? primary 'Ren, T.' 7 ? primary 'Kuang, Y.' 8 ? primary 'Taylor, S.' 9 0000-0002-7702-6108 primary 'Chen, Y.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase UBR2' 8180.306 1 2.3.2.27 ? 'UBR-box domain (UNP residues 98-168)' ? 2 polymer syn 'AF23 peptide' 609.578 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 4 water nat water 18.015 49 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N-recognin-2,Ubiquitin-protein ligase E3-alpha-2,Ubiquitin-protein ligase E3-alpha-II' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no PLGSLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHE PLGSLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHE A ? 2 'polypeptide(L)' no yes '(A1CH8)(NIY)F(NH2)' XYFX C ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 LEU n 1 3 GLY n 1 4 SER n 1 5 LEU n 1 6 CYS n 1 7 GLY n 1 8 ARG n 1 9 VAL n 1 10 PHE n 1 11 LYS n 1 12 VAL n 1 13 GLY n 1 14 GLU n 1 15 PRO n 1 16 THR n 1 17 TYR n 1 18 SER n 1 19 CYS n 1 20 ARG n 1 21 ASP n 1 22 CYS n 1 23 ALA n 1 24 VAL n 1 25 ASP n 1 26 PRO n 1 27 THR n 1 28 CYS n 1 29 VAL n 1 30 LEU n 1 31 CYS n 1 32 MET n 1 33 GLU n 1 34 CYS n 1 35 PHE n 1 36 LEU n 1 37 GLY n 1 38 SER n 1 39 ILE n 1 40 HIS n 1 41 ARG n 1 42 ASP n 1 43 HIS n 1 44 ARG n 1 45 TYR n 1 46 ARG n 1 47 MET n 1 48 THR n 1 49 THR n 1 50 SER n 1 51 GLY n 1 52 GLY n 1 53 GLY n 1 54 GLY n 1 55 PHE n 1 56 CYS n 1 57 ASP n 1 58 CYS n 1 59 GLY n 1 60 ASP n 1 61 THR n 1 62 GLU n 1 63 ALA n 1 64 TRP n 1 65 LYS n 1 66 GLU n 1 67 GLY n 1 68 PRO n 1 69 TYR n 1 70 CYS n 1 71 GLN n 1 72 LYS n 1 73 HIS n 1 74 GLU n 2 1 A1CH8 n 2 2 NIY n 2 3 PHE n 2 4 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 74 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'UBR2, C6orf133, KIAA0349' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'Amp resistance, N-terminal GST tag' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6p-1-hUBR1-UBRbox _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 4 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1CH8 'L-peptide linking' n 'N~5~-[N-(2,2,2-trifluoroethyl)carbamimidoyl]-L-ornithine' ? 'C8 H15 F3 N4 O2' 256.226 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 NIY 'L-peptide linking' n META-NITRO-TYROSINE ? 'C9 H10 N2 O5' 226.186 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 94 94 PRO PRO A . n A 1 2 LEU 2 95 95 LEU LEU A . n A 1 3 GLY 3 96 96 GLY GLY A . n A 1 4 SER 4 97 97 SER SER A . n A 1 5 LEU 5 98 98 LEU LEU A . n A 1 6 CYS 6 99 99 CYS CYS A . n A 1 7 GLY 7 100 100 GLY GLY A . n A 1 8 ARG 8 101 101 ARG ARG A . n A 1 9 VAL 9 102 102 VAL VAL A . n A 1 10 PHE 10 103 103 PHE PHE A . n A 1 11 LYS 11 104 104 LYS LYS A . n A 1 12 VAL 12 105 105 VAL VAL A . n A 1 13 GLY 13 106 106 GLY GLY A . n A 1 14 GLU 14 107 107 GLU GLU A . n A 1 15 PRO 15 108 108 PRO PRO A . n A 1 16 THR 16 109 109 THR THR A . n A 1 17 TYR 17 110 110 TYR TYR A . n A 1 18 SER 18 111 111 SER SER A . n A 1 19 CYS 19 112 112 CYS CYS A . n A 1 20 ARG 20 113 113 ARG ARG A . n A 1 21 ASP 21 114 114 ASP ASP A . n A 1 22 CYS 22 115 115 CYS CYS A . n A 1 23 ALA 23 116 116 ALA ALA A . n A 1 24 VAL 24 117 117 VAL VAL A . n A 1 25 ASP 25 118 118 ASP ASP A . n A 1 26 PRO 26 119 119 PRO PRO A . n A 1 27 THR 27 120 120 THR THR A . n A 1 28 CYS 28 121 121 CYS CYS A . n A 1 29 VAL 29 122 122 VAL VAL A . n A 1 30 LEU 30 123 123 LEU LEU A . n A 1 31 CYS 31 124 124 CYS CYS A . n A 1 32 MET 32 125 125 MET MET A . n A 1 33 GLU 33 126 126 GLU GLU A . n A 1 34 CYS 34 127 127 CYS CYS A . n A 1 35 PHE 35 128 128 PHE PHE A . n A 1 36 LEU 36 129 129 LEU LEU A . n A 1 37 GLY 37 130 130 GLY GLY A . n A 1 38 SER 38 131 131 SER SER A . n A 1 39 ILE 39 132 132 ILE ILE A . n A 1 40 HIS 40 133 133 HIS HIS A . n A 1 41 ARG 41 134 134 ARG ARG A . n A 1 42 ASP 42 135 135 ASP ASP A . n A 1 43 HIS 43 136 136 HIS HIS A . n A 1 44 ARG 44 137 137 ARG ARG A . n A 1 45 TYR 45 138 138 TYR TYR A . n A 1 46 ARG 46 139 139 ARG ARG A . n A 1 47 MET 47 140 140 MET MET A . n A 1 48 THR 48 141 141 THR THR A . n A 1 49 THR 49 142 142 THR THR A . n A 1 50 SER 50 143 143 SER SER A . n A 1 51 GLY 51 144 144 GLY GLY A . n A 1 52 GLY 52 145 145 GLY GLY A . n A 1 53 GLY 53 146 146 GLY GLY A . n A 1 54 GLY 54 147 147 GLY GLY A . n A 1 55 PHE 55 148 148 PHE PHE A . n A 1 56 CYS 56 149 149 CYS CYS A . n A 1 57 ASP 57 150 150 ASP ASP A . n A 1 58 CYS 58 151 151 CYS CYS A . n A 1 59 GLY 59 152 152 GLY GLY A . n A 1 60 ASP 60 153 153 ASP ASP A . n A 1 61 THR 61 154 154 THR THR A . n A 1 62 GLU 62 155 155 GLU GLU A . n A 1 63 ALA 63 156 156 ALA ALA A . n A 1 64 TRP 64 157 157 TRP TRP A . n A 1 65 LYS 65 158 158 LYS LYS A . n A 1 66 GLU 66 159 159 GLU GLU A . n A 1 67 GLY 67 160 160 GLY GLY A . n A 1 68 PRO 68 161 161 PRO PRO A . n A 1 69 TYR 69 162 162 TYR TYR A . n A 1 70 CYS 70 163 163 CYS CYS A . n A 1 71 GLN 71 164 164 GLN GLN A . n A 1 72 LYS 72 165 165 LYS LYS A . n A 1 73 HIS 73 166 166 HIS HIS A . n A 1 74 GLU 74 167 167 GLU GLU A . n B 2 1 A1CH8 1 1 1 A1CH8 F23 C . n B 2 2 NIY 2 2 1 NIY F23 C . n B 2 3 PHE 3 3 1 PHE F23 C . n B 2 4 NH2 4 4 1 NH2 F23 C . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? 2 A1CH8 ? ? A1CH8 ? ? 'SUBJECT OF INVESTIGATION' ? 3 NIY ? ? NIY ? ? 'SUBJECT OF INVESTIGATION' ? 4 NH2 ? ? NH2 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 201 1 ZN ZN A . D 3 ZN 1 202 2 ZN ZN A . E 3 ZN 1 203 3 ZN ZN A . F 4 HOH 1 301 12 HOH HOH A . F 4 HOH 2 302 9 HOH HOH A . F 4 HOH 3 303 23 HOH HOH A . F 4 HOH 4 304 17 HOH HOH A . F 4 HOH 5 305 30 HOH HOH A . F 4 HOH 6 306 22 HOH HOH A . F 4 HOH 7 307 6 HOH HOH A . F 4 HOH 8 308 21 HOH HOH A . F 4 HOH 9 309 4 HOH HOH A . F 4 HOH 10 310 15 HOH HOH A . F 4 HOH 11 311 25 HOH HOH A . F 4 HOH 12 312 14 HOH HOH A . F 4 HOH 13 313 41 HOH HOH A . F 4 HOH 14 314 5 HOH HOH A . F 4 HOH 15 315 2 HOH HOH A . F 4 HOH 16 316 13 HOH HOH A . F 4 HOH 17 317 29 HOH HOH A . F 4 HOH 18 318 11 HOH HOH A . F 4 HOH 19 319 1 HOH HOH A . F 4 HOH 20 320 43 HOH HOH A . F 4 HOH 21 321 16 HOH HOH A . F 4 HOH 22 322 46 HOH HOH A . F 4 HOH 23 323 10 HOH HOH A . F 4 HOH 24 324 28 HOH HOH A . F 4 HOH 25 325 36 HOH HOH A . F 4 HOH 26 326 20 HOH HOH A . F 4 HOH 27 327 7 HOH HOH A . F 4 HOH 28 328 8 HOH HOH A . F 4 HOH 29 329 45 HOH HOH A . F 4 HOH 30 330 19 HOH HOH A . F 4 HOH 31 331 3 HOH HOH A . F 4 HOH 32 332 37 HOH HOH A . F 4 HOH 33 333 27 HOH HOH A . F 4 HOH 34 334 48 HOH HOH A . F 4 HOH 35 335 40 HOH HOH A . F 4 HOH 36 336 31 HOH HOH A . F 4 HOH 37 337 33 HOH HOH A . F 4 HOH 38 338 35 HOH HOH A . F 4 HOH 39 339 39 HOH HOH A . F 4 HOH 40 340 26 HOH HOH A . F 4 HOH 41 341 49 HOH HOH A . F 4 HOH 42 342 47 HOH HOH A . F 4 HOH 43 343 34 HOH HOH A . F 4 HOH 44 344 44 HOH HOH A . F 4 HOH 45 345 24 HOH HOH A . F 4 HOH 46 346 38 HOH HOH A . F 4 HOH 47 347 32 HOH HOH A . F 4 HOH 48 348 18 HOH HOH A . F 4 HOH 49 349 42 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 117.39 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9PG4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 27.798 _cell.length_a_esd ? _cell.length_b 43.736 _cell.length_b_esd ? _cell.length_c 27.970 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9PG4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9PG4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '27% PEG4000, 0.1M HEPES, protein ligand ratio 1 to 2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 295.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 10.71 _reflns.entry_id 9PG4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.180 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 47384 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.290 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.104 _reflns.pdbx_Rpim_I_all 0.038 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.097 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.22 1.24 ? ? ? ? ? ? 1294 ? ? ? ? ? ? ? ? ? ? ? 2.3 0.501 ? ? 1.563 0.866 ? 1 1 0.195 0.571 ? 53.2 ? 1.281 ? ? ? ? ? ? ? ? ? 1.24 1.26 ? ? ? ? ? ? 1832 ? ? ? ? ? ? ? ? ? ? ? 2.8 0.485 ? ? 1.424 0.751 ? 2 1 0.320 0.696 ? 73.3 ? 1.193 ? ? ? ? ? ? ? ? ? 1.26 1.29 ? ? ? ? ? ? 2163 ? ? ? ? ? ? ? ? ? ? ? 3.9 0.475 ? ? 1.439 0.679 ? 3 1 0.383 0.745 ? 89.1 ? 1.258 ? ? ? ? ? ? ? ? ? 1.29 1.31 ? ? ? ? ? ? 2341 ? ? ? ? ? ? ? ? ? ? ? 5.1 0.503 ? ? 1.163 0.491 ? 4 1 0.459 0.793 ? 95.0 ? 1.047 ? ? ? ? ? ? ? ? ? 1.31 1.34 ? ? ? ? ? ? 2389 ? ? ? ? ? ? ? ? ? ? ? 6.1 0.502 ? ? 1.079 0.421 ? 5 1 0.616 0.873 ? 97.7 ? 0.989 ? ? ? ? ? ? ? ? ? 1.34 1.37 ? ? ? ? ? ? 2451 ? ? ? ? ? ? ? ? ? ? ? 6.9 0.552 ? ? 0.891 0.333 ? 6 1 0.727 0.918 ? 99.5 ? 0.824 ? ? ? ? ? ? ? ? ? 1.37 1.41 ? ? ? ? ? ? 2484 ? ? ? ? ? ? ? ? ? ? ? 7.2 0.623 ? ? 0.728 0.266 ? 7 1 0.794 0.941 ? 99.7 ? 0.676 ? ? ? ? ? ? ? ? ? 1.41 1.45 ? ? ? ? ? ? 2434 ? ? ? ? ? ? ? ? ? ? ? 6.6 0.654 ? ? 0.647 0.245 ? 8 1 0.836 0.954 ? 99.8 ? 0.597 ? ? ? ? ? ? ? ? ? 1.45 1.49 ? ? ? ? ? ? 2452 ? ? ? ? ? ? ? ? ? ? ? 7.1 0.760 ? ? 0.481 0.176 ? 9 1 0.882 0.968 ? 99.8 ? 0.446 ? ? ? ? ? ? ? ? ? 1.49 1.54 ? ? ? ? ? ? 2470 ? ? ? ? ? ? ? ? ? ? ? 8.1 0.909 ? ? 0.416 0.145 ? 10 1 0.928 0.981 ? 100.0 ? 0.389 ? ? ? ? ? ? ? ? ? 1.54 1.59 ? ? ? ? ? ? 2478 ? ? ? ? ? ? ? ? ? ? ? 7.9 1.226 ? ? 0.343 0.121 ? 11 1 0.942 0.985 ? 100.0 ? 0.321 ? ? ? ? ? ? ? ? ? 1.59 1.66 ? ? ? ? ? ? 2478 ? ? ? ? ? ? ? ? ? ? ? 7.9 1.557 ? ? 0.278 0.098 ? 12 1 0.961 0.990 ? 100.0 ? 0.260 ? ? ? ? ? ? ? ? ? 1.66 1.73 ? ? ? ? ? ? 2464 ? ? ? ? ? ? ? ? ? ? ? 7.6 1.788 ? ? 0.232 0.083 ? 13 1 0.977 0.994 ? 99.9 ? 0.217 ? ? ? ? ? ? ? ? ? 1.73 1.82 ? ? ? ? ? ? 2479 ? ? ? ? ? ? ? ? ? ? ? 7.5 1.850 ? ? 0.191 0.069 ? 14 1 0.983 0.996 ? 99.8 ? 0.178 ? ? ? ? ? ? ? ? ? 1.82 1.94 ? ? ? ? ? ? 2470 ? ? ? ? ? ? ? ? ? ? ? 6.7 1.952 ? ? 0.186 0.071 ? 15 1 0.982 0.995 ? 99.9 ? 0.172 ? ? ? ? ? ? ? ? ? 1.94 2.09 ? ? ? ? ? ? 2496 ? ? ? ? ? ? ? ? ? ? ? 6.6 1.814 ? ? 0.122 0.046 ? 16 1 0.993 0.998 ? 99.7 ? 0.113 ? ? ? ? ? ? ? ? ? 2.09 2.30 ? ? ? ? ? ? 2498 ? ? ? ? ? ? ? ? ? ? ? 8.0 1.847 ? ? 0.132 0.046 ? 17 1 0.991 0.998 ? 100.0 ? 0.124 ? ? ? ? ? ? ? ? ? 2.30 2.63 ? ? ? ? ? ? 2520 ? ? ? ? ? ? ? ? ? ? ? 8.1 1.839 ? ? 0.105 0.036 ? 18 1 0.993 0.998 ? 99.8 ? 0.099 ? ? ? ? ? ? ? ? ? 2.63 3.31 ? ? ? ? ? ? 2543 ? ? ? ? ? ? ? ? ? ? ? 7.7 1.641 ? ? 0.087 0.030 ? 19 1 0.995 0.999 ? 99.8 ? 0.081 ? ? ? ? ? ? ? ? ? 3.31 50.00 ? ? ? ? ? ? 2648 ? ? ? ? ? ? ? ? ? ? ? 7.2 1.773 ? ? 0.057 0.020 ? 20 1 0.998 0.999 ? 99.2 ? 0.053 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 17.1 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9PG4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.180 _refine.ls_d_res_low 24.834 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17439 _refine.ls_number_reflns_R_free 887 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 88.84 _refine.ls_percent_reflns_R_free 5.09 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1750 _refine.ls_R_factor_R_free 0.1895 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1742 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.69 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.12 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.180 _refine_hist.d_res_low 24.834 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 660 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 568 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 623 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.762 ? 839 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 7.138 ? 257 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.063 ? 82 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 110 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.1801 1.2540 . . 110 2142 70.00 . . . . 0.2374 . . . . . . . . . . . . . . . 0.2737 'X-RAY DIFFRACTION' 1.2540 1.3508 . . 139 2567 83.00 . . . . 0.2316 . . . . . . . . . . . . . . . 0.2454 'X-RAY DIFFRACTION' 1.3508 1.4868 . . 147 2810 91.00 . . . . 0.1939 . . . . . . . . . . . . . . . 0.2097 'X-RAY DIFFRACTION' 1.4868 1.7019 . . 165 2960 95.00 . . . . 0.1697 . . . . . . . . . . . . . . . 0.1944 'X-RAY DIFFRACTION' 1.7019 2.1440 . . 159 3015 97.00 . . . . 0.1671 . . . . . . . . . . . . . . . 0.1799 'X-RAY DIFFRACTION' 2.1440 24.834 . . 167 3058 97.00 . . . . 0.1627 . . . . . . . . . . . . . . . 0.1757 # _struct.entry_id 9PG4 _struct.title 'Structure of UBR2-AF23 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9PG4 _struct_keywords.text 'UBR, E3 ligase, Peptidomimetics ligands, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP UBR2_HUMAN Q8IWV8 ? 1 LCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHE 98 2 PDB 9PG4 9PG4 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9PG4 A 5 ? 74 ? Q8IWV8 98 ? 167 ? 98 167 2 2 9PG4 C 1 ? 4 ? 9PG4 1 ? 4 ? 1 4 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9PG4 PRO A 1 ? UNP Q8IWV8 ? ? 'expression tag' 94 1 1 9PG4 LEU A 2 ? UNP Q8IWV8 ? ? 'expression tag' 95 2 1 9PG4 GLY A 3 ? UNP Q8IWV8 ? ? 'expression tag' 96 3 1 9PG4 SER A 4 ? UNP Q8IWV8 ? ? 'expression tag' 97 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Single peak observed during size exclusion chromatography purification' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 31 ? GLY A 37 ? CYS A 124 GLY A 130 1 ? 7 HELX_P HELX_P2 AA2 SER A 38 ? HIS A 43 ? SER A 131 HIS A 136 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B A1CH8 1 C ? ? ? 1_555 B NIY 2 N ? ? C A1CH8 1 C NIY 2 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale2 covale both ? B NIY 2 C ? ? ? 1_555 B PHE 3 N ? ? C NIY 2 C PHE 3 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale3 covale both ? B PHE 3 C ? ? ? 1_555 B NH2 4 N ? ? C PHE 3 C NH2 4 1_555 ? ? ? ? ? ? ? 1.329 ? ? metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 99 A ZN 201 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc2 metalc ? ? A CYS 19 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 112 A ZN 203 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc3 metalc ? ? A CYS 22 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 115 A ZN 203 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc4 metalc ? ? A CYS 31 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 124 A ZN 201 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc5 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 127 A ZN 201 1_555 ? ? ? ? ? ? ? 2.395 ? ? metalc6 metalc ? ? A CYS 34 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 127 A ZN 202 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc7 metalc ? ? A HIS 40 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 133 A ZN 203 1_555 ? ? ? ? ? ? ? 2.087 ? ? metalc8 metalc ? ? A HIS 43 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 136 A ZN 203 1_555 ? ? ? ? ? ? ? 2.094 ? ? metalc9 metalc ? ? A CYS 56 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 149 A ZN 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc10 metalc ? ? A CYS 58 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 151 A ZN 202 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc11 metalc ? ? A CYS 70 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 163 A ZN 202 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc12 metalc ? ? A HIS 73 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 166 A ZN 202 1_555 ? ? ? ? ? ? ? 2.110 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 99 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 124 ? 1_555 121.1 ? 2 SG ? A CYS 6 ? A CYS 99 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 34 ? A CYS 127 ? 1_555 106.1 ? 3 SG ? A CYS 31 ? A CYS 124 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 34 ? A CYS 127 ? 1_555 94.2 ? 4 SG ? A CYS 6 ? A CYS 99 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 149 ? 1_555 107.2 ? 5 SG ? A CYS 31 ? A CYS 124 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 149 ? 1_555 113.9 ? 6 SG ? A CYS 34 ? A CYS 127 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 149 ? 1_555 113.7 ? 7 SG ? A CYS 19 ? A CYS 112 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 SG ? A CYS 22 ? A CYS 115 ? 1_555 115.1 ? 8 SG ? A CYS 19 ? A CYS 112 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 40 ? A HIS 133 ? 1_555 110.3 ? 9 SG ? A CYS 22 ? A CYS 115 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 40 ? A HIS 133 ? 1_555 101.7 ? 10 SG ? A CYS 19 ? A CYS 112 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 43 ? A HIS 136 ? 1_555 111.3 ? 11 SG ? A CYS 22 ? A CYS 115 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 43 ? A HIS 136 ? 1_555 104.7 ? 12 ND1 ? A HIS 40 ? A HIS 133 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 43 ? A HIS 136 ? 1_555 113.3 ? 13 SG ? A CYS 34 ? A CYS 127 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 SG ? A CYS 58 ? A CYS 151 ? 1_555 109.7 ? 14 SG ? A CYS 34 ? A CYS 127 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 SG ? A CYS 70 ? A CYS 163 ? 1_555 109.8 ? 15 SG ? A CYS 58 ? A CYS 151 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 SG ? A CYS 70 ? A CYS 163 ? 1_555 111.5 ? 16 SG ? A CYS 34 ? A CYS 127 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 73 ? A HIS 166 ? 1_555 104.2 ? 17 SG ? A CYS 58 ? A CYS 151 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 73 ? A HIS 166 ? 1_555 118.7 ? 18 SG ? A CYS 70 ? A CYS 163 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 73 ? A HIS 166 ? 1_555 102.4 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NIY B 2 ? . . . . NIY C 2 ? 1_555 . . . . . . . TYR 1 NIY Nitration 'Named protein modification' 2 A1CH8 B 1 ? . . . . A1CH8 C 1 ? 1_555 . . . . . . . ARG 1 A1CH8 None 'Non-standard residue' 3 NH2 B 4 ? PHE B 3 ? NH2 C 4 ? 1_555 PHE C 3 ? 1_555 . . PHE 15 NH2 None 'Terminal amidation' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PRO A 15 ? CYS A 19 ? PRO A 108 CYS A 112 AA1 2 TYR A 45 ? THR A 49 ? TYR A 138 THR A 142 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 18 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 111 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 46 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 139 # _pdbx_entry_details.entry_id 9PG4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 304 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 334 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.00 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 341 ? ? 1_555 O A HOH 342 ? ? 1_655 2.01 2 1 O A HOH 325 ? ? 1_555 O A HOH 342 ? ? 1_655 2.08 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 C _pdbx_validate_rmsd_bond.auth_comp_id_1 PHE _pdbx_validate_rmsd_bond.auth_seq_id_1 3 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG _pdbx_validate_rmsd_bond.auth_asym_id_2 C _pdbx_validate_rmsd_bond.auth_comp_id_2 PHE _pdbx_validate_rmsd_bond.auth_seq_id_2 3 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.392 _pdbx_validate_rmsd_bond.bond_target_value 1.509 _pdbx_validate_rmsd_bond.bond_deviation -0.117 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.017 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 99 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -81.68 _pdbx_validate_torsion.psi -70.74 # _pdbx_molecule_features.prd_id PRD_002577 _pdbx_molecule_features.name 'AF23 peptide' _pdbx_molecule_features.type Peptide-like _pdbx_molecule_features.class Unknown _pdbx_molecule_features.details ? # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_002577 _pdbx_molecule.asym_id B # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1CH8 CAU C N N 1 A1CH8 CG C N N 2 A1CH8 CZ C N N 3 A1CH8 CA C N S 4 A1CH8 C C N N 5 A1CH8 CD C N N 6 A1CH8 CAV C N N 7 A1CH8 CB C N N 8 A1CH8 FAW F N N 9 A1CH8 FAX F N N 10 A1CH8 FAY F N N 11 A1CH8 N N N N 12 A1CH8 NE N N N 13 A1CH8 NH1 N N N 14 A1CH8 NH2 N N N 15 A1CH8 O O N N 16 A1CH8 H1 H N N 17 A1CH8 H3 H N N 18 A1CH8 HG2 H N N 19 A1CH8 HG3 H N N 20 A1CH8 HA H N N 21 A1CH8 OXT O N N 22 A1CH8 HD2 H N N 23 A1CH8 HD3 H N N 24 A1CH8 HB2 H N N 25 A1CH8 HB3 H N N 26 A1CH8 H H N N 27 A1CH8 H2 H N N 28 A1CH8 HE H N N 29 A1CH8 HH11 H N N 30 A1CH8 HH21 H N N 31 A1CH8 HXT H N N 32 ALA N N N N 33 ALA CA C N S 34 ALA C C N N 35 ALA O O N N 36 ALA CB C N N 37 ALA OXT O N N 38 ALA H H N N 39 ALA H2 H N N 40 ALA HA H N N 41 ALA HB1 H N N 42 ALA HB2 H N N 43 ALA HB3 H N N 44 ALA HXT H N N 45 ARG N N N N 46 ARG CA C N S 47 ARG C C N N 48 ARG O O N N 49 ARG CB C N N 50 ARG CG C N N 51 ARG CD C N N 52 ARG NE N N N 53 ARG CZ C N N 54 ARG NH1 N N N 55 ARG NH2 N N N 56 ARG OXT O N N 57 ARG H H N N 58 ARG H2 H N N 59 ARG HA H N N 60 ARG HB2 H N N 61 ARG HB3 H N N 62 ARG HG2 H N N 63 ARG HG3 H N N 64 ARG HD2 H N N 65 ARG HD3 H N N 66 ARG HE H N N 67 ARG HH11 H N N 68 ARG HH12 H N N 69 ARG HH21 H N N 70 ARG HH22 H N N 71 ARG HXT H N N 72 ASP N N N N 73 ASP CA C N S 74 ASP C C N N 75 ASP O O N N 76 ASP CB C N N 77 ASP CG C N N 78 ASP OD1 O N N 79 ASP OD2 O N N 80 ASP OXT O N N 81 ASP H H N N 82 ASP H2 H N N 83 ASP HA H N N 84 ASP HB2 H N N 85 ASP HB3 H N N 86 ASP HD2 H N N 87 ASP HXT H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 NH2 N N N N 265 NH2 HN1 H N N 266 NH2 HN2 H N N 267 NIY N N N N 268 NIY CA C N S 269 NIY C C N N 270 NIY O O N N 271 NIY CB C N N 272 NIY CG C Y N 273 NIY CD1 C Y N 274 NIY CD2 C Y N 275 NIY CE1 C Y N 276 NIY CE2 C Y N 277 NIY CZ C Y N 278 NIY OH O N N 279 NIY NN N N N 280 NIY O1 O N N 281 NIY O2 O N N 282 NIY OXT O N N 283 NIY H H N N 284 NIY H2 H N N 285 NIY HA H N N 286 NIY HB2 H N N 287 NIY HB3 H N N 288 NIY HD1 H N N 289 NIY HD2 H N N 290 NIY HE2 H N N 291 NIY HH H N N 292 NIY HXT H N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 ZN ZN ZN N N 435 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1CH8 N CA sing N N 1 A1CH8 NH1 CZ doub N N 2 A1CH8 O C doub N N 3 A1CH8 CA C sing N N 4 A1CH8 CA CB sing N N 5 A1CH8 CG CB sing N N 6 A1CH8 CG CD sing N N 7 A1CH8 CZ NH2 sing N N 8 A1CH8 CZ NE sing N N 9 A1CH8 NH2 CAU sing N N 10 A1CH8 CD NE sing N N 11 A1CH8 CAU CAV sing N N 12 A1CH8 FAX CAV sing N N 13 A1CH8 CAV FAW sing N N 14 A1CH8 CAV FAY sing N N 15 A1CH8 CAU H1 sing N N 16 A1CH8 CAU H3 sing N N 17 A1CH8 CG HG2 sing N N 18 A1CH8 CG HG3 sing N N 19 A1CH8 CA HA sing N N 20 A1CH8 C OXT sing N N 21 A1CH8 CD HD2 sing N N 22 A1CH8 CD HD3 sing N N 23 A1CH8 CB HB2 sing N N 24 A1CH8 CB HB3 sing N N 25 A1CH8 N H sing N N 26 A1CH8 N H2 sing N N 27 A1CH8 NE HE sing N N 28 A1CH8 NH1 HH11 sing N N 29 A1CH8 NH2 HH21 sing N N 30 A1CH8 OXT HXT sing N N 31 ALA N CA sing N N 32 ALA N H sing N N 33 ALA N H2 sing N N 34 ALA CA C sing N N 35 ALA CA CB sing N N 36 ALA CA HA sing N N 37 ALA C O doub N N 38 ALA C OXT sing N N 39 ALA CB HB1 sing N N 40 ALA CB HB2 sing N N 41 ALA CB HB3 sing N N 42 ALA OXT HXT sing N N 43 ARG N CA sing N N 44 ARG N H sing N N 45 ARG N H2 sing N N 46 ARG CA C sing N N 47 ARG CA CB sing N N 48 ARG CA HA sing N N 49 ARG C O doub N N 50 ARG C OXT sing N N 51 ARG CB CG sing N N 52 ARG CB HB2 sing N N 53 ARG CB HB3 sing N N 54 ARG CG CD sing N N 55 ARG CG HG2 sing N N 56 ARG CG HG3 sing N N 57 ARG CD NE sing N N 58 ARG CD HD2 sing N N 59 ARG CD HD3 sing N N 60 ARG NE CZ sing N N 61 ARG NE HE sing N N 62 ARG CZ NH1 sing N N 63 ARG CZ NH2 doub N N 64 ARG NH1 HH11 sing N N 65 ARG NH1 HH12 sing N N 66 ARG NH2 HH21 sing N N 67 ARG NH2 HH22 sing N N 68 ARG OXT HXT sing N N 69 ASP N CA sing N N 70 ASP N H sing N N 71 ASP N H2 sing N N 72 ASP CA C sing N N 73 ASP CA CB sing N N 74 ASP CA HA sing N N 75 ASP C O doub N N 76 ASP C OXT sing N N 77 ASP CB CG sing N N 78 ASP CB HB2 sing N N 79 ASP CB HB3 sing N N 80 ASP CG OD1 doub N N 81 ASP CG OD2 sing N N 82 ASP OD2 HD2 sing N N 83 ASP OXT HXT sing N N 84 CYS N CA sing N N 85 CYS N H sing N N 86 CYS N H2 sing N N 87 CYS CA C sing N N 88 CYS CA CB sing N N 89 CYS CA HA sing N N 90 CYS C O doub N N 91 CYS C OXT sing N N 92 CYS CB SG sing N N 93 CYS CB HB2 sing N N 94 CYS CB HB3 sing N N 95 CYS SG HG sing N N 96 CYS OXT HXT sing N N 97 GLN N CA sing N N 98 GLN N H sing N N 99 GLN N H2 sing N N 100 GLN CA C sing N N 101 GLN CA CB sing N N 102 GLN CA HA sing N N 103 GLN C O doub N N 104 GLN C OXT sing N N 105 GLN CB CG sing N N 106 GLN CB HB2 sing N N 107 GLN CB HB3 sing N N 108 GLN CG CD sing N N 109 GLN CG HG2 sing N N 110 GLN CG HG3 sing N N 111 GLN CD OE1 doub N N 112 GLN CD NE2 sing N N 113 GLN NE2 HE21 sing N N 114 GLN NE2 HE22 sing N N 115 GLN OXT HXT sing N N 116 GLU N CA sing N N 117 GLU N H sing N N 118 GLU N H2 sing N N 119 GLU CA C sing N N 120 GLU CA CB sing N N 121 GLU CA HA sing N N 122 GLU C O doub N N 123 GLU C OXT sing N N 124 GLU CB CG sing N N 125 GLU CB HB2 sing N N 126 GLU CB HB3 sing N N 127 GLU CG CD sing N N 128 GLU CG HG2 sing N N 129 GLU CG HG3 sing N N 130 GLU CD OE1 doub N N 131 GLU CD OE2 sing N N 132 GLU OE2 HE2 sing N N 133 GLU OXT HXT sing N N 134 GLY N CA sing N N 135 GLY N H sing N N 136 GLY N H2 sing N N 137 GLY CA C sing N N 138 GLY CA HA2 sing N N 139 GLY CA HA3 sing N N 140 GLY C O doub N N 141 GLY C OXT sing N N 142 GLY OXT HXT sing N N 143 HIS N CA sing N N 144 HIS N H sing N N 145 HIS N H2 sing N N 146 HIS CA C sing N N 147 HIS CA CB sing N N 148 HIS CA HA sing N N 149 HIS C O doub N N 150 HIS C OXT sing N N 151 HIS CB CG sing N N 152 HIS CB HB2 sing N N 153 HIS CB HB3 sing N N 154 HIS CG ND1 sing Y N 155 HIS CG CD2 doub Y N 156 HIS ND1 CE1 doub Y N 157 HIS ND1 HD1 sing N N 158 HIS CD2 NE2 sing Y N 159 HIS CD2 HD2 sing N N 160 HIS CE1 NE2 sing Y N 161 HIS CE1 HE1 sing N N 162 HIS NE2 HE2 sing N N 163 HIS OXT HXT sing N N 164 HOH O H1 sing N N 165 HOH O H2 sing N N 166 ILE N CA sing N N 167 ILE N H sing N N 168 ILE N H2 sing N N 169 ILE CA C sing N N 170 ILE CA CB sing N N 171 ILE CA HA sing N N 172 ILE C O doub N N 173 ILE C OXT sing N N 174 ILE CB CG1 sing N N 175 ILE CB CG2 sing N N 176 ILE CB HB sing N N 177 ILE CG1 CD1 sing N N 178 ILE CG1 HG12 sing N N 179 ILE CG1 HG13 sing N N 180 ILE CG2 HG21 sing N N 181 ILE CG2 HG22 sing N N 182 ILE CG2 HG23 sing N N 183 ILE CD1 HD11 sing N N 184 ILE CD1 HD12 sing N N 185 ILE CD1 HD13 sing N N 186 ILE OXT HXT sing N N 187 LEU N CA sing N N 188 LEU N H sing N N 189 LEU N H2 sing N N 190 LEU CA C sing N N 191 LEU CA CB sing N N 192 LEU CA HA sing N N 193 LEU C O doub N N 194 LEU C OXT sing N N 195 LEU CB CG sing N N 196 LEU CB HB2 sing N N 197 LEU CB HB3 sing N N 198 LEU CG CD1 sing N N 199 LEU CG CD2 sing N N 200 LEU CG HG sing N N 201 LEU CD1 HD11 sing N N 202 LEU CD1 HD12 sing N N 203 LEU CD1 HD13 sing N N 204 LEU CD2 HD21 sing N N 205 LEU CD2 HD22 sing N N 206 LEU CD2 HD23 sing N N 207 LEU OXT HXT sing N N 208 LYS N CA sing N N 209 LYS N H sing N N 210 LYS N H2 sing N N 211 LYS CA C sing N N 212 LYS CA CB sing N N 213 LYS CA HA sing N N 214 LYS C O doub N N 215 LYS C OXT sing N N 216 LYS CB CG sing N N 217 LYS CB HB2 sing N N 218 LYS CB HB3 sing N N 219 LYS CG CD sing N N 220 LYS CG HG2 sing N N 221 LYS CG HG3 sing N N 222 LYS CD CE sing N N 223 LYS CD HD2 sing N N 224 LYS CD HD3 sing N N 225 LYS CE NZ sing N N 226 LYS CE HE2 sing N N 227 LYS CE HE3 sing N N 228 LYS NZ HZ1 sing N N 229 LYS NZ HZ2 sing N N 230 LYS NZ HZ3 sing N N 231 LYS OXT HXT sing N N 232 MET N CA sing N N 233 MET N H sing N N 234 MET N H2 sing N N 235 MET CA C sing N N 236 MET CA CB sing N N 237 MET CA HA sing N N 238 MET C O doub N N 239 MET C OXT sing N N 240 MET CB CG sing N N 241 MET CB HB2 sing N N 242 MET CB HB3 sing N N 243 MET CG SD sing N N 244 MET CG HG2 sing N N 245 MET CG HG3 sing N N 246 MET SD CE sing N N 247 MET CE HE1 sing N N 248 MET CE HE2 sing N N 249 MET CE HE3 sing N N 250 MET OXT HXT sing N N 251 NH2 N HN1 sing N N 252 NH2 N HN2 sing N N 253 NIY N CA sing N N 254 NIY N H sing N N 255 NIY N H2 sing N N 256 NIY CA C sing N N 257 NIY CA CB sing N N 258 NIY CA HA sing N N 259 NIY C O doub N N 260 NIY C OXT sing N N 261 NIY CB CG sing N N 262 NIY CB HB2 sing N N 263 NIY CB HB3 sing N N 264 NIY CG CD1 doub Y N 265 NIY CG CD2 sing Y N 266 NIY CD1 CE1 sing Y N 267 NIY CD1 HD1 sing N N 268 NIY CD2 CE2 doub Y N 269 NIY CD2 HD2 sing N N 270 NIY CE1 CZ doub Y N 271 NIY CE1 NN sing N N 272 NIY CE2 CZ sing Y N 273 NIY CE2 HE2 sing N N 274 NIY CZ OH sing N N 275 NIY OH HH sing N N 276 NIY NN O1 sing N N 277 NIY NN O2 doub N N 278 NIY OXT HXT sing N N 279 PHE N CA sing N N 280 PHE N H sing N N 281 PHE N H2 sing N N 282 PHE CA C sing N N 283 PHE CA CB sing N N 284 PHE CA HA sing N N 285 PHE C O doub N N 286 PHE C OXT sing N N 287 PHE CB CG sing N N 288 PHE CB HB2 sing N N 289 PHE CB HB3 sing N N 290 PHE CG CD1 doub Y N 291 PHE CG CD2 sing Y N 292 PHE CD1 CE1 sing Y N 293 PHE CD1 HD1 sing N N 294 PHE CD2 CE2 doub Y N 295 PHE CD2 HD2 sing N N 296 PHE CE1 CZ doub Y N 297 PHE CE1 HE1 sing N N 298 PHE CE2 CZ sing Y N 299 PHE CE2 HE2 sing N N 300 PHE CZ HZ sing N N 301 PHE OXT HXT sing N N 302 PRO N CA sing N N 303 PRO N CD sing N N 304 PRO N H sing N N 305 PRO CA C sing N N 306 PRO CA CB sing N N 307 PRO CA HA sing N N 308 PRO C O doub N N 309 PRO C OXT sing N N 310 PRO CB CG sing N N 311 PRO CB HB2 sing N N 312 PRO CB HB3 sing N N 313 PRO CG CD sing N N 314 PRO CG HG2 sing N N 315 PRO CG HG3 sing N N 316 PRO CD HD2 sing N N 317 PRO CD HD3 sing N N 318 PRO OXT HXT sing N N 319 SER N CA sing N N 320 SER N H sing N N 321 SER N H2 sing N N 322 SER CA C sing N N 323 SER CA CB sing N N 324 SER CA HA sing N N 325 SER C O doub N N 326 SER C OXT sing N N 327 SER CB OG sing N N 328 SER CB HB2 sing N N 329 SER CB HB3 sing N N 330 SER OG HG sing N N 331 SER OXT HXT sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TRP N CA sing N N 349 TRP N H sing N N 350 TRP N H2 sing N N 351 TRP CA C sing N N 352 TRP CA CB sing N N 353 TRP CA HA sing N N 354 TRP C O doub N N 355 TRP C OXT sing N N 356 TRP CB CG sing N N 357 TRP CB HB2 sing N N 358 TRP CB HB3 sing N N 359 TRP CG CD1 doub Y N 360 TRP CG CD2 sing Y N 361 TRP CD1 NE1 sing Y N 362 TRP CD1 HD1 sing N N 363 TRP CD2 CE2 doub Y N 364 TRP CD2 CE3 sing Y N 365 TRP NE1 CE2 sing Y N 366 TRP NE1 HE1 sing N N 367 TRP CE2 CZ2 sing Y N 368 TRP CE3 CZ3 doub Y N 369 TRP CE3 HE3 sing N N 370 TRP CZ2 CH2 doub Y N 371 TRP CZ2 HZ2 sing N N 372 TRP CZ3 CH2 sing Y N 373 TRP CZ3 HZ3 sing N N 374 TRP CH2 HH2 sing N N 375 TRP OXT HXT sing N N 376 TYR N CA sing N N 377 TYR N H sing N N 378 TYR N H2 sing N N 379 TYR CA C sing N N 380 TYR CA CB sing N N 381 TYR CA HA sing N N 382 TYR C O doub N N 383 TYR C OXT sing N N 384 TYR CB CG sing N N 385 TYR CB HB2 sing N N 386 TYR CB HB3 sing N N 387 TYR CG CD1 doub Y N 388 TYR CG CD2 sing Y N 389 TYR CD1 CE1 sing Y N 390 TYR CD1 HD1 sing N N 391 TYR CD2 CE2 doub Y N 392 TYR CD2 HD2 sing N N 393 TYR CE1 CZ doub Y N 394 TYR CE1 HE1 sing N N 395 TYR CE2 CZ sing Y N 396 TYR CE2 HE2 sing N N 397 TYR CZ OH sing N N 398 TYR OH HH sing N N 399 TYR OXT HXT sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Defense (DOD, United States)' 'United States' HT9425-23-1-0560 1 'Department of Defense (DOD, United States)' 'United States' PA220024P1 2 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' 'R01 CA212119' 3 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' 'R01 CA265410' 4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ny2 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9PG4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.035974 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.018639 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022864 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.040267 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S ZN # loop_ #