data_9QLM # _entry.id 9QLM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QLM pdb_00009qlm 10.2210/pdb9qlm/pdb WWPDB D_1292146471 ? ? BMRB 34986 ? 10.13018/BMR34986 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-14 ? 2 'Structure model' 1 1 2025-07-23 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation.country' 3 2 'Structure model' '_citation.journal_abbrev' 4 2 'Structure model' '_citation.journal_id_ASTM' 5 2 'Structure model' '_citation.journal_id_CSD' 6 2 'Structure model' '_citation.journal_id_ISSN' 7 2 'Structure model' '_citation.journal_volume' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9QLM _pdbx_database_status.recvd_initial_deposition_date 2025-03-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'complex of TAF3-PHD and H3K4me3 peptide' 2k17 unspecified BMRB 'Solution structure of the TAF3-PHD bound to a H3K4me3Q5ser histone tail peptide with a serotonylated glutamine' 34986 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email h.vaningen@uu.nl _pdbx_contact_author.name_first Hugo _pdbx_contact_author.name_last 'van Ingen' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0808-3811 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'van Ingen, H.' 1 0000-0002-0808-3811 'Gielingh, H.' 2 ? 'Pulido-Cortes, L.' 3 ? 'Thijssen, V.' 4 ? 'Timmers, H.T.M.' 5 ? 'Jongkees, S.' 6 ? 'Honorato, R.V.' 7 ? 'Bonvin, A.M.J.J.' 8 ? 'Liu, M.' 9 ? 'Yoshisada, R.' 10 ? 'Soares, L.R.' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 53 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Molecular determinants for recognition of serotonylated chromatin.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkaf612 _citation.pdbx_database_id_PubMed 40637225 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pulido-Cortes, L.' 1 ? primary 'Gielingh, H.' 2 ? primary 'Thijssen, V.' 3 ? primary 'Liu, M.' 4 ? primary 'Yoshisada, R.' 5 ? primary 'Romao Soares, L.' 6 ? primary 'Nizamuddin, S.' 7 0000-0002-4586-5898 primary 'Friedrich, F.' 8 0000-0001-5420-6184 primary 'Greschik, H.' 9 ? primary 'Peng, L.' 10 ? primary 'Vargas Honorato, R.' 11 ? primary 'Jung, M.' 12 ? primary 'Bonvin, A.M.J.J.' 13 0000-0001-7369-1322 primary 'Biniossek, M.L.' 14 ? primary 'Schule, R.' 15 ? primary 'Jongkees, S.' 16 ? primary 'van Ingen, H.' 17 0000-0002-0808-3811 primary 'Timmers, H.T.M.' 18 0000-0001-7062-1417 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcription initiation factor TFIID subunit 3' 8611.936 1 ? ? ? 'Plant Homeodomain of TAF3 with 2 zinc ions bound' 2 polymer syn 'Histone H3.1' 1351.553 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn SEROTONIN 176.215 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;140 kDa TATA box-binding protein-associated factor,TBP-associated factor 3,Transcription initiation factor TFIID 140 kDa subunit,TAF(II)140,TAF140,TAFII-140,TAFII140 ; 2 'Histone H3/a,Histone H3/b,Histone H3/c,Histone H3/d,Histone H3/f,Histone H3/h,Histone H3/i,Histone H3/j,Histone H3/k,Histone H3/l' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH A ? 2 'polypeptide(L)' no yes 'ART(M3L)ETARKSTG' ARTKETARKSTG B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 SEROTONIN SRO # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 MET n 1 7 ALA n 1 8 TYR n 1 9 VAL n 1 10 ILE n 1 11 ARG n 1 12 ASP n 1 13 GLU n 1 14 TRP n 1 15 GLY n 1 16 ASN n 1 17 GLN n 1 18 ILE n 1 19 TRP n 1 20 ILE n 1 21 CYS n 1 22 PRO n 1 23 GLY n 1 24 CYS n 1 25 ASN n 1 26 LYS n 1 27 PRO n 1 28 ASP n 1 29 ASP n 1 30 GLY n 1 31 SER n 1 32 PRO n 1 33 MET n 1 34 ILE n 1 35 GLY n 1 36 CYS n 1 37 ASP n 1 38 ASP n 1 39 CYS n 1 40 ASP n 1 41 ASP n 1 42 TRP n 1 43 TYR n 1 44 HIS n 1 45 TRP n 1 46 PRO n 1 47 CYS n 1 48 VAL n 1 49 GLY n 1 50 ILE n 1 51 MET n 1 52 ALA n 1 53 ALA n 1 54 PRO n 1 55 PRO n 1 56 GLU n 1 57 GLU n 1 58 MET n 1 59 GLN n 1 60 TRP n 1 61 PHE n 1 62 CYS n 1 63 PRO n 1 64 LYS n 1 65 CYS n 1 66 ALA n 1 67 ASN n 1 68 LYS n 1 69 ILE n 1 70 LYS n 1 71 LYS n 1 72 ASP n 1 73 LYS n 1 74 LYS n 1 75 HIS n 2 1 ALA n 2 2 ARG n 2 3 THR n 2 4 M3L n 2 5 GLU n 2 6 THR n 2 7 ALA n 2 8 ARG n 2 9 LYS n 2 10 SER n 2 11 THR n 2 12 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 75 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Taf3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SRO non-polymer . SEROTONIN '3-(2-AMINOETHYL)-1H-INDOL-5-OL' 'C10 H12 N2 O' 176.215 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 850 850 GLY GLY A . n A 1 2 SER 2 851 851 SER SER A . n A 1 3 HIS 3 852 852 HIS HIS A . n A 1 4 MET 4 853 853 MET MET A . n A 1 5 ALA 5 854 854 ALA ALA A . n A 1 6 MET 6 855 855 MET MET A . n A 1 7 ALA 7 856 856 ALA ALA A . n A 1 8 TYR 8 857 857 TYR TYR A . n A 1 9 VAL 9 858 858 VAL VAL A . n A 1 10 ILE 10 859 859 ILE ILE A . n A 1 11 ARG 11 860 860 ARG ARG A . n A 1 12 ASP 12 861 861 ASP ASP A . n A 1 13 GLU 13 862 862 GLU GLU A . n A 1 14 TRP 14 863 863 TRP TRP A . n A 1 15 GLY 15 864 864 GLY GLY A . n A 1 16 ASN 16 865 865 ASN ASN A . n A 1 17 GLN 17 866 866 GLN GLN A . n A 1 18 ILE 18 867 867 ILE ILE A . n A 1 19 TRP 19 868 868 TRP TRP A . n A 1 20 ILE 20 869 869 ILE ILE A . n A 1 21 CYS 21 870 870 CYS CYS A . n A 1 22 PRO 22 871 871 PRO PRO A . n A 1 23 GLY 23 872 872 GLY GLY A . n A 1 24 CYS 24 873 873 CYS CYS A . n A 1 25 ASN 25 874 874 ASN ASN A . n A 1 26 LYS 26 875 875 LYS LYS A . n A 1 27 PRO 27 876 876 PRO PRO A . n A 1 28 ASP 28 877 877 ASP ASP A . n A 1 29 ASP 29 878 878 ASP ASP A . n A 1 30 GLY 30 879 879 GLY GLY A . n A 1 31 SER 31 880 880 SER SER A . n A 1 32 PRO 32 881 881 PRO PRO A . n A 1 33 MET 33 882 882 MET MET A . n A 1 34 ILE 34 883 883 ILE ILE A . n A 1 35 GLY 35 884 884 GLY GLY A . n A 1 36 CYS 36 885 885 CYS CYS A . n A 1 37 ASP 37 886 886 ASP ASP A . n A 1 38 ASP 38 887 887 ASP ASP A . n A 1 39 CYS 39 888 888 CYS CYS A . n A 1 40 ASP 40 889 889 ASP ASP A . n A 1 41 ASP 41 890 890 ASP ASP A . n A 1 42 TRP 42 891 891 TRP TRP A . n A 1 43 TYR 43 892 892 TYR TYR A . n A 1 44 HIS 44 893 893 HIS HIS A . n A 1 45 TRP 45 894 894 TRP TRP A . n A 1 46 PRO 46 895 895 PRO PRO A . n A 1 47 CYS 47 896 896 CYS CYS A . n A 1 48 VAL 48 897 897 VAL VAL A . n A 1 49 GLY 49 898 898 GLY GLY A . n A 1 50 ILE 50 899 899 ILE ILE A . n A 1 51 MET 51 900 900 MET MET A . n A 1 52 ALA 52 901 901 ALA ALA A . n A 1 53 ALA 53 902 902 ALA ALA A . n A 1 54 PRO 54 903 903 PRO PRO A . n A 1 55 PRO 55 904 904 PRO PRO A . n A 1 56 GLU 56 905 905 GLU GLU A . n A 1 57 GLU 57 906 906 GLU GLU A . n A 1 58 MET 58 907 907 MET MET A . n A 1 59 GLN 59 908 908 GLN GLN A . n A 1 60 TRP 60 909 909 TRP TRP A . n A 1 61 PHE 61 910 910 PHE PHE A . n A 1 62 CYS 62 911 911 CYS CYS A . n A 1 63 PRO 63 912 912 PRO PRO A . n A 1 64 LYS 64 913 913 LYS LYS A . n A 1 65 CYS 65 914 914 CYS CYS A . n A 1 66 ALA 66 915 915 ALA ALA A . n A 1 67 ASN 67 916 916 ASN ASN A . n A 1 68 LYS 68 917 917 LYS LYS A . n A 1 69 ILE 69 918 918 ILE ILE A . n A 1 70 LYS 70 919 919 LYS LYS A . n A 1 71 LYS 71 920 920 LYS LYS A . n A 1 72 ASP 72 921 921 ASP ASP A . n A 1 73 LYS 73 922 922 LYS LYS A . n A 1 74 LYS 74 923 923 LYS LYS A . n A 1 75 HIS 75 924 924 HIS HIS A . n B 2 1 ALA 1 1 1 ALA ALA B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 THR 3 3 3 THR THR B . n B 2 4 M3L 4 4 4 M3L M3L B . n B 2 5 GLU 5 5 5 GLU GLU B . n B 2 6 THR 6 6 6 THR THR B . n B 2 7 ALA 7 7 7 ALA ALA B . n B 2 8 ARG 8 8 8 ARG ARG B . n B 2 9 LYS 9 9 9 LYS LYS B . n B 2 10 SER 10 10 10 SER SER B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 GLY 12 12 12 GLY GLY B . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 SRO ? ? SRO ? ? 'SUBJECT OF INVESTIGATION' ? 2 M3L ? ? M3L ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 1001 940 ZN ZN A . D 3 ZN 1 1002 941 ZN ZN A . E 4 SRO 1 101 101 SRO SRO B . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QLM _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9QLM _struct.title 'Solution structure of the TAF3-PHD bound to a H3K4me3Q5ser histone tail peptide with a serotonylated glutamine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QLM _struct_keywords.text 'serotonylation, methylation, histone H3, GENE REGULATION, TFIID' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TAF3_MOUSE Q5HZG4 ? 1 YVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH 857 2 UNP H31_HUMAN P68431 ? 2 ARTKQTARKSTG 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9QLM A 8 ? 75 ? Q5HZG4 857 ? 924 ? 857 924 2 2 9QLM B 1 ? 12 ? P68431 2 ? 13 ? 1 12 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9QLM GLY A 1 ? UNP Q5HZG4 ? ? 'expression tag' 850 1 1 9QLM SER A 2 ? UNP Q5HZG4 ? ? 'expression tag' 851 2 1 9QLM HIS A 3 ? UNP Q5HZG4 ? ? 'expression tag' 852 3 1 9QLM MET A 4 ? UNP Q5HZG4 ? ? 'expression tag' 853 4 1 9QLM ALA A 5 ? UNP Q5HZG4 ? ? 'expression tag' 854 5 1 9QLM MET A 6 ? UNP Q5HZG4 ? ? 'expression tag' 855 6 1 9QLM ALA A 7 ? UNP Q5HZG4 ? ? 'expression tag' 856 7 2 9QLM GLU B 5 ? UNP P68431 GLN 6 conflict 5 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TRP A 45 ? GLY A 49 ? TRP A 894 GLY A 898 1 ? 5 HELX_P HELX_P2 AA2 LYS A 64 ? LYS A 71 ? LYS A 913 LYS A 920 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B THR 3 C ? ? ? 1_555 B M3L 4 N ? ? B THR 3 B M3L 4 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? B M3L 4 C ? ? ? 1_555 B GLU 5 N ? ? B M3L 4 B GLU 5 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale3 covale none ? B GLU 5 CD ? ? ? 1_555 E SRO . NZ ? ? B GLU 5 B SRO 101 1_555 ? ? ? ? ? ? ? 1.321 ? ? metalc1 metalc ? ? A CYS 21 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 870 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.660 ? ? metalc2 metalc ? ? A CYS 24 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 873 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.611 ? ? metalc3 metalc ? ? A CYS 36 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 885 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.454 ? ? metalc4 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 888 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.653 ? ? metalc5 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 893 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc6 metalc ? ? A CYS 47 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 896 A ZN 1002 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc7 metalc ? ? A CYS 62 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 911 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.705 ? ? metalc8 metalc ? ? A CYS 65 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 914 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.519 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 21 ? A CYS 870 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG ? A CYS 24 ? A CYS 873 ? 1_555 113.5 ? 2 SG ? A CYS 21 ? A CYS 870 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 ND1 ? A HIS 44 ? A HIS 893 ? 1_555 93.5 ? 3 SG ? A CYS 24 ? A CYS 873 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 ND1 ? A HIS 44 ? A HIS 893 ? 1_555 98.5 ? 4 SG ? A CYS 21 ? A CYS 870 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG ? A CYS 47 ? A CYS 896 ? 1_555 123.7 ? 5 SG ? A CYS 24 ? A CYS 873 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG ? A CYS 47 ? A CYS 896 ? 1_555 104.5 ? 6 ND1 ? A HIS 44 ? A HIS 893 ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 SG ? A CYS 47 ? A CYS 896 ? 1_555 120.7 ? 7 SG ? A CYS 36 ? A CYS 885 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 39 ? A CYS 888 ? 1_555 126.1 ? 8 SG ? A CYS 36 ? A CYS 885 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 62 ? A CYS 911 ? 1_555 117.5 ? 9 SG ? A CYS 39 ? A CYS 888 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 62 ? A CYS 911 ? 1_555 109.1 ? 10 SG ? A CYS 36 ? A CYS 885 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 65 ? A CYS 914 ? 1_555 113.2 ? 11 SG ? A CYS 39 ? A CYS 888 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 65 ? A CYS 914 ? 1_555 83.2 ? 12 SG ? A CYS 62 ? A CYS 911 ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 65 ? A CYS 914 ? 1_555 99.1 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 M3L B 4 ? . . . . M3L B 4 ? 1_555 . . . . . . . LYS 1 M3L Methylation 'Named protein modification' 2 SRO E . ? GLU B 5 ? SRO B 101 ? 1_555 GLU B 5 ? 1_555 NZ CD GLU 1 SRO None 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 9 ? ARG A 11 ? VAL A 858 ARG A 860 AA1 2 GLN A 17 ? TRP A 19 ? GLN A 866 TRP A 868 AA2 1 TRP A 42 ? HIS A 44 ? TRP A 891 HIS A 893 AA2 2 PRO A 32 ? GLY A 35 ? PRO A 881 GLY A 884 AA2 3 ARG B 2 ? GLU B 5 ? ARG B 2 GLU B 5 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 10 ? N ILE A 859 O ILE A 18 ? O ILE A 867 AA2 1 2 O TYR A 43 ? O TYR A 892 N ILE A 34 ? N ILE A 883 AA2 2 3 N GLY A 35 ? N GLY A 884 O ARG B 2 ? O ARG B 2 # _pdbx_entry_details.entry_id 9QLM _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 921 ? ? H A HIS 924 ? ? 1.51 2 1 OD1 A ASP 889 ? ? HH21 B ARG 2 ? ? 1.57 3 1 OD2 A ASP 887 ? ? HZ3 A LYS 917 ? ? 1.58 4 2 OD2 A ASP 921 ? ? H A HIS 924 ? ? 1.55 5 2 OD2 A ASP 887 ? ? HZ3 A LYS 917 ? ? 1.58 6 3 OD2 A ASP 921 ? ? HZ1 A LYS 923 ? ? 1.52 7 3 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.54 8 3 OE2 A GLU 905 ? ? HH22 B ARG 2 ? ? 1.57 9 4 OD2 A ASP 921 ? ? HZ1 A LYS 923 ? ? 1.51 10 4 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.55 11 5 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.54 12 6 OE2 A GLU 905 ? ? HH22 B ARG 2 ? ? 1.55 13 6 OD2 A ASP 890 ? ? HZ2 A LYS 913 ? ? 1.60 14 7 HZ2 A LYS 875 ? ? OD2 A ASP 878 ? ? 1.55 15 7 OD2 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.56 16 8 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.56 17 9 OD2 A ASP 921 ? ? HZ1 A LYS 923 ? ? 1.52 18 9 OD2 A ASP 878 ? ? HH22 B ARG 8 ? ? 1.53 19 9 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.55 20 10 OE1 A GLU 905 ? ? HH21 B ARG 2 ? ? 1.60 21 13 OD1 A ASP 887 ? ? HZ3 A LYS 917 ? ? 1.57 22 14 OE2 A GLU 905 ? ? HH21 B ARG 2 ? ? 1.57 23 15 O A LYS 917 ? ? HZ2 A LYS 920 ? ? 1.58 24 15 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.58 25 16 OD2 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.58 26 17 OE1 A GLU 905 ? ? HH22 B ARG 2 ? ? 1.54 27 17 OD2 A ASP 890 ? ? HZ2 A LYS 913 ? ? 1.59 28 18 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.53 29 19 HZ2 A LYS 875 ? ? OD2 A ASP 878 ? ? 1.60 30 20 OD2 A ASP 921 ? ? HZ1 A LYS 923 ? ? 1.52 31 20 OD1 A ASP 887 ? ? HZ2 A LYS 917 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 857 ? ? -84.47 37.70 2 1 PRO A 871 ? ? -69.94 13.04 3 1 ASN A 874 ? ? 70.28 37.08 4 1 ASP A 889 ? ? 73.98 -19.71 5 1 LYS A 920 ? ? 76.62 140.47 6 1 LYS A 923 ? ? 155.06 47.41 7 2 TYR A 857 ? ? -82.56 38.54 8 2 ASP A 887 ? ? -132.28 -54.66 9 2 ASP A 889 ? ? 76.96 -18.37 10 2 PRO A 904 ? ? -57.26 109.55 11 2 PRO A 912 ? ? -56.34 -7.85 12 2 LYS A 920 ? ? 77.23 141.32 13 2 LYS A 923 ? ? 151.51 45.08 14 2 GLU B 5 ? ? -125.99 -86.01 15 2 ALA B 7 ? ? -53.11 100.45 16 2 SER B 10 ? ? -161.25 -110.27 17 2 THR B 11 ? ? -151.50 23.92 18 3 SER A 851 ? ? -76.49 41.21 19 3 ALA A 854 ? ? -118.00 -156.88 20 3 TYR A 857 ? ? 68.62 -61.52 21 3 ASP A 861 ? ? -98.81 -157.30 22 3 ASP A 878 ? ? -176.47 -27.45 23 3 ASP A 886 ? ? -97.76 32.67 24 3 ASP A 887 ? ? -147.53 -52.81 25 3 CYS A 888 ? ? -76.00 -95.87 26 3 ASP A 889 ? ? -138.76 -73.74 27 3 ASP A 890 ? ? -110.88 -149.86 28 3 ALA A 901 ? ? -173.80 -175.16 29 3 ASP A 921 ? ? -97.22 -72.90 30 3 LYS A 922 ? ? 55.74 70.34 31 3 LYS A 923 ? ? -159.13 -75.12 32 3 THR B 6 ? ? -90.19 52.30 33 3 SER B 10 ? ? -56.97 107.23 34 3 THR B 11 ? ? -144.57 29.25 35 4 SER A 851 ? ? -72.50 42.68 36 4 ALA A 854 ? ? -117.36 -156.44 37 4 TYR A 857 ? ? 70.01 -63.91 38 4 ASP A 861 ? ? -96.83 -157.59 39 4 ASP A 878 ? ? -159.61 68.36 40 4 ASP A 886 ? ? -98.63 35.82 41 4 ASP A 887 ? ? -152.87 -52.55 42 4 CYS A 888 ? ? -73.07 -96.05 43 4 ASP A 889 ? ? -139.90 -76.52 44 4 ASP A 890 ? ? -106.66 -148.12 45 4 ALA A 901 ? ? -173.00 -177.18 46 4 ASP A 921 ? ? -96.10 -75.45 47 4 LYS A 923 ? ? -156.53 -78.33 48 4 LYS B 9 ? ? -160.59 54.03 49 5 ALA A 856 ? ? 47.44 -107.25 50 5 ASN A 874 ? ? 71.56 54.04 51 5 ASP A 878 ? ? -160.16 65.84 52 5 ASP A 887 ? ? -107.48 -62.38 53 5 ASP A 921 ? ? 65.47 -156.07 54 5 GLU B 5 ? ? -172.56 -65.92 55 5 ARG B 8 ? ? -172.15 -64.06 56 5 SER B 10 ? ? 63.15 167.24 57 5 THR B 11 ? ? -76.80 -71.32 58 6 HIS A 852 ? ? -94.35 48.98 59 6 MET A 853 ? ? -77.75 -87.98 60 6 ALA A 854 ? ? -161.24 90.00 61 6 ALA A 856 ? ? -171.99 -163.67 62 6 TYR A 857 ? ? -95.26 48.71 63 6 ILE A 859 ? ? -113.94 -169.14 64 6 LYS A 919 ? ? 69.30 -45.09 65 6 LYS A 920 ? ? 67.14 78.52 66 6 LYS B 9 ? ? -103.59 52.49 67 7 HIS A 852 ? ? -144.69 45.99 68 7 ALA A 854 ? ? 55.67 -148.94 69 7 ALA A 856 ? ? -110.26 -165.17 70 7 PRO A 871 ? ? -68.15 3.89 71 7 ASP A 889 ? ? 74.28 -10.27 72 7 ALA A 901 ? ? -175.24 -172.58 73 7 LYS A 920 ? ? -140.15 21.38 74 8 HIS A 852 ? ? -161.96 96.56 75 8 MET A 853 ? ? -140.53 21.44 76 8 ILE A 859 ? ? -120.47 -169.51 77 8 ASP A 878 ? ? -145.82 47.30 78 8 ASP A 887 ? ? -120.90 -58.55 79 8 ALA A 901 ? ? -173.02 -178.98 80 8 LYS A 919 ? ? 70.07 -58.23 81 8 LYS A 920 ? ? 91.80 -34.55 82 8 GLU B 5 ? ? -164.12 -85.81 83 8 ALA B 7 ? ? -52.15 97.30 84 8 SER B 10 ? ? -154.21 -114.14 85 8 THR B 11 ? ? -141.38 20.73 86 9 SER A 851 ? ? -79.43 39.85 87 9 ALA A 854 ? ? -120.29 -160.48 88 9 TYR A 857 ? ? 68.43 -62.97 89 9 ASP A 861 ? ? -97.44 -159.60 90 9 ASP A 878 ? ? -157.85 66.93 91 9 ASP A 886 ? ? -90.68 32.28 92 9 ASP A 887 ? ? -146.94 -55.36 93 9 CYS A 888 ? ? -75.05 -92.71 94 9 ASP A 889 ? ? -139.28 -73.80 95 9 ASP A 890 ? ? -115.45 -145.41 96 9 ALA A 901 ? ? -174.64 -170.75 97 9 ASP A 921 ? ? -97.03 -72.36 98 9 LYS A 922 ? ? 55.09 72.55 99 9 LYS A 923 ? ? -161.42 -73.58 100 9 GLU B 5 ? ? -123.12 -80.28 101 9 THR B 6 ? ? 61.24 64.06 102 9 ALA B 7 ? ? -62.44 85.95 103 9 SER B 10 ? ? -129.53 -159.18 104 10 MET A 855 ? ? -88.59 38.11 105 10 ALA A 856 ? ? 67.86 174.74 106 10 ASP A 878 ? ? -158.29 40.94 107 10 LYS A 919 ? ? 66.57 -54.89 108 10 LYS A 920 ? ? 72.93 100.52 109 10 ASP A 921 ? ? -105.34 -158.78 110 10 GLU B 5 ? ? -134.93 -78.33 111 10 ALA B 7 ? ? -53.80 103.59 112 10 SER B 10 ? ? -149.19 -84.67 113 10 THR B 11 ? ? 177.53 -17.62 114 11 HIS A 852 ? ? -151.29 41.28 115 11 ALA A 854 ? ? 56.78 -145.40 116 11 ALA A 856 ? ? -108.00 -164.06 117 11 PRO A 871 ? ? -66.71 2.06 118 11 ASP A 889 ? ? 74.91 -14.02 119 11 ALA A 901 ? ? -174.71 -163.85 120 11 LYS A 920 ? ? -140.49 22.24 121 11 GLU B 5 ? ? -131.25 -77.91 122 11 ALA B 7 ? ? -58.75 109.86 123 11 ARG B 8 ? ? 83.03 22.26 124 11 SER B 10 ? ? -117.40 -70.61 125 11 THR B 11 ? ? -165.70 -72.52 126 12 MET A 855 ? ? -90.31 37.65 127 12 ALA A 856 ? ? 68.15 174.70 128 12 PRO A 871 ? ? -72.67 20.59 129 12 LYS A 919 ? ? 66.82 -54.40 130 12 LYS A 920 ? ? 72.34 101.69 131 12 ASP A 921 ? ? -106.60 -158.46 132 12 ARG B 8 ? ? -78.31 48.27 133 12 LYS B 9 ? ? -155.48 18.26 134 13 MET A 853 ? ? -93.44 -81.85 135 13 ALA A 854 ? ? 65.39 -97.46 136 13 ALA A 856 ? ? 66.45 60.60 137 13 ILE A 859 ? ? -115.33 -166.44 138 13 ASP A 861 ? ? -99.84 -153.99 139 13 ASP A 889 ? ? 72.75 -18.44 140 13 ASP A 921 ? ? 65.23 119.66 141 13 LYS A 923 ? ? 73.17 139.19 142 13 LYS B 9 ? ? -94.73 51.11 143 14 ALA A 856 ? ? 57.46 -143.93 144 14 PRO A 871 ? ? -67.14 0.96 145 14 ASP A 887 ? ? -107.05 -75.92 146 14 ALA A 901 ? ? -171.78 -179.89 147 14 GLU B 5 ? ? -111.44 -74.60 148 14 ALA B 7 ? ? -54.16 100.42 149 14 SER B 10 ? ? -174.83 -92.97 150 14 THR B 11 ? ? 173.79 -38.84 151 15 ALA A 854 ? ? -147.71 19.77 152 15 ALA A 856 ? ? 70.32 172.64 153 15 VAL A 858 ? ? -164.11 111.49 154 15 CYS A 885 ? ? 49.68 -146.05 155 15 ASP A 887 ? ? -131.35 -59.84 156 15 LYS A 920 ? ? 58.54 -161.39 157 15 LYS A 922 ? ? 58.45 -146.60 158 15 ARG B 8 ? ? -79.40 42.01 159 15 LYS B 9 ? ? -154.16 36.15 160 16 SER A 851 ? ? 58.24 -140.31 161 16 HIS A 852 ? ? -160.04 -66.58 162 16 MET A 853 ? ? 48.27 74.84 163 16 ALA A 854 ? ? -126.04 -72.95 164 16 MET A 855 ? ? -160.21 -166.37 165 16 TYR A 857 ? ? -77.28 47.01 166 16 ASP A 887 ? ? -105.39 -60.84 167 16 ASP A 889 ? ? 71.38 -2.68 168 16 GLN A 908 ? ? 68.13 164.59 169 16 PRO A 912 ? ? -58.14 -6.55 170 16 LYS A 919 ? ? -140.23 -56.66 171 16 LYS A 922 ? ? -175.51 -166.69 172 16 LYS A 923 ? ? 67.83 173.05 173 16 GLU B 5 ? ? -125.80 -67.30 174 16 ALA B 7 ? ? -48.71 104.78 175 16 ARG B 8 ? ? 81.57 29.52 176 16 SER B 10 ? ? -150.37 -78.03 177 16 THR B 11 ? ? 174.86 -19.27 178 17 HIS A 852 ? ? -93.07 52.05 179 17 MET A 853 ? ? -80.49 -87.44 180 17 ALA A 854 ? ? -162.12 90.18 181 17 ALA A 856 ? ? -171.63 -164.87 182 17 TYR A 857 ? ? -93.50 47.00 183 17 ILE A 859 ? ? -115.50 -169.80 184 17 ASP A 887 ? ? -117.19 -70.04 185 17 MET A 900 ? ? -140.46 21.17 186 17 LYS A 919 ? ? 69.39 -45.14 187 17 LYS A 920 ? ? 67.17 76.55 188 17 THR B 6 ? ? -84.99 34.69 189 17 LYS B 9 ? ? -101.26 66.23 190 18 ALA A 856 ? ? 44.60 -106.08 191 18 ASN A 874 ? ? 71.58 54.71 192 18 ASP A 878 ? ? -158.30 59.78 193 18 ASP A 887 ? ? -108.54 -61.63 194 18 ALA A 901 ? ? -174.29 -179.27 195 18 ASP A 921 ? ? 65.69 -155.99 196 18 GLU B 5 ? ? -126.29 -79.02 197 18 ALA B 7 ? ? -55.75 96.28 198 18 SER B 10 ? ? -176.88 -72.57 199 18 THR B 11 ? ? -178.86 -35.60 200 19 HIS A 852 ? ? -149.92 41.38 201 19 ALA A 854 ? ? 55.96 -147.48 202 19 ALA A 856 ? ? -109.12 -166.92 203 19 PRO A 871 ? ? -69.09 3.75 204 19 ASP A 889 ? ? 72.89 -16.13 205 19 ALA A 901 ? ? -179.02 -170.78 206 19 LYS A 920 ? ? -141.07 22.00 207 19 THR B 6 ? ? -87.08 42.97 208 19 LYS B 9 ? ? -147.48 47.94 209 19 SER B 10 ? ? -75.32 44.82 210 20 SER A 851 ? ? -74.28 42.61 211 20 ALA A 854 ? ? -117.21 -155.83 212 20 TYR A 857 ? ? 69.08 -64.22 213 20 ILE A 859 ? ? -128.55 -168.57 214 20 ASP A 861 ? ? -99.60 -155.98 215 20 ASP A 878 ? ? -161.86 76.22 216 20 ASP A 886 ? ? -99.20 30.58 217 20 ASP A 887 ? ? -144.41 -51.83 218 20 CYS A 888 ? ? -77.01 -96.81 219 20 ASP A 889 ? ? -139.06 -74.30 220 20 ASP A 890 ? ? -109.09 -149.60 221 20 ALA A 901 ? ? -171.24 -170.00 222 20 ASP A 921 ? ? -97.12 -74.07 223 20 LYS A 923 ? ? -157.88 -77.40 224 20 GLU B 5 ? ? -132.40 -77.09 225 20 ALA B 7 ? ? -47.98 96.67 226 20 SER B 10 ? ? -162.29 -96.18 227 20 THR B 11 ? ? -155.22 22.05 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id M3L _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id M3L _pdbx_struct_mod_residue.auth_seq_id 4 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_nmr_ensemble.entry_id 9QLM _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9QLM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 2 _pdbx_nmr_sample_details.contents ;0.88 mM [U-13C; U-15N] TAF3-PHD, 0.88 mM H3K4me3Q5ser, 20 mM potassium phosphate, 4 mM potassium chloride, 10 uM zinc chloride, 0.01 % w/v sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label NOESY_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '1:1 mix of TAF3-PHD (U-13C,15N) and unlabeled H3K4me3Q5ser peptide' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 2 TAF3-PHD 0.88 ? mM '[U-13C; U-15N]' 2 H3K4me3Q5ser 0.88 ? mM 'natural abundance' 2 'potassium phosphate' 20 ? mM 'natural abundance' 2 'potassium chloride' 4 ? mM 'natural abundance' 2 'zinc chloride' 10 ? uM 'natural abundance' 2 'sodium azide' 0.01 ? '% w/v' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 44 _pdbx_nmr_exptl_sample_conditions.details 'low-salt and 293K for best quality filtered NOESY' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label NOESY_conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D F2-filtered NOESY' 1 isotropic 2 1 2 '2D F2-filtered TOCSY' 1 isotropic 3 1 2 '3D 1H-13C NOESY aliphatic' 1 isotropic 4 1 2 '3D 1H-13C NOESY aromatic' 1 isotropic 5 1 2 '3D 1H-15N NOESY' 1 isotropic 6 1 2 '2D 1H-13C HSQC' 1 isotropic 7 1 2 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 9QLM _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement HADDOCK ? Bonvin 2 'structure calculation' HADDOCK ? Bonvin 3 'chemical shift assignment' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 4 'peak picking' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 M3L N N N N 205 M3L CA C N S 206 M3L CB C N N 207 M3L CG C N N 208 M3L CD C N N 209 M3L CE C N N 210 M3L NZ N N N 211 M3L C C N N 212 M3L O O N N 213 M3L OXT O N N 214 M3L CM1 C N N 215 M3L CM2 C N N 216 M3L CM3 C N N 217 M3L H H N N 218 M3L H2 H N N 219 M3L HA H N N 220 M3L HB2 H N N 221 M3L HB3 H N N 222 M3L HG2 H N N 223 M3L HG3 H N N 224 M3L HD2 H N N 225 M3L HD3 H N N 226 M3L HE2 H N N 227 M3L HE3 H N N 228 M3L HXT H N N 229 M3L HM11 H N N 230 M3L HM12 H N N 231 M3L HM13 H N N 232 M3L HM21 H N N 233 M3L HM22 H N N 234 M3L HM23 H N N 235 M3L HM31 H N N 236 M3L HM32 H N N 237 M3L HM33 H N N 238 MET N N N N 239 MET CA C N S 240 MET C C N N 241 MET O O N N 242 MET CB C N N 243 MET CG C N N 244 MET SD S N N 245 MET CE C N N 246 MET OXT O N N 247 MET H H N N 248 MET H2 H N N 249 MET HA H N N 250 MET HB2 H N N 251 MET HB3 H N N 252 MET HG2 H N N 253 MET HG3 H N N 254 MET HE1 H N N 255 MET HE2 H N N 256 MET HE3 H N N 257 MET HXT H N N 258 PHE N N N N 259 PHE CA C N S 260 PHE C C N N 261 PHE O O N N 262 PHE CB C N N 263 PHE CG C Y N 264 PHE CD1 C Y N 265 PHE CD2 C Y N 266 PHE CE1 C Y N 267 PHE CE2 C Y N 268 PHE CZ C Y N 269 PHE OXT O N N 270 PHE H H N N 271 PHE H2 H N N 272 PHE HA H N N 273 PHE HB2 H N N 274 PHE HB3 H N N 275 PHE HD1 H N N 276 PHE HD2 H N N 277 PHE HE1 H N N 278 PHE HE2 H N N 279 PHE HZ H N N 280 PHE HXT H N N 281 PRO N N N N 282 PRO CA C N S 283 PRO C C N N 284 PRO O O N N 285 PRO CB C N N 286 PRO CG C N N 287 PRO CD C N N 288 PRO OXT O N N 289 PRO H H N N 290 PRO HA H N N 291 PRO HB2 H N N 292 PRO HB3 H N N 293 PRO HG2 H N N 294 PRO HG3 H N N 295 PRO HD2 H N N 296 PRO HD3 H N N 297 PRO HXT H N N 298 SER N N N N 299 SER CA C N S 300 SER C C N N 301 SER O O N N 302 SER CB C N N 303 SER OG O N N 304 SER OXT O N N 305 SER H H N N 306 SER H2 H N N 307 SER HA H N N 308 SER HB2 H N N 309 SER HB3 H N N 310 SER HG H N N 311 SER HXT H N N 312 SRO OH O N N 313 SRO CZ3 C Y N 314 SRO CH2 C Y N 315 SRO CZ2 C Y N 316 SRO CE2 C Y N 317 SRO NE1 N Y N 318 SRO CD1 C Y N 319 SRO CG C Y N 320 SRO CD2 C Y N 321 SRO CE3 C Y N 322 SRO CB C N N 323 SRO CA C N N 324 SRO NZ N N N 325 SRO HOH H N N 326 SRO HH2 H N N 327 SRO HZ2 H N N 328 SRO HNE1 H N N 329 SRO HD1 H N N 330 SRO HE3 H N N 331 SRO HB1 H N N 332 SRO HB2 H N N 333 SRO HA1 H N N 334 SRO HA2 H N N 335 SRO HNZ1 H N N 336 SRO HNZ2 H N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TRP N N N N 355 TRP CA C N S 356 TRP C C N N 357 TRP O O N N 358 TRP CB C N N 359 TRP CG C Y N 360 TRP CD1 C Y N 361 TRP CD2 C Y N 362 TRP NE1 N Y N 363 TRP CE2 C Y N 364 TRP CE3 C Y N 365 TRP CZ2 C Y N 366 TRP CZ3 C Y N 367 TRP CH2 C Y N 368 TRP OXT O N N 369 TRP H H N N 370 TRP H2 H N N 371 TRP HA H N N 372 TRP HB2 H N N 373 TRP HB3 H N N 374 TRP HD1 H N N 375 TRP HE1 H N N 376 TRP HE3 H N N 377 TRP HZ2 H N N 378 TRP HZ3 H N N 379 TRP HH2 H N N 380 TRP HXT H N N 381 TYR N N N N 382 TYR CA C N S 383 TYR C C N N 384 TYR O O N N 385 TYR CB C N N 386 TYR CG C Y N 387 TYR CD1 C Y N 388 TYR CD2 C Y N 389 TYR CE1 C Y N 390 TYR CE2 C Y N 391 TYR CZ C Y N 392 TYR OH O N N 393 TYR OXT O N N 394 TYR H H N N 395 TYR H2 H N N 396 TYR HA H N N 397 TYR HB2 H N N 398 TYR HB3 H N N 399 TYR HD1 H N N 400 TYR HD2 H N N 401 TYR HE1 H N N 402 TYR HE2 H N N 403 TYR HH H N N 404 TYR HXT H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 ZN ZN ZN N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 M3L N CA sing N N 195 M3L N H sing N N 196 M3L N H2 sing N N 197 M3L CA CB sing N N 198 M3L CA C sing N N 199 M3L CA HA sing N N 200 M3L CB CG sing N N 201 M3L CB HB2 sing N N 202 M3L CB HB3 sing N N 203 M3L CG CD sing N N 204 M3L CG HG2 sing N N 205 M3L CG HG3 sing N N 206 M3L CD CE sing N N 207 M3L CD HD2 sing N N 208 M3L CD HD3 sing N N 209 M3L CE NZ sing N N 210 M3L CE HE2 sing N N 211 M3L CE HE3 sing N N 212 M3L NZ CM1 sing N N 213 M3L NZ CM2 sing N N 214 M3L NZ CM3 sing N N 215 M3L C O doub N N 216 M3L C OXT sing N N 217 M3L OXT HXT sing N N 218 M3L CM1 HM11 sing N N 219 M3L CM1 HM12 sing N N 220 M3L CM1 HM13 sing N N 221 M3L CM2 HM21 sing N N 222 M3L CM2 HM22 sing N N 223 M3L CM2 HM23 sing N N 224 M3L CM3 HM31 sing N N 225 M3L CM3 HM32 sing N N 226 M3L CM3 HM33 sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 SRO OH CZ3 sing N N 300 SRO OH HOH sing N N 301 SRO CZ3 CE3 doub Y N 302 SRO CZ3 CH2 sing Y N 303 SRO CH2 CZ2 doub Y N 304 SRO CH2 HH2 sing N N 305 SRO CZ2 CE2 sing Y N 306 SRO CZ2 HZ2 sing N N 307 SRO CE2 NE1 sing Y N 308 SRO CE2 CD2 doub Y N 309 SRO NE1 CD1 sing Y N 310 SRO NE1 HNE1 sing N N 311 SRO CD1 CG doub Y N 312 SRO CD1 HD1 sing N N 313 SRO CG CB sing N N 314 SRO CG CD2 sing Y N 315 SRO CD2 CE3 sing Y N 316 SRO CE3 HE3 sing N N 317 SRO CB CA sing N N 318 SRO CB HB1 sing N N 319 SRO CB HB2 sing N N 320 SRO CA NZ sing N N 321 SRO CA HA1 sing N N 322 SRO CA HA2 sing N N 323 SRO NZ HNZ1 sing N N 324 SRO NZ HNZ2 sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal iNEXT-Discovery 'European Union' 'PID 12004' 1 'German Research Foundation (DFG)' Germany SFB992 2 'German Research Foundation (DFG)' Germany TI688/1-1 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9QLM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ #