data_9QNU # _entry.id 9QNU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QNU pdb_00009qnu 10.2210/pdb9qnu/pdb WWPDB D_1292146613 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-24 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'ABA B 1 HAS WRONG CHIRALITY AT ATOM CA' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9QNU _pdbx_database_status.recvd_initial_deposition_date 2025-03-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email ivan.huc@cup.lmu.de _pdbx_contact_author.name_first Ivan _pdbx_contact_author.name_last Huc _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7036-9696 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sigl, J.C.' 1 0009-0004-0880-3008 'Wang, L.' 2 ? 'Douat, C.' 3 0000-0003-2678-1047 'Huc, I.' 4 0000-0001-7036-9696 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of Nanofitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sigl, J.C.' 1 0009-0004-0880-3008 primary 'Wang, L.' 2 ? primary 'Douat, C.' 3 0000-0003-2678-1047 primary 'Huc, I.' 4 0000-0001-7036-9696 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Foldamer-binding Nanofitin C10 fused to a coiled-coil domain' 11571.341 1 ? ? ? ? 2 polymer syn 'Aromatic oligoamide foldamer' 3783.033 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPVKVKFKYKGEEKEVDTSKITHVFRHGKLVVFYYDDNGKTGHGLVPEKDAPKELLDMLARAEREKAAIAQIIAAQEEML RKERELEEARKKLAQIRQQQ ; ;GPVKVKFKYKGEEKEVDTSKITHVFRHGKLVVFYYDDNGKTGHGLVPEKDAPKELLDMLARAEREKAAIAQIIAAQEEML RKERELEEARKKLAQIRQQQ ; A ? 2 'polypeptide(D)' no yes ;(ABA)(ZY9)(QUK)(QUK)(QUK)(QUK)(A1I9P)(A1I9P)(A1I9P)(A1I9P)(A1IKE)(QVE)(QUK)(QVS) (QOL)(QVE) ; AXXXXXXXXXXXXXXX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 VAL n 1 4 LYS n 1 5 VAL n 1 6 LYS n 1 7 PHE n 1 8 LYS n 1 9 TYR n 1 10 LYS n 1 11 GLY n 1 12 GLU n 1 13 GLU n 1 14 LYS n 1 15 GLU n 1 16 VAL n 1 17 ASP n 1 18 THR n 1 19 SER n 1 20 LYS n 1 21 ILE n 1 22 THR n 1 23 HIS n 1 24 VAL n 1 25 PHE n 1 26 ARG n 1 27 HIS n 1 28 GLY n 1 29 LYS n 1 30 LEU n 1 31 VAL n 1 32 VAL n 1 33 PHE n 1 34 TYR n 1 35 TYR n 1 36 ASP n 1 37 ASP n 1 38 ASN n 1 39 GLY n 1 40 LYS n 1 41 THR n 1 42 GLY n 1 43 HIS n 1 44 GLY n 1 45 LEU n 1 46 VAL n 1 47 PRO n 1 48 GLU n 1 49 LYS n 1 50 ASP n 1 51 ALA n 1 52 PRO n 1 53 LYS n 1 54 GLU n 1 55 LEU n 1 56 LEU n 1 57 ASP n 1 58 MET n 1 59 LEU n 1 60 ALA n 1 61 ARG n 1 62 ALA n 1 63 GLU n 1 64 ARG n 1 65 GLU n 1 66 LYS n 1 67 ALA n 1 68 ALA n 1 69 ILE n 1 70 ALA n 1 71 GLN n 1 72 ILE n 1 73 ILE n 1 74 ALA n 1 75 ALA n 1 76 GLN n 1 77 GLU n 1 78 GLU n 1 79 MET n 1 80 LEU n 1 81 ARG n 1 82 LYS n 1 83 GLU n 1 84 ARG n 1 85 GLU n 1 86 LEU n 1 87 GLU n 1 88 GLU n 1 89 ALA n 1 90 ARG n 1 91 LYS n 1 92 LYS n 1 93 LEU n 1 94 ALA n 1 95 GLN n 1 96 ILE n 1 97 ARG n 1 98 GLN n 1 99 GLN n 1 100 GLN n 2 1 ABA n 2 2 ZY9 n 2 3 QUK n 2 4 QUK n 2 5 QUK n 2 6 QUK n 2 7 A1I9P n 2 8 A1I9P n 2 9 A1I9P n 2 10 A1I9P n 2 11 A1IKE n 2 12 QVE n 2 13 QUK n 2 14 QVS n 2 15 QOL n 2 16 QVE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 100 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Saci_0064 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus acidocaldarius' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2285 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 16 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1I9P 'L-peptide linking' . '8-azanyl-4-[2-(2-methoxyethoxy)ethylsulfanyl]quinoline-2-carbaldehyde' ? 'C15 H18 N2 O4 S' 322.379 A1IKE 'L-peptide linking' . '(2~{S})-2-(2-azanylphenoxy)propanoic acid' ? 'C9 H11 N O3' 181.189 ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QOL 'L-peptide linking' . '8-azanyl-4-[2-(hydroxymethyl)-3-oxidanyl-propoxy]quinoline-2-carbaldehyde' ? 'C14 H16 N2 O5' 292.287 QUK 'L-peptide linking' . '8-azanyl-4-(3-azanylpropoxy)quinoline-2-carboxylic acid' ? 'C13 H15 N3 O3' 261.276 QVE 'L-peptide linking' . '8-azanyl-4-(2-hydroxy-2-oxoethyloxy)quinoline-2-carboxylic acid' ? 'C12 H10 N2 O5' 262.218 QVS 'L-peptide linking' . '8-azanyl-4-oxidanyl-quinoline-2-carboxylic acid' ? 'C10 H8 N2 O3' 204.182 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZY9 'L-peptide linking' . '6-(aminomethyl)pyridine-2-carboxylic acid' ? 'C7 H8 N2 O2' 152.151 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 PRO 2 1 1 PRO PRO A . n A 1 3 VAL 3 2 2 VAL VAL A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 VAL 5 4 4 VAL VAL A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 TYR 9 8 8 TYR TYR A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 LYS 14 13 13 LYS LYS A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 ASP 17 16 16 ASP ASP A . n A 1 18 THR 18 17 17 THR THR A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 THR 22 21 21 THR THR A . n A 1 23 HIS 23 22 22 HIS HIS A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 PHE 25 24 24 PHE PHE A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 HIS 27 26 26 HIS HIS A . n A 1 28 GLY 28 27 27 GLY GLY A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 VAL 32 31 31 VAL VAL A . n A 1 33 PHE 33 32 32 PHE PHE A . n A 1 34 TYR 34 33 33 TYR TYR A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 GLY 39 38 38 GLY GLY A . n A 1 40 LYS 40 39 39 LYS LYS A . n A 1 41 THR 41 40 40 THR THR A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 GLY 44 43 43 GLY GLY A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 PRO 47 46 46 PRO PRO A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 ALA 51 50 50 ALA ALA A . n A 1 52 PRO 52 51 51 PRO PRO A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 LEU 55 54 54 LEU LEU A . n A 1 56 LEU 56 55 55 LEU LEU A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 MET 58 57 57 MET MET A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 ARG 61 60 60 ARG ARG A . n A 1 62 ALA 62 61 61 ALA ALA A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 ARG 64 63 63 ARG ARG A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 LYS 66 65 65 LYS LYS A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 ILE 69 68 68 ILE ILE A . n A 1 70 ALA 70 69 69 ALA ALA A . n A 1 71 GLN 71 70 70 GLN GLN A . n A 1 72 ILE 72 71 71 ILE ILE A . n A 1 73 ILE 73 72 72 ILE ILE A . n A 1 74 ALA 74 73 73 ALA ALA A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 GLN 76 75 75 GLN GLN A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 MET 79 78 78 MET MET A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 ARG 81 80 80 ARG ARG A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 GLU 83 82 82 GLU GLU A . n A 1 84 ARG 84 83 83 ARG ARG A . n A 1 85 GLU 85 84 84 GLU GLU A . n A 1 86 LEU 86 85 85 LEU LEU A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 ALA 89 88 88 ALA ALA A . n A 1 90 ARG 90 89 89 ARG ARG A . n A 1 91 LYS 91 90 90 LYS LYS A . n A 1 92 LYS 92 91 91 LYS LYS A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 ALA 94 93 93 ALA ALA A . n A 1 95 GLN 95 94 94 GLN GLN A . n A 1 96 ILE 96 95 95 ILE ILE A . n A 1 97 ARG 97 96 96 ARG ARG A . n A 1 98 GLN 98 97 97 GLN GLN A . n A 1 99 GLN 99 98 ? ? ? A . n A 1 100 GLN 100 99 ? ? ? A . n B 2 1 ABA 1 1 1 ABA HUC B . n B 2 2 ZY9 2 2 2 ZY9 WLF B . n B 2 3 QUK 3 3 3 QUK QOR B . n B 2 4 QUK 4 4 4 QUK QOR B . n B 2 5 QUK 5 5 5 QUK QOR B . n B 2 6 QUK 6 6 6 QUK QOR B . n B 2 7 A1I9P 7 7 7 A1I9P VMO B . n B 2 8 A1I9P 8 8 8 A1I9P VMO B . n B 2 9 A1I9P 9 9 9 A1I9P VMO B . n B 2 10 A1I9P 10 10 10 A1I9P VMO B . n B 2 11 A1IKE 11 11 11 A1IKE BSS B . n B 2 12 QVE 12 12 12 QVE JCS B . n B 2 13 QUK 13 13 13 QUK QOR B . n B 2 14 QVS 14 14 14 QVS DOU B . n B 2 15 QOL 15 15 15 QOL QDI B . n B 2 16 QVE 16 16 16 QVE JCS B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 39 ? CG ? A LYS 40 CG 2 1 Y 1 A LYS 39 ? CD ? A LYS 40 CD 3 1 Y 1 A LYS 39 ? CE ? A LYS 40 CE 4 1 Y 1 A LYS 39 ? NZ ? A LYS 40 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9QNU _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.914 _cell.length_a_esd ? _cell.length_b 56.914 _cell.length_b_esd ? _cell.length_c 394.866 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9QNU _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QNU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description 'lightly yellow block' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 550 MME, 30 mM Sodium cacodylate, 30 mM MnCl2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8266 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8266 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9QNU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.53 _reflns.d_resolution_low 16.38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11489 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.59 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.24 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1297 _reflns.pdbx_Rpim_I_all 0.02625 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1269 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.53 _reflns_shell.d_res_low 2.62 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.25 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1105 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.329 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.846 _reflns_shell.pdbx_CC_star 0.957 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.64 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.684 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9QNU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.53 _refine.ls_d_res_low 16.38 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11423 _refine.ls_number_reflns_R_free 1142 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.10 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2457 _refine.ls_R_factor_R_free 0.2691 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2430 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.09 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.41 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.53 _refine_hist.d_res_low 16.38 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1063 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 790 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 273 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1084 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.717 ? 1440 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 35.246 ? 148 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 116 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 157 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.53 2.64 . . 138 1238 99.00 . . . . 0.3922 . . . . . . . . . . . . . . . 0.4535 'X-RAY DIFFRACTION' 2.64 2.78 . . 141 1263 100.00 . . . . 0.3639 . . . . . . . . . . . . . . . 0.4270 'X-RAY DIFFRACTION' 2.78 2.95 . . 140 1266 100.00 . . . . 0.3486 . . . . . . . . . . . . . . . 0.3396 'X-RAY DIFFRACTION' 2.95 3.18 . . 140 1268 99.00 . . . . 0.2842 . . . . . . . . . . . . . . . 0.3946 'X-RAY DIFFRACTION' 3.18 3.50 . . 136 1220 95.00 . . . . 0.2545 . . . . . . . . . . . . . . . 0.2978 'X-RAY DIFFRACTION' 3.50 4.00 . . 143 1295 100.00 . . . . 0.2610 . . . . . . . . . . . . . . . 0.2741 'X-RAY DIFFRACTION' 4.00 5.01 . . 147 1322 100.00 . . . . 0.2206 . . . . . . . . . . . . . . . 0.2228 'X-RAY DIFFRACTION' 5.02 16.38 . . 157 1409 99.00 . . . . 0.1960 . . . . . . . . . . . . . . . 0.2183 # _struct.entry_id 9QNU _struct.title ;Crystal structure of Nanofitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QNU _struct_keywords.text 'Protein-Foldamer complex, Affitin, Nanofitin, Symmetry assembly, coiled-coil, AOF, Aromatic oligoamide foldamer, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 9QNU 9QNU ? 1 ? 1 2 PDB 9QNU 9QNU ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9QNU A 1 ? 100 ? 9QNU 0 ? 99 ? 0 99 2 2 9QNU B 1 ? 16 ? 9QNU 1 ? 16 ? 1 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 1 2 A 1 3 B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -56.9140000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 49 ? ALA A 51 ? LYS A 48 ALA A 50 5 ? 3 HELX_P HELX_P2 AA2 PRO A 52 ? GLN A 98 ? PRO A 51 GLN A 97 1 ? 47 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ABA 1 C ? ? ? 1_555 B ZY9 2 N ? ? B ABA 1 B ZY9 2 1_555 ? ? ? ? ? ? ? 1.429 ? ? covale2 covale both ? B ZY9 2 C ? ? ? 1_555 B QUK 3 N ? ? B ZY9 2 B QUK 3 1_555 ? ? ? ? ? ? ? 1.429 ? ? covale3 covale both ? B QUK 3 C ? ? ? 1_555 B QUK 4 N ? ? B QUK 3 B QUK 4 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale4 covale both ? B QUK 4 C ? ? ? 1_555 B QUK 5 N ? ? B QUK 4 B QUK 5 1_555 ? ? ? ? ? ? ? 1.431 ? ? covale5 covale both ? B QUK 5 C ? ? ? 1_555 B QUK 6 N ? ? B QUK 5 B QUK 6 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale6 covale both ? B QUK 6 C ? ? ? 1_555 B A1I9P 7 N ? ? B QUK 6 B A1I9P 7 1_555 ? ? ? ? ? ? ? 1.431 ? ? covale7 covale both ? B A1I9P 7 C ? ? ? 1_555 B A1I9P 8 N ? ? B A1I9P 7 B A1I9P 8 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale8 covale both ? B A1I9P 8 C ? ? ? 1_555 B A1I9P 9 N ? ? B A1I9P 8 B A1I9P 9 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale9 covale both ? B A1I9P 9 C ? ? ? 1_555 B A1I9P 10 N ? ? B A1I9P 9 B A1I9P 10 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale10 covale both ? B A1I9P 10 C ? ? ? 1_555 B A1IKE 11 N ? ? B A1I9P 10 B A1IKE 11 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale11 covale both ? B A1IKE 11 C ? ? ? 1_555 B QVE 12 N ? ? B A1IKE 11 B QVE 12 1_555 ? ? ? ? ? ? ? 1.432 ? ? covale12 covale both ? B QVE 12 C ? ? ? 1_555 B QUK 13 N ? ? B QVE 12 B QUK 13 1_555 ? ? ? ? ? ? ? 1.429 ? ? covale13 covale both ? B QUK 13 C ? ? ? 1_555 B QVS 14 N ? ? B QUK 13 B QVS 14 1_555 ? ? ? ? ? ? ? 1.431 ? ? covale14 covale both ? B QVS 14 C ? ? ? 1_555 B QOL 15 N ? ? B QVS 14 B QOL 15 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale15 covale both ? B QOL 15 C ? ? ? 1_555 B QVE 16 N ? ? B QOL 15 B QVE 16 1_555 ? ? ? ? ? ? ? 1.430 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 ABA B 1 ? . . . . ABA B 1 ? 1_555 . . . . . . . ? 1 ABA None 'Non-standard residue' 2 ZY9 B 2 ? . . . . ZY9 B 2 ? 1_555 . . . . . . . ? 1 ZY9 None 'Non-standard residue' 3 QUK B 3 ? . . . . QUK B 3 ? 1_555 . . . . . . . ? 1 QUK None 'Non-standard residue' 4 QUK B 4 ? . . . . QUK B 4 ? 1_555 . . . . . . . ? 1 QUK None 'Non-standard residue' 5 QUK B 5 ? . . . . QUK B 5 ? 1_555 . . . . . . . ? 1 QUK None 'Non-standard residue' 6 QUK B 6 ? . . . . QUK B 6 ? 1_555 . . . . . . . ? 1 QUK None 'Non-standard residue' 7 A1I9P B 7 ? . . . . A1I9P B 7 ? 1_555 . . . . . . . ? 1 A1I9P None 'Non-standard residue' 8 A1I9P B 8 ? . . . . A1I9P B 8 ? 1_555 . . . . . . . ? 1 A1I9P None 'Non-standard residue' 9 A1I9P B 9 ? . . . . A1I9P B 9 ? 1_555 . . . . . . . ? 1 A1I9P None 'Non-standard residue' 10 A1I9P B 10 ? . . . . A1I9P B 10 ? 1_555 . . . . . . . ? 1 A1I9P None 'Non-standard residue' 11 A1IKE B 11 ? . . . . A1IKE B 11 ? 1_555 . . . . . . . ? 1 A1IKE None 'Non-standard residue' 12 QVE B 12 ? . . . . QVE B 12 ? 1_555 . . . . . . . ? 1 QVE None 'Non-standard residue' 13 QUK B 13 ? . . . . QUK B 13 ? 1_555 . . . . . . . ? 1 QUK None 'Non-standard residue' 14 QVS B 14 ? . . . . QVS B 14 ? 1_555 . . . . . . . ? 1 QVS None 'Non-standard residue' 15 QOL B 15 ? . . . . QOL B 15 ? 1_555 . . . . . . . ? 1 QOL None 'Non-standard residue' 16 QVE B 16 ? . . . . QVE B 16 ? 1_555 . . . . . . . ? 1 QVE None 'Non-standard residue' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 QUK 13 B . ? QUK 13 B QVS 14 B ? QVS 14 B 1 -26.55 2 QOL 15 B . ? QOL 15 B QVE 16 B ? QVE 16 B 1 -2.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 4 ? TYR A 9 ? LYS A 3 TYR A 8 AA1 2 GLU A 12 ? ASP A 17 ? GLU A 11 ASP A 16 AA2 1 ILE A 21 ? HIS A 27 ? ILE A 20 HIS A 26 AA2 2 LEU A 30 ? TYR A 35 ? LEU A 29 TYR A 34 AA2 3 GLY A 42 ? PRO A 47 ? GLY A 41 PRO A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 7 ? N PHE A 6 O LYS A 14 ? O LYS A 13 AA2 1 2 N THR A 22 ? N THR A 21 O TYR A 34 ? O TYR A 33 AA2 2 3 N VAL A 31 ? N VAL A 30 O VAL A 46 ? O VAL A 45 # _pdbx_entry_details.entry_id 9QNU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 N B ABA 1 ? ? 1_555 CA B ABA 1 ? ? 10_545 1.32 2 1 CB B ABA 1 ? ? 1_555 CG B ABA 1 ? ? 10_545 1.39 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C B ABA 1 ? ? N B ZY9 2 ? ? CA B ZY9 2 ? ? 146.01 121.70 24.31 2.50 Y 2 1 CA B QUK 3 ? ? C B QUK 3 ? ? N B QUK 4 ? ? 73.03 117.20 -44.17 2.20 Y 3 1 O B QUK 3 ? ? C B QUK 3 ? ? N B QUK 4 ? ? 138.00 122.70 15.30 1.60 Y 4 1 CA B QUK 4 ? ? C B QUK 4 ? ? N B QUK 5 ? ? 73.89 117.20 -43.31 2.20 Y 5 1 O B QUK 4 ? ? C B QUK 4 ? ? N B QUK 5 ? ? 139.52 122.70 16.82 1.60 Y 6 1 CA B QUK 5 ? ? C B QUK 5 ? ? N B QUK 6 ? ? 68.98 117.20 -48.22 2.20 Y 7 1 O B QUK 5 ? ? C B QUK 5 ? ? N B QUK 6 ? ? 143.08 122.70 20.38 1.60 Y 8 1 CA B QUK 6 ? ? C B QUK 6 ? ? N B A1I9P 7 ? ? 78.80 117.20 -38.40 2.20 Y 9 1 O B QUK 6 ? ? C B QUK 6 ? ? N B A1I9P 7 ? ? 133.08 122.70 10.38 1.60 Y 10 1 CA B A1I9P 7 ? ? C B A1I9P 7 ? ? N B A1I9P 8 ? ? 83.00 117.20 -34.20 2.20 Y 11 1 CA B A1I9P 8 ? ? C B A1I9P 8 ? ? N B A1I9P 9 ? ? 79.40 117.20 -37.80 2.20 Y 12 1 CA B A1I9P 9 ? ? C B A1I9P 9 ? ? N B A1I9P 10 ? ? 75.53 117.20 -41.67 2.20 Y 13 1 O B A1I9P 9 ? ? C B A1I9P 9 ? ? N B A1I9P 10 ? ? 136.57 122.70 13.87 1.60 Y 14 1 CA B A1I9P 10 ? ? C B A1I9P 10 ? ? N B A1IKE 11 ? ? 71.27 117.20 -45.93 2.20 Y 15 1 O B A1I9P 10 ? ? C B A1I9P 10 ? ? N B A1IKE 11 ? ? 142.54 122.70 19.84 1.60 Y 16 1 CA B A1IKE 11 ? ? C B A1IKE 11 ? ? N B QVE 12 ? ? 65.06 117.20 -52.14 2.20 Y 17 1 O B A1IKE 11 ? ? C B A1IKE 11 ? ? N B QVE 12 ? ? 139.26 122.70 16.56 1.60 Y 18 1 C B A1IKE 11 ? ? N B QVE 12 ? ? CA B QVE 12 ? ? 174.46 121.70 52.76 2.50 Y 19 1 CA B QVE 12 ? ? C B QVE 12 ? ? N B QUK 13 ? ? 97.78 117.20 -19.42 2.20 Y 20 1 O B QVE 12 ? ? C B QVE 12 ? ? N B QUK 13 ? ? 142.38 122.70 19.68 1.60 Y 21 1 CA B QUK 13 ? ? C B QUK 13 ? ? N B QVS 14 ? ? 73.11 117.20 -44.09 2.20 Y 22 1 O B QUK 13 ? ? C B QUK 13 ? ? N B QVS 14 ? ? 136.69 122.70 13.99 1.60 Y 23 1 C B QUK 13 ? ? N B QVS 14 ? ? CA B QVS 14 ? ? 174.61 121.70 52.91 2.50 Y 24 1 CA B QVS 14 ? ? C B QVS 14 ? ? N B QOL 15 ? ? 100.00 117.20 -17.20 2.20 Y 25 1 O B QVS 14 ? ? C B QVS 14 ? ? N B QOL 15 ? ? 139.33 122.70 16.63 1.60 Y 26 1 CA B QOL 15 ? ? C B QOL 15 ? ? N B QVE 16 ? ? 79.09 117.20 -38.11 2.20 Y 27 1 C B QOL 15 ? ? N B QVE 16 ? ? CA B QVE 16 ? ? 166.34 121.70 44.64 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 36 ? ? 61.19 -101.54 2 1 ASN A 37 ? ? -73.15 35.13 3 1 ZY9 B 2 ? ? -40.25 20.64 4 1 QUK B 3 ? ? -175.21 18.18 5 1 QUK B 4 ? ? -174.65 30.96 6 1 QUK B 5 ? ? 166.49 25.09 7 1 QUK B 6 ? ? 171.28 23.18 8 1 A1I9P B 7 ? ? 169.46 25.65 9 1 A1I9P B 8 ? ? 167.80 20.22 10 1 A1I9P B 9 ? ? 176.41 21.41 11 1 A1I9P B 10 ? ? 171.07 5.08 12 1 A1IKE B 11 ? ? -150.46 35.41 13 1 QUK B 13 ? ? 168.42 21.26 14 1 QVS B 14 ? ? 44.70 24.72 15 1 QOL B 15 ? ? 173.52 22.12 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ABA B 1 ? ? ZY9 B 2 ? ? 63.66 2 1 QUK B 4 ? ? QUK B 5 ? ? -147.81 3 1 A1I9P B 9 ? ? A1I9P B 10 ? ? -148.40 4 1 A1IKE B 11 ? ? QVE B 12 ? ? 115.91 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id B _pdbx_validate_chiral.auth_comp_id ABA _pdbx_validate_chiral.auth_seq_id 1 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B ABA 1 ? B ABA 1 2 1 B ABA 1 ? B ABA 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x,z+3/4 3 y+1/2,-x,z+3/4 4 x+1/2,-y,-z+3/4 5 -x+1/2,y,-z+3/4 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z 9 x+1/2,y+1/2,z+1/2 10 -y+1,x+1/2,z+5/4 11 y+1,-x+1/2,z+5/4 12 x+1,-y+1/2,-z+5/4 13 -x+1,y+1/2,-z+5/4 14 -x+1/2,-y+1/2,z+1/2 15 y+1/2,x+1/2,-z+1/2 16 -y+1/2,-x+1/2,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 24.9962 -10.1949 39.7801 0.5668 ? -0.0671 ? -0.1011 ? 0.7493 ? 0.2799 ? 0.6019 ? 4.8428 ? 0.0252 ? -3.4381 ? 5.3597 ? 1.6461 ? 7.1079 ? -0.5080 ? -0.3710 ? -0.2730 ? -0.0373 ? 0.5063 ? 0.4068 ? 0.0298 ? 0.5746 ? 0.0231 ? 2 'X-RAY DIFFRACTION' ? refined 29.4008 -20.6559 44.0975 1.0442 ? -0.1520 ? -0.1455 ? 2.2363 ? 1.0147 ? 1.5411 ? 6.5666 ? 1.0702 ? 6.7601 ? 7.2531 ? 6.4213 ? 1.9978 ? 0.3402 ? -1.3696 ? -1.5183 ? 0.4872 ? 0.8194 ? 0.7424 ? 2.3260 ? 1.7845 ? -1.0297 ? 3 'X-RAY DIFFRACTION' ? refined 22.5817 -19.8017 11.5245 1.0986 ? -0.0188 ? -0.1726 ? 0.8518 ? -0.0514 ? 0.5615 ? -0.2381 ? 0.1576 ? -0.6028 ? 1.4879 ? 3.7246 ? 6.7640 ? 0.1097 ? 0.1474 ? -0.2546 ? -0.5747 ? -0.2063 ? 0.1627 ? -0.0095 ? -0.5129 ? 0.0858 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 35 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 36 through 42 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 43 through 100 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 98 ? A GLN 99 2 1 Y 1 A GLN 99 ? A GLN 100 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1I9P N N N N 1 A1I9P CA C Y N 2 A1I9P C C N N 3 A1I9P O O N N 4 A1I9P C10 C Y N 5 A1I9P C16 C N N 6 A1I9P C17 C N N 7 A1I9P C19 C N N 8 A1I9P C20 C N N 9 A1I9P C22 C N N 10 A1I9P C3 C Y N 11 A1I9P C4 C Y N 12 A1I9P C5 C Y N 13 A1I9P C6 C Y N 14 A1I9P C7 C Y N 15 A1I9P C9 C Y N 16 A1I9P CA1 C Y N 17 A1I9P N1 N Y N 18 A1I9P O18 O N N 19 A1I9P O21 O N N 20 A1I9P S15 S N N 21 A1I9P H H N N 22 A1I9P H2 H N N 23 A1I9P H4 H N N 24 A1I9P H5 H N N 25 A1I9P H6 H N N 26 A1I9P H7 H N N 27 A1I9P H8 H N N 28 A1I9P H9 H N N 29 A1I9P H10 H N N 30 A1I9P H11 H N N 31 A1I9P H12 H N N 32 A1I9P H13 H N N 33 A1I9P H14 H N N 34 A1I9P H15 H N N 35 A1I9P H16 H N N 36 A1I9P H17 H N N 37 A1I9P H18 H N N 38 A1I9P OXT O N N 39 A1I9P HXT H N N 40 A1IKE N N N N 41 A1IKE O13 O N N 42 A1IKE CA C Y N 43 A1IKE C125 C Y N 44 A1IKE C126 C N S 45 A1IKE C127 C Y N 46 A1IKE C128 C N N 47 A1IKE C129 C Y N 48 A1IKE C C N N 49 A1IKE C131 C Y N 50 A1IKE C132 C Y N 51 A1IKE O O N N 52 A1IKE OXT O N N 53 A1IKE H H N N 54 A1IKE H2 H N N 55 A1IKE H3 H N N 56 A1IKE H4 H N N 57 A1IKE H5 H N N 58 A1IKE H6 H N N 59 A1IKE H7 H N N 60 A1IKE H8 H N N 61 A1IKE H9 H N N 62 A1IKE H10 H N N 63 A1IKE HXT H N N 64 ABA N N N N 65 ABA CA C N S 66 ABA C C N N 67 ABA O O N N 68 ABA CB C N N 69 ABA CG C N N 70 ABA OXT O N N 71 ABA H H N N 72 ABA H2 H N N 73 ABA HA H N N 74 ABA HB3 H N N 75 ABA HB2 H N N 76 ABA HG1 H N N 77 ABA HG3 H N N 78 ABA HG2 H N N 79 ABA HXT H N N 80 ALA N N N N 81 ALA CA C N S 82 ALA C C N N 83 ALA O O N N 84 ALA CB C N N 85 ALA OXT O N N 86 ALA H H N N 87 ALA H2 H N N 88 ALA HA H N N 89 ALA HB1 H N N 90 ALA HB2 H N N 91 ALA HB3 H N N 92 ALA HXT H N N 93 ARG N N N N 94 ARG CA C N S 95 ARG C C N N 96 ARG O O N N 97 ARG CB C N N 98 ARG CG C N N 99 ARG CD C N N 100 ARG NE N N N 101 ARG CZ C N N 102 ARG NH1 N N N 103 ARG NH2 N N N 104 ARG OXT O N N 105 ARG H H N N 106 ARG H2 H N N 107 ARG HA H N N 108 ARG HB2 H N N 109 ARG HB3 H N N 110 ARG HG2 H N N 111 ARG HG3 H N N 112 ARG HD2 H N N 113 ARG HD3 H N N 114 ARG HE H N N 115 ARG HH11 H N N 116 ARG HH12 H N N 117 ARG HH21 H N N 118 ARG HH22 H N N 119 ARG HXT H N N 120 ASN N N N N 121 ASN CA C N S 122 ASN C C N N 123 ASN O O N N 124 ASN CB C N N 125 ASN CG C N N 126 ASN OD1 O N N 127 ASN ND2 N N N 128 ASN OXT O N N 129 ASN H H N N 130 ASN H2 H N N 131 ASN HA H N N 132 ASN HB2 H N N 133 ASN HB3 H N N 134 ASN HD21 H N N 135 ASN HD22 H N N 136 ASN HXT H N N 137 ASP N N N N 138 ASP CA C N S 139 ASP C C N N 140 ASP O O N N 141 ASP CB C N N 142 ASP CG C N N 143 ASP OD1 O N N 144 ASP OD2 O N N 145 ASP OXT O N N 146 ASP H H N N 147 ASP H2 H N N 148 ASP HA H N N 149 ASP HB2 H N N 150 ASP HB3 H N N 151 ASP HD2 H N N 152 ASP HXT H N N 153 GLN N N N N 154 GLN CA C N S 155 GLN C C N N 156 GLN O O N N 157 GLN CB C N N 158 GLN CG C N N 159 GLN CD C N N 160 GLN OE1 O N N 161 GLN NE2 N N N 162 GLN OXT O N N 163 GLN H H N N 164 GLN H2 H N N 165 GLN HA H N N 166 GLN HB2 H N N 167 GLN HB3 H N N 168 GLN HG2 H N N 169 GLN HG3 H N N 170 GLN HE21 H N N 171 GLN HE22 H N N 172 GLN HXT H N N 173 GLU N N N N 174 GLU CA C N S 175 GLU C C N N 176 GLU O O N N 177 GLU CB C N N 178 GLU CG C N N 179 GLU CD C N N 180 GLU OE1 O N N 181 GLU OE2 O N N 182 GLU OXT O N N 183 GLU H H N N 184 GLU H2 H N N 185 GLU HA H N N 186 GLU HB2 H N N 187 GLU HB3 H N N 188 GLU HG2 H N N 189 GLU HG3 H N N 190 GLU HE2 H N N 191 GLU HXT H N N 192 GLY N N N N 193 GLY CA C N N 194 GLY C C N N 195 GLY O O N N 196 GLY OXT O N N 197 GLY H H N N 198 GLY H2 H N N 199 GLY HA2 H N N 200 GLY HA3 H N N 201 GLY HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 ILE N N N N 224 ILE CA C N S 225 ILE C C N N 226 ILE O O N N 227 ILE CB C N S 228 ILE CG1 C N N 229 ILE CG2 C N N 230 ILE CD1 C N N 231 ILE OXT O N N 232 ILE H H N N 233 ILE H2 H N N 234 ILE HA H N N 235 ILE HB H N N 236 ILE HG12 H N N 237 ILE HG13 H N N 238 ILE HG21 H N N 239 ILE HG22 H N N 240 ILE HG23 H N N 241 ILE HD11 H N N 242 ILE HD12 H N N 243 ILE HD13 H N N 244 ILE HXT H N N 245 LEU N N N N 246 LEU CA C N S 247 LEU C C N N 248 LEU O O N N 249 LEU CB C N N 250 LEU CG C N N 251 LEU CD1 C N N 252 LEU CD2 C N N 253 LEU OXT O N N 254 LEU H H N N 255 LEU H2 H N N 256 LEU HA H N N 257 LEU HB2 H N N 258 LEU HB3 H N N 259 LEU HG H N N 260 LEU HD11 H N N 261 LEU HD12 H N N 262 LEU HD13 H N N 263 LEU HD21 H N N 264 LEU HD22 H N N 265 LEU HD23 H N N 266 LEU HXT H N N 267 LYS N N N N 268 LYS CA C N S 269 LYS C C N N 270 LYS O O N N 271 LYS CB C N N 272 LYS CG C N N 273 LYS CD C N N 274 LYS CE C N N 275 LYS NZ N N N 276 LYS OXT O N N 277 LYS H H N N 278 LYS H2 H N N 279 LYS HA H N N 280 LYS HB2 H N N 281 LYS HB3 H N N 282 LYS HG2 H N N 283 LYS HG3 H N N 284 LYS HD2 H N N 285 LYS HD3 H N N 286 LYS HE2 H N N 287 LYS HE3 H N N 288 LYS HZ1 H N N 289 LYS HZ2 H N N 290 LYS HZ3 H N N 291 LYS HXT H N N 292 MET N N N N 293 MET CA C N S 294 MET C C N N 295 MET O O N N 296 MET CB C N N 297 MET CG C N N 298 MET SD S N N 299 MET CE C N N 300 MET OXT O N N 301 MET H H N N 302 MET H2 H N N 303 MET HA H N N 304 MET HB2 H N N 305 MET HB3 H N N 306 MET HG2 H N N 307 MET HG3 H N N 308 MET HE1 H N N 309 MET HE2 H N N 310 MET HE3 H N N 311 MET HXT H N N 312 PHE N N N N 313 PHE CA C N S 314 PHE C C N N 315 PHE O O N N 316 PHE CB C N N 317 PHE CG C Y N 318 PHE CD1 C Y N 319 PHE CD2 C Y N 320 PHE CE1 C Y N 321 PHE CE2 C Y N 322 PHE CZ C Y N 323 PHE OXT O N N 324 PHE H H N N 325 PHE H2 H N N 326 PHE HA H N N 327 PHE HB2 H N N 328 PHE HB3 H N N 329 PHE HD1 H N N 330 PHE HD2 H N N 331 PHE HE1 H N N 332 PHE HE2 H N N 333 PHE HZ H N N 334 PHE HXT H N N 335 PRO N N N N 336 PRO CA C N S 337 PRO C C N N 338 PRO O O N N 339 PRO CB C N N 340 PRO CG C N N 341 PRO CD C N N 342 PRO OXT O N N 343 PRO H H N N 344 PRO HA H N N 345 PRO HB2 H N N 346 PRO HB3 H N N 347 PRO HG2 H N N 348 PRO HG3 H N N 349 PRO HD2 H N N 350 PRO HD3 H N N 351 PRO HXT H N N 352 QOL OZ1 O N N 353 QOL CE1 C N N 354 QOL CD C N N 355 QOL CE2 C N N 356 QOL OZ2 O N N 357 QOL CG C N N 358 QOL OB O N N 359 QOL C8 C Y N 360 QOL C9 C Y N 361 QOL C10 C Y N 362 QOL C C N N 363 QOL O O N N 364 QOL N11 N Y N 365 QOL C7 C Y N 366 QOL C6 C Y N 367 QOL C5 C Y N 368 QOL C4 C Y N 369 QOL C3 C Y N 370 QOL CA C Y N 371 QOL N N N N 372 QOL H1 H N N 373 QOL H20 H N N 374 QOL H3 H N N 375 QOL H4 H N N 376 QOL H5 H N N 377 QOL H6 H N N 378 QOL H7 H N N 379 QOL H8 H N N 380 QOL H9 H N N 381 QOL H10 H N N 382 QOL H12 H N N 383 QOL H13 H N N 384 QOL H14 H N N 385 QOL H H N N 386 QOL H2 H N N 387 QOL OXT O N N 388 QOL HXT H N N 389 QUK O O N N 390 QUK C C N N 391 QUK C10 C Y N 392 QUK N11 N Y N 393 QUK C7 C Y N 394 QUK CA C Y N 395 QUK N N N N 396 QUK C9 C Y N 397 QUK C8 C Y N 398 QUK C6 C Y N 399 QUK C5 C Y N 400 QUK C4 C Y N 401 QUK C3 C Y N 402 QUK OB O N N 403 QUK CG C N N 404 QUK CD C N N 405 QUK CE C N N 406 QUK OXT O N N 407 QUK H H N N 408 QUK H2 H N N 409 QUK H3 H N N 410 QUK H4 H N N 411 QUK H5 H N N 412 QUK H6 H N N 413 QUK H7 H N N 414 QUK H8 H N N 415 QUK H9 H N N 416 QUK H10 H N N 417 QUK H11 H N N 418 QUK H12 H N N 419 QUK HXT H N N 420 QUK N1 N N N 421 QUK H13 H N N 422 QUK H15 H N N 423 QVE O O N N 424 QVE C C N N 425 QVE CA C Y N 426 QVE N11 N Y N 427 QVE C7 C Y N 428 QVE C2 C Y N 429 QVE N N N N 430 QVE C9 C Y N 431 QVE C8 C Y N 432 QVE OB O N N 433 QVE CG C N N 434 QVE CD C N N 435 QVE OE2 O N N 436 QVE OE1 O N N 437 QVE C6 C Y N 438 QVE C5 C Y N 439 QVE C4 C Y N 440 QVE C3 C Y N 441 QVE H2 H N N 442 QVE H H N N 443 QVE H4 H N N 444 QVE H5 H N N 445 QVE H6 H N N 446 QVE H7 H N N 447 QVE H8 H N N 448 QVE H9 H N N 449 QVE H10 H N N 450 QVE OXT O N N 451 QVE HXT H N N 452 QVS OB O N N 453 QVS C8 C Y N 454 QVS C9 C Y N 455 QVS CA C Y N 456 QVS C C N N 457 QVS O O N N 458 QVS N11 N Y N 459 QVS C7 C Y N 460 QVS C6 C Y N 461 QVS C5 C Y N 462 QVS C4 C Y N 463 QVS C3 C Y N 464 QVS C2 C Y N 465 QVS N N N N 466 QVS H1 H N N 467 QVS H3 H N N 468 QVS H4 H N N 469 QVS H5 H N N 470 QVS H6 H N N 471 QVS H H N N 472 QVS H2 H N N 473 QVS OXT O N N 474 QVS HXT H N N 475 SER N N N N 476 SER CA C N S 477 SER C C N N 478 SER O O N N 479 SER CB C N N 480 SER OG O N N 481 SER OXT O N N 482 SER H H N N 483 SER H2 H N N 484 SER HA H N N 485 SER HB2 H N N 486 SER HB3 H N N 487 SER HG H N N 488 SER HXT H N N 489 THR N N N N 490 THR CA C N S 491 THR C C N N 492 THR O O N N 493 THR CB C N R 494 THR OG1 O N N 495 THR CG2 C N N 496 THR OXT O N N 497 THR H H N N 498 THR H2 H N N 499 THR HA H N N 500 THR HB H N N 501 THR HG1 H N N 502 THR HG21 H N N 503 THR HG22 H N N 504 THR HG23 H N N 505 THR HXT H N N 506 TYR N N N N 507 TYR CA C N S 508 TYR C C N N 509 TYR O O N N 510 TYR CB C N N 511 TYR CG C Y N 512 TYR CD1 C Y N 513 TYR CD2 C Y N 514 TYR CE1 C Y N 515 TYR CE2 C Y N 516 TYR CZ C Y N 517 TYR OH O N N 518 TYR OXT O N N 519 TYR H H N N 520 TYR H2 H N N 521 TYR HA H N N 522 TYR HB2 H N N 523 TYR HB3 H N N 524 TYR HD1 H N N 525 TYR HD2 H N N 526 TYR HE1 H N N 527 TYR HE2 H N N 528 TYR HH H N N 529 TYR HXT H N N 530 VAL N N N N 531 VAL CA C N S 532 VAL C C N N 533 VAL O O N N 534 VAL CB C N N 535 VAL CG1 C N N 536 VAL CG2 C N N 537 VAL OXT O N N 538 VAL H H N N 539 VAL H2 H N N 540 VAL HA H N N 541 VAL HB H N N 542 VAL HG11 H N N 543 VAL HG12 H N N 544 VAL HG13 H N N 545 VAL HG21 H N N 546 VAL HG22 H N N 547 VAL HG23 H N N 548 VAL HXT H N N 549 ZY9 O O N N 550 ZY9 C C N N 551 ZY9 CA C Y N 552 ZY9 N11 N Y N 553 ZY9 C9 C Y N 554 ZY9 C8 C Y N 555 ZY9 C6 C Y N 556 ZY9 C7 C Y N 557 ZY9 C2 C N N 558 ZY9 N N N N 559 ZY9 OXT O N N 560 ZY9 H1 H N N 561 ZY9 H6 H N N 562 ZY9 H3 H N N 563 ZY9 H4 H N N 564 ZY9 H5 H N N 565 ZY9 H H N N 566 ZY9 H2 H N N 567 ZY9 HXT H N N 568 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1I9P O C doub N N 1 A1I9P C CA1 sing N N 2 A1I9P CA1 C3 doub Y N 3 A1I9P CA1 N1 sing Y N 4 A1I9P C3 C4 sing Y N 5 A1I9P C16 C17 sing N N 6 A1I9P C16 S15 sing N N 7 A1I9P N1 C9 doub Y N 8 A1I9P C17 O18 sing N N 9 A1I9P C4 S15 sing N N 10 A1I9P C4 C10 doub Y N 11 A1I9P C19 O18 sing N N 12 A1I9P C19 C20 sing N N 13 A1I9P C9 C10 sing Y N 14 A1I9P C9 CA sing Y N 15 A1I9P N CA sing N N 16 A1I9P C10 C5 sing Y N 17 A1I9P O21 C20 sing N N 18 A1I9P O21 C22 sing N N 19 A1I9P CA C7 doub Y N 20 A1I9P C5 C6 doub Y N 21 A1I9P C7 C6 sing Y N 22 A1I9P N H sing N N 23 A1I9P N H2 sing N N 24 A1I9P C16 H4 sing N N 25 A1I9P C16 H5 sing N N 26 A1I9P C17 H6 sing N N 27 A1I9P C17 H7 sing N N 28 A1I9P C19 H8 sing N N 29 A1I9P C19 H9 sing N N 30 A1I9P C20 H10 sing N N 31 A1I9P C20 H11 sing N N 32 A1I9P C22 H12 sing N N 33 A1I9P C22 H13 sing N N 34 A1I9P C22 H14 sing N N 35 A1I9P C3 H15 sing N N 36 A1I9P C5 H16 sing N N 37 A1I9P C6 H17 sing N N 38 A1I9P C7 H18 sing N N 39 A1I9P C OXT sing N N 40 A1I9P OXT HXT sing N N 41 A1IKE C127 C129 doub Y N 42 A1IKE C127 C125 sing Y N 43 A1IKE C129 C131 sing Y N 44 A1IKE C125 CA doub Y N 45 A1IKE C131 C132 doub Y N 46 A1IKE CA C132 sing Y N 47 A1IKE CA N sing N N 48 A1IKE C132 O13 sing N N 49 A1IKE O13 C126 sing N N 50 A1IKE C128 C126 sing N N 51 A1IKE C126 C sing N N 52 A1IKE C O doub N N 53 A1IKE C OXT sing N N 54 A1IKE N H sing N N 55 A1IKE N H2 sing N N 56 A1IKE C125 H3 sing N N 57 A1IKE C126 H4 sing N N 58 A1IKE C127 H5 sing N N 59 A1IKE C128 H6 sing N N 60 A1IKE C128 H7 sing N N 61 A1IKE C128 H8 sing N N 62 A1IKE C129 H9 sing N N 63 A1IKE C131 H10 sing N N 64 A1IKE OXT HXT sing N N 65 ABA N CA sing N N 66 ABA N H sing N N 67 ABA N H2 sing N N 68 ABA CA C sing N N 69 ABA CA CB sing N N 70 ABA CA HA sing N N 71 ABA C O doub N N 72 ABA C OXT sing N N 73 ABA CB CG sing N N 74 ABA CB HB3 sing N N 75 ABA CB HB2 sing N N 76 ABA CG HG1 sing N N 77 ABA CG HG3 sing N N 78 ABA CG HG2 sing N N 79 ABA OXT HXT sing N N 80 ALA N CA sing N N 81 ALA N H sing N N 82 ALA N H2 sing N N 83 ALA CA C sing N N 84 ALA CA CB sing N N 85 ALA CA HA sing N N 86 ALA C O doub N N 87 ALA C OXT sing N N 88 ALA CB HB1 sing N N 89 ALA CB HB2 sing N N 90 ALA CB HB3 sing N N 91 ALA OXT HXT sing N N 92 ARG N CA sing N N 93 ARG N H sing N N 94 ARG N H2 sing N N 95 ARG CA C sing N N 96 ARG CA CB sing N N 97 ARG CA HA sing N N 98 ARG C O doub N N 99 ARG C OXT sing N N 100 ARG CB CG sing N N 101 ARG CB HB2 sing N N 102 ARG CB HB3 sing N N 103 ARG CG CD sing N N 104 ARG CG HG2 sing N N 105 ARG CG HG3 sing N N 106 ARG CD NE sing N N 107 ARG CD HD2 sing N N 108 ARG CD HD3 sing N N 109 ARG NE CZ sing N N 110 ARG NE HE sing N N 111 ARG CZ NH1 sing N N 112 ARG CZ NH2 doub N N 113 ARG NH1 HH11 sing N N 114 ARG NH1 HH12 sing N N 115 ARG NH2 HH21 sing N N 116 ARG NH2 HH22 sing N N 117 ARG OXT HXT sing N N 118 ASN N CA sing N N 119 ASN N H sing N N 120 ASN N H2 sing N N 121 ASN CA C sing N N 122 ASN CA CB sing N N 123 ASN CA HA sing N N 124 ASN C O doub N N 125 ASN C OXT sing N N 126 ASN CB CG sing N N 127 ASN CB HB2 sing N N 128 ASN CB HB3 sing N N 129 ASN CG OD1 doub N N 130 ASN CG ND2 sing N N 131 ASN ND2 HD21 sing N N 132 ASN ND2 HD22 sing N N 133 ASN OXT HXT sing N N 134 ASP N CA sing N N 135 ASP N H sing N N 136 ASP N H2 sing N N 137 ASP CA C sing N N 138 ASP CA CB sing N N 139 ASP CA HA sing N N 140 ASP C O doub N N 141 ASP C OXT sing N N 142 ASP CB CG sing N N 143 ASP CB HB2 sing N N 144 ASP CB HB3 sing N N 145 ASP CG OD1 doub N N 146 ASP CG OD2 sing N N 147 ASP OD2 HD2 sing N N 148 ASP OXT HXT sing N N 149 GLN N CA sing N N 150 GLN N H sing N N 151 GLN N H2 sing N N 152 GLN CA C sing N N 153 GLN CA CB sing N N 154 GLN CA HA sing N N 155 GLN C O doub N N 156 GLN C OXT sing N N 157 GLN CB CG sing N N 158 GLN CB HB2 sing N N 159 GLN CB HB3 sing N N 160 GLN CG CD sing N N 161 GLN CG HG2 sing N N 162 GLN CG HG3 sing N N 163 GLN CD OE1 doub N N 164 GLN CD NE2 sing N N 165 GLN NE2 HE21 sing N N 166 GLN NE2 HE22 sing N N 167 GLN OXT HXT sing N N 168 GLU N CA sing N N 169 GLU N H sing N N 170 GLU N H2 sing N N 171 GLU CA C sing N N 172 GLU CA CB sing N N 173 GLU CA HA sing N N 174 GLU C O doub N N 175 GLU C OXT sing N N 176 GLU CB CG sing N N 177 GLU CB HB2 sing N N 178 GLU CB HB3 sing N N 179 GLU CG CD sing N N 180 GLU CG HG2 sing N N 181 GLU CG HG3 sing N N 182 GLU CD OE1 doub N N 183 GLU CD OE2 sing N N 184 GLU OE2 HE2 sing N N 185 GLU OXT HXT sing N N 186 GLY N CA sing N N 187 GLY N H sing N N 188 GLY N H2 sing N N 189 GLY CA C sing N N 190 GLY CA HA2 sing N N 191 GLY CA HA3 sing N N 192 GLY C O doub N N 193 GLY C OXT sing N N 194 GLY OXT HXT sing N N 195 HIS N CA sing N N 196 HIS N H sing N N 197 HIS N H2 sing N N 198 HIS CA C sing N N 199 HIS CA CB sing N N 200 HIS CA HA sing N N 201 HIS C O doub N N 202 HIS C OXT sing N N 203 HIS CB CG sing N N 204 HIS CB HB2 sing N N 205 HIS CB HB3 sing N N 206 HIS CG ND1 sing Y N 207 HIS CG CD2 doub Y N 208 HIS ND1 CE1 doub Y N 209 HIS ND1 HD1 sing N N 210 HIS CD2 NE2 sing Y N 211 HIS CD2 HD2 sing N N 212 HIS CE1 NE2 sing Y N 213 HIS CE1 HE1 sing N N 214 HIS NE2 HE2 sing N N 215 HIS OXT HXT sing N N 216 ILE N CA sing N N 217 ILE N H sing N N 218 ILE N H2 sing N N 219 ILE CA C sing N N 220 ILE CA CB sing N N 221 ILE CA HA sing N N 222 ILE C O doub N N 223 ILE C OXT sing N N 224 ILE CB CG1 sing N N 225 ILE CB CG2 sing N N 226 ILE CB HB sing N N 227 ILE CG1 CD1 sing N N 228 ILE CG1 HG12 sing N N 229 ILE CG1 HG13 sing N N 230 ILE CG2 HG21 sing N N 231 ILE CG2 HG22 sing N N 232 ILE CG2 HG23 sing N N 233 ILE CD1 HD11 sing N N 234 ILE CD1 HD12 sing N N 235 ILE CD1 HD13 sing N N 236 ILE OXT HXT sing N N 237 LEU N CA sing N N 238 LEU N H sing N N 239 LEU N H2 sing N N 240 LEU CA C sing N N 241 LEU CA CB sing N N 242 LEU CA HA sing N N 243 LEU C O doub N N 244 LEU C OXT sing N N 245 LEU CB CG sing N N 246 LEU CB HB2 sing N N 247 LEU CB HB3 sing N N 248 LEU CG CD1 sing N N 249 LEU CG CD2 sing N N 250 LEU CG HG sing N N 251 LEU CD1 HD11 sing N N 252 LEU CD1 HD12 sing N N 253 LEU CD1 HD13 sing N N 254 LEU CD2 HD21 sing N N 255 LEU CD2 HD22 sing N N 256 LEU CD2 HD23 sing N N 257 LEU OXT HXT sing N N 258 LYS N CA sing N N 259 LYS N H sing N N 260 LYS N H2 sing N N 261 LYS CA C sing N N 262 LYS CA CB sing N N 263 LYS CA HA sing N N 264 LYS C O doub N N 265 LYS C OXT sing N N 266 LYS CB CG sing N N 267 LYS CB HB2 sing N N 268 LYS CB HB3 sing N N 269 LYS CG CD sing N N 270 LYS CG HG2 sing N N 271 LYS CG HG3 sing N N 272 LYS CD CE sing N N 273 LYS CD HD2 sing N N 274 LYS CD HD3 sing N N 275 LYS CE NZ sing N N 276 LYS CE HE2 sing N N 277 LYS CE HE3 sing N N 278 LYS NZ HZ1 sing N N 279 LYS NZ HZ2 sing N N 280 LYS NZ HZ3 sing N N 281 LYS OXT HXT sing N N 282 MET N CA sing N N 283 MET N H sing N N 284 MET N H2 sing N N 285 MET CA C sing N N 286 MET CA CB sing N N 287 MET CA HA sing N N 288 MET C O doub N N 289 MET C OXT sing N N 290 MET CB CG sing N N 291 MET CB HB2 sing N N 292 MET CB HB3 sing N N 293 MET CG SD sing N N 294 MET CG HG2 sing N N 295 MET CG HG3 sing N N 296 MET SD CE sing N N 297 MET CE HE1 sing N N 298 MET CE HE2 sing N N 299 MET CE HE3 sing N N 300 MET OXT HXT sing N N 301 PHE N CA sing N N 302 PHE N H sing N N 303 PHE N H2 sing N N 304 PHE CA C sing N N 305 PHE CA CB sing N N 306 PHE CA HA sing N N 307 PHE C O doub N N 308 PHE C OXT sing N N 309 PHE CB CG sing N N 310 PHE CB HB2 sing N N 311 PHE CB HB3 sing N N 312 PHE CG CD1 doub Y N 313 PHE CG CD2 sing Y N 314 PHE CD1 CE1 sing Y N 315 PHE CD1 HD1 sing N N 316 PHE CD2 CE2 doub Y N 317 PHE CD2 HD2 sing N N 318 PHE CE1 CZ doub Y N 319 PHE CE1 HE1 sing N N 320 PHE CE2 CZ sing Y N 321 PHE CE2 HE2 sing N N 322 PHE CZ HZ sing N N 323 PHE OXT HXT sing N N 324 PRO N CA sing N N 325 PRO N CD sing N N 326 PRO N H sing N N 327 PRO CA C sing N N 328 PRO CA CB sing N N 329 PRO CA HA sing N N 330 PRO C O doub N N 331 PRO C OXT sing N N 332 PRO CB CG sing N N 333 PRO CB HB2 sing N N 334 PRO CB HB3 sing N N 335 PRO CG CD sing N N 336 PRO CG HG2 sing N N 337 PRO CG HG3 sing N N 338 PRO CD HD2 sing N N 339 PRO CD HD3 sing N N 340 PRO OXT HXT sing N N 341 QOL C3 C4 doub Y N 342 QOL C3 CA sing Y N 343 QOL C4 C5 sing Y N 344 QOL CA N sing N N 345 QOL CA C7 doub Y N 346 QOL C5 C6 doub Y N 347 QOL OZ2 CE2 sing N N 348 QOL C7 C6 sing Y N 349 QOL C7 N11 sing Y N 350 QOL C6 C8 sing Y N 351 QOL N11 C10 doub Y N 352 QOL C8 OB sing N N 353 QOL C8 C9 doub Y N 354 QOL OB CG sing N N 355 QOL C10 C9 sing Y N 356 QOL C10 C sing N N 357 QOL CE2 CD sing N N 358 QOL CD CG sing N N 359 QOL CD CE1 sing N N 360 QOL C O doub N N 361 QOL CE1 OZ1 sing N N 362 QOL OZ1 H1 sing N N 363 QOL CE1 H20 sing N N 364 QOL CE1 H3 sing N N 365 QOL CD H4 sing N N 366 QOL CE2 H5 sing N N 367 QOL CE2 H6 sing N N 368 QOL OZ2 H7 sing N N 369 QOL CG H8 sing N N 370 QOL CG H9 sing N N 371 QOL C9 H10 sing N N 372 QOL C5 H12 sing N N 373 QOL C4 H13 sing N N 374 QOL C3 H14 sing N N 375 QOL N H sing N N 376 QOL N H2 sing N N 377 QOL C OXT sing N N 378 QOL OXT HXT sing N N 379 QUK O C doub N N 380 QUK C C10 sing N N 381 QUK C10 C9 doub Y N 382 QUK C10 N11 sing Y N 383 QUK C9 C8 sing Y N 384 QUK N11 C7 doub Y N 385 QUK C8 OB sing N N 386 QUK C8 C6 doub Y N 387 QUK CE CD sing N N 388 QUK C7 C6 sing Y N 389 QUK C7 CA sing Y N 390 QUK CG OB sing N N 391 QUK CG CD sing N N 392 QUK N CA sing N N 393 QUK C6 C5 sing Y N 394 QUK CA C3 doub Y N 395 QUK C5 C4 doub Y N 396 QUK C3 C4 sing Y N 397 QUK C OXT sing N N 398 QUK N H sing N N 399 QUK N H2 sing N N 400 QUK C9 H3 sing N N 401 QUK C5 H4 sing N N 402 QUK C4 H5 sing N N 403 QUK C3 H6 sing N N 404 QUK CG H7 sing N N 405 QUK CG H8 sing N N 406 QUK CD H9 sing N N 407 QUK CD H10 sing N N 408 QUK CE H11 sing N N 409 QUK CE H12 sing N N 410 QUK OXT HXT sing N N 411 QUK CE N1 sing N N 412 QUK N1 H13 sing N N 413 QUK N1 H15 sing N N 414 QVE N C2 sing N N 415 QVE O C doub N N 416 QVE C2 C3 doub Y N 417 QVE C2 C7 sing Y N 418 QVE N11 C7 doub Y N 419 QVE N11 CA sing Y N 420 QVE C CA sing N N 421 QVE C3 C4 sing Y N 422 QVE C7 C6 sing Y N 423 QVE CA C9 doub Y N 424 QVE C4 C5 doub Y N 425 QVE C6 C5 sing Y N 426 QVE C6 C8 doub Y N 427 QVE C9 C8 sing Y N 428 QVE C8 OB sing N N 429 QVE CG OB sing N N 430 QVE CG CD sing N N 431 QVE OE2 CD doub N N 432 QVE CD OE1 sing N N 433 QVE N H2 sing N N 434 QVE N H sing N N 435 QVE C9 H4 sing N N 436 QVE CG H5 sing N N 437 QVE CG H6 sing N N 438 QVE OE1 H7 sing N N 439 QVE C5 H8 sing N N 440 QVE C4 H9 sing N N 441 QVE C3 H10 sing N N 442 QVE C OXT sing N N 443 QVE OXT HXT sing N N 444 QVS OB C8 sing N N 445 QVS C8 C9 doub Y N 446 QVS C8 C6 sing Y N 447 QVS C5 C6 doub Y N 448 QVS C5 C4 sing Y N 449 QVS C9 CA sing Y N 450 QVS C6 C7 sing Y N 451 QVS C4 C3 doub Y N 452 QVS CA N11 doub Y N 453 QVS CA C sing N N 454 QVS C7 N11 sing Y N 455 QVS C7 C2 doub Y N 456 QVS C3 C2 sing Y N 457 QVS O C doub N N 458 QVS C2 N sing N N 459 QVS OB H1 sing N N 460 QVS C9 H3 sing N N 461 QVS C5 H4 sing N N 462 QVS C4 H5 sing N N 463 QVS C3 H6 sing N N 464 QVS N H sing N N 465 QVS N H2 sing N N 466 QVS C OXT sing N N 467 QVS OXT HXT sing N N 468 SER N CA sing N N 469 SER N H sing N N 470 SER N H2 sing N N 471 SER CA C sing N N 472 SER CA CB sing N N 473 SER CA HA sing N N 474 SER C O doub N N 475 SER C OXT sing N N 476 SER CB OG sing N N 477 SER CB HB2 sing N N 478 SER CB HB3 sing N N 479 SER OG HG sing N N 480 SER OXT HXT sing N N 481 THR N CA sing N N 482 THR N H sing N N 483 THR N H2 sing N N 484 THR CA C sing N N 485 THR CA CB sing N N 486 THR CA HA sing N N 487 THR C O doub N N 488 THR C OXT sing N N 489 THR CB OG1 sing N N 490 THR CB CG2 sing N N 491 THR CB HB sing N N 492 THR OG1 HG1 sing N N 493 THR CG2 HG21 sing N N 494 THR CG2 HG22 sing N N 495 THR CG2 HG23 sing N N 496 THR OXT HXT sing N N 497 TYR N CA sing N N 498 TYR N H sing N N 499 TYR N H2 sing N N 500 TYR CA C sing N N 501 TYR CA CB sing N N 502 TYR CA HA sing N N 503 TYR C O doub N N 504 TYR C OXT sing N N 505 TYR CB CG sing N N 506 TYR CB HB2 sing N N 507 TYR CB HB3 sing N N 508 TYR CG CD1 doub Y N 509 TYR CG CD2 sing Y N 510 TYR CD1 CE1 sing Y N 511 TYR CD1 HD1 sing N N 512 TYR CD2 CE2 doub Y N 513 TYR CD2 HD2 sing N N 514 TYR CE1 CZ doub Y N 515 TYR CE1 HE1 sing N N 516 TYR CE2 CZ sing Y N 517 TYR CE2 HE2 sing N N 518 TYR CZ OH sing N N 519 TYR OH HH sing N N 520 TYR OXT HXT sing N N 521 VAL N CA sing N N 522 VAL N H sing N N 523 VAL N H2 sing N N 524 VAL CA C sing N N 525 VAL CA CB sing N N 526 VAL CA HA sing N N 527 VAL C O doub N N 528 VAL C OXT sing N N 529 VAL CB CG1 sing N N 530 VAL CB CG2 sing N N 531 VAL CB HB sing N N 532 VAL CG1 HG11 sing N N 533 VAL CG1 HG12 sing N N 534 VAL CG1 HG13 sing N N 535 VAL CG2 HG21 sing N N 536 VAL CG2 HG22 sing N N 537 VAL CG2 HG23 sing N N 538 VAL OXT HXT sing N N 539 ZY9 N C2 sing N N 540 ZY9 C2 C7 sing N N 541 ZY9 C6 C7 doub Y N 542 ZY9 C6 C8 sing Y N 543 ZY9 C7 N11 sing Y N 544 ZY9 C8 C9 doub Y N 545 ZY9 N11 CA doub Y N 546 ZY9 C9 CA sing Y N 547 ZY9 CA C sing N N 548 ZY9 C O doub N N 549 ZY9 C OXT sing N N 550 ZY9 C9 H1 sing N N 551 ZY9 C8 H6 sing N N 552 ZY9 C6 H3 sing N N 553 ZY9 C2 H4 sing N N 554 ZY9 C2 H5 sing N N 555 ZY9 N H sing N N 556 ZY9 N H2 sing N N 557 ZY9 OXT HXT sing N N 558 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9QDO _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 41 2 2' _space_group.name_Hall 'I 4bw 2bw' _space_group.IT_number 98 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9QNU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017570 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017570 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002533 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #