data_9QQU # _entry.id 9QQU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.412 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QQU pdb_00009qqu 10.2210/pdb9qqu/pdb WWPDB D_1292146736 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9QQU _pdbx_database_status.recvd_initial_deposition_date 2025-04-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 ma.williams@bbk.ac.uk Mark Williams A 'principal investigator/group leader' 0000-0002-1645-2189 3 ma.williams@bbk.ac.uk Mark Williams ? 'principal investigator/group leader' 0000-0002-1645-2189 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pinotis, N.' 1 0000-0002-5096-257X 'Bell, R.' 2 0000-0002-1744-7066 'Williams, M.A.' 3 0000-0002-1645-2189 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Engineering a robust protein-protein interaction motif' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bell, R.' 1 0000-0002-1744-7066 primary 'Pinotsis, N.' 2 0000-0002-5096-257X primary 'Driva, D.' 3 ? primary 'Daviter, T.' 4 0000-0003-2636-5959 primary 'Garza-Garcia, A.' 5 0000-0003-0307-0138 primary 'Williams, M.A.' 6 0000-0002-1645-2189 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stress-induced-phosphoprotein 1' 17880.055 1 ? ? ? ? 2 polymer man 'Heat shock protein HSP 90-alpha' 647.695 1 3.6.4.10 ? ? 'Acetylated methionine' 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'STI1,Hsc70/Hsp90-organizing protein,Hop,Renal carcinoma antigen NY-REN-11,Transformation-sensitive protein IEF SSP 3521' 2 ;Heat shock 86 kDa,HSP 86,HSP86,Heat shock protein family C member 1,Lipopolysaccharide-associated protein 2,LAP-2,LPS-associated protein 2,Renal carcinoma antigen NY-REN-38 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MHHHHHHSSGTENLYFQSLPENKKQAEREKELGNDAYKKKDFDTALEHYDKAIELDPTNMTYITNQAAVYFEMGDYDKCR ELCEKAIEVGRENRADYKQIAKAYARIANSYFKEGKYKDAIKYYNKSLTEHRTPDVLKKCKEAEKILKEQE ; ;MHHHHHHSSGTENLYFQSLPENKKQAEREKELGNDAYKKKDFDTALEHYDKAIELDPTNMTYITNQAAVYFEMGDYDKCR ELCEKAIEVGRENRADYKQIAKAYARIANSYFKEGKYKDAIKYYNKSLTEHRTPDVLKKCKEAEKILKEQE ; A ? 2 'polypeptide(L)' no yes '(ACE)MEEVD' XMEEVD B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 THR n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 SER n 1 19 LEU n 1 20 PRO n 1 21 GLU n 1 22 ASN n 1 23 LYS n 1 24 LYS n 1 25 GLN n 1 26 ALA n 1 27 GLU n 1 28 ARG n 1 29 GLU n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 ASN n 1 35 ASP n 1 36 ALA n 1 37 TYR n 1 38 LYS n 1 39 LYS n 1 40 LYS n 1 41 ASP n 1 42 PHE n 1 43 ASP n 1 44 THR n 1 45 ALA n 1 46 LEU n 1 47 GLU n 1 48 HIS n 1 49 TYR n 1 50 ASP n 1 51 LYS n 1 52 ALA n 1 53 ILE n 1 54 GLU n 1 55 LEU n 1 56 ASP n 1 57 PRO n 1 58 THR n 1 59 ASN n 1 60 MET n 1 61 THR n 1 62 TYR n 1 63 ILE n 1 64 THR n 1 65 ASN n 1 66 GLN n 1 67 ALA n 1 68 ALA n 1 69 VAL n 1 70 TYR n 1 71 PHE n 1 72 GLU n 1 73 MET n 1 74 GLY n 1 75 ASP n 1 76 TYR n 1 77 ASP n 1 78 LYS n 1 79 CYS n 1 80 ARG n 1 81 GLU n 1 82 LEU n 1 83 CYS n 1 84 GLU n 1 85 LYS n 1 86 ALA n 1 87 ILE n 1 88 GLU n 1 89 VAL n 1 90 GLY n 1 91 ARG n 1 92 GLU n 1 93 ASN n 1 94 ARG n 1 95 ALA n 1 96 ASP n 1 97 TYR n 1 98 LYS n 1 99 GLN n 1 100 ILE n 1 101 ALA n 1 102 LYS n 1 103 ALA n 1 104 TYR n 1 105 ALA n 1 106 ARG n 1 107 ILE n 1 108 ALA n 1 109 ASN n 1 110 SER n 1 111 TYR n 1 112 PHE n 1 113 LYS n 1 114 GLU n 1 115 GLY n 1 116 LYS n 1 117 TYR n 1 118 LYS n 1 119 ASP n 1 120 ALA n 1 121 ILE n 1 122 LYS n 1 123 TYR n 1 124 TYR n 1 125 ASN n 1 126 LYS n 1 127 SER n 1 128 LEU n 1 129 THR n 1 130 GLU n 1 131 HIS n 1 132 ARG n 1 133 THR n 1 134 PRO n 1 135 ASP n 1 136 VAL n 1 137 LEU n 1 138 LYS n 1 139 LYS n 1 140 CYS n 1 141 LYS n 1 142 GLU n 1 143 ALA n 1 144 GLU n 1 145 LYS n 1 146 ILE n 1 147 LEU n 1 148 LYS n 1 149 GLU n 1 150 GLN n 1 151 GLU n 2 1 ACE n 2 2 MET n 2 3 GLU n 2 4 GLU n 2 5 VAL n 2 6 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 151 human ? STIP1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 6 human ? 'HSP90AA1, HSP90A, HSPC1, HSPCA' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 THR 11 11 ? ? ? A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 CYS 140 140 140 CYS CYS A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 GLU 151 151 ? ? ? A . n B 2 1 ACE 1 1 201 ACE AME B . n B 2 2 MET 2 2 201 MET AME B . n B 2 3 GLU 3 3 202 GLU GLU B . n B 2 4 GLU 4 4 203 GLU GLU B . n B 2 5 VAL 5 5 204 VAL VAL B . n B 2 6 ASP 6 6 205 ASP ASP B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 201 1 SO4 SO4 A . D 3 SO4 1 101 2 SO4 SO4 B . E 4 HOH 1 301 3 HOH HOH A . E 4 HOH 2 302 25 HOH HOH A . E 4 HOH 3 303 8 HOH HOH A . E 4 HOH 4 304 27 HOH HOH A . E 4 HOH 5 305 34 HOH HOH A . E 4 HOH 6 306 15 HOH HOH A . E 4 HOH 7 307 33 HOH HOH A . E 4 HOH 8 308 5 HOH HOH A . E 4 HOH 9 309 2 HOH HOH A . E 4 HOH 10 310 1 HOH HOH A . E 4 HOH 11 311 24 HOH HOH A . E 4 HOH 12 312 18 HOH HOH A . E 4 HOH 13 313 26 HOH HOH A . E 4 HOH 14 314 11 HOH HOH A . E 4 HOH 15 315 17 HOH HOH A . E 4 HOH 16 316 12 HOH HOH A . E 4 HOH 17 317 20 HOH HOH A . E 4 HOH 18 318 9 HOH HOH A . E 4 HOH 19 319 16 HOH HOH A . E 4 HOH 20 320 13 HOH HOH A . E 4 HOH 21 321 32 HOH HOH A . E 4 HOH 22 322 19 HOH HOH A . E 4 HOH 23 323 10 HOH HOH A . E 4 HOH 24 324 39 HOH HOH A . E 4 HOH 25 325 35 HOH HOH A . E 4 HOH 26 326 22 HOH HOH A . E 4 HOH 27 327 21 HOH HOH A . E 4 HOH 28 328 6 HOH HOH A . E 4 HOH 29 329 14 HOH HOH A . E 4 HOH 30 330 40 HOH HOH A . E 4 HOH 31 331 28 HOH HOH A . E 4 HOH 32 332 23 HOH HOH A . E 4 HOH 33 333 38 HOH HOH A . E 4 HOH 34 334 41 HOH HOH A . E 4 HOH 35 335 37 HOH HOH A . E 4 HOH 36 336 42 HOH HOH A . E 4 HOH 37 337 36 HOH HOH A . F 4 HOH 1 201 4 HOH HOH B . F 4 HOH 2 202 7 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20230630 ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9QQU _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.692 _cell.length_a_esd ? _cell.length_b 67.692 _cell.length_b_esd ? _cell.length_c 56.212 _cell.length_c_esd ? _cell.volume 223066.504 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9QQU _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QQU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 29 _exptl_crystal.description cubic _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1M Sodium Acetate, pH 5.0 2.0 M Ammonium sulphate ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-02-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.873128 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.873128 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 37.76 _reflns.entry_id 9QQU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.13 _reflns.d_resolution_low 57 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8617 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.294 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.13 _reflns_shell.d_res_low 2.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 695 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.501 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.1 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 45.83 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9QQU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.13 _refine.ls_d_res_low 40.57 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8592 _refine.ls_number_reflns_R_free 431 _refine.ls_number_reflns_R_work 8161 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.72 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2004 _refine.ls_R_factor_R_free 0.2561 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1976 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.3079 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2924 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.13 _refine_hist.d_res_low 40.57 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1249 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1200 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0024 ? 1226 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.4653 ? 1639 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0350 ? 166 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0033 ? 213 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 9.5407 ? 168 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.13 2.44 . . 171 2644 99.68 . . . . 0.2657 . . . . . . . . . . . . . . . 0.3311 'X-RAY DIFFRACTION' 2.44 3.07 . . 122 2716 99.93 . . . . 0.2257 . . . . . . . . . . . . . . . 0.2822 'X-RAY DIFFRACTION' 3.08 40.57 . . 138 2801 99.56 . . . . 0.1727 . . . . . . . . . . . . . . . 0.2275 # _struct.entry_id 9QQU _struct.title 'Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QQU _struct_keywords.text 'Engineered protein, Complex, Tetratricopeptide repeat domain, Hsp90 protein binding, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP STIP1_HUMAN P31948 ? 1 ;LPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYR QIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE ; 218 2 UNP HS90A_HUMAN P07900 ? 2 MEEVD 728 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9QQU A 19 ? 151 ? P31948 218 ? 350 ? 19 151 2 2 9QQU B 2 ? 6 ? P07900 728 ? 732 ? 2 6 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9QQU MET A 1 ? UNP P31948 ? ? 'initiating methionine' 1 1 1 9QQU HIS A 2 ? UNP P31948 ? ? 'expression tag' 2 2 1 9QQU HIS A 3 ? UNP P31948 ? ? 'expression tag' 3 3 1 9QQU HIS A 4 ? UNP P31948 ? ? 'expression tag' 4 4 1 9QQU HIS A 5 ? UNP P31948 ? ? 'expression tag' 5 5 1 9QQU HIS A 6 ? UNP P31948 ? ? 'expression tag' 6 6 1 9QQU HIS A 7 ? UNP P31948 ? ? 'expression tag' 7 7 1 9QQU SER A 8 ? UNP P31948 ? ? 'expression tag' 8 8 1 9QQU SER A 9 ? UNP P31948 ? ? 'expression tag' 9 9 1 9QQU GLY A 10 ? UNP P31948 ? ? 'expression tag' 10 10 1 9QQU THR A 11 ? UNP P31948 ? ? 'expression tag' 11 11 1 9QQU GLU A 12 ? UNP P31948 ? ? 'expression tag' 12 12 1 9QQU ASN A 13 ? UNP P31948 ? ? 'expression tag' 13 13 1 9QQU LEU A 14 ? UNP P31948 ? ? 'expression tag' 14 14 1 9QQU TYR A 15 ? UNP P31948 ? ? 'expression tag' 15 15 1 9QQU PHE A 16 ? UNP P31948 ? ? 'expression tag' 16 16 1 9QQU GLN A 17 ? UNP P31948 ? ? 'expression tag' 17 17 1 9QQU SER A 18 ? UNP P31948 ? ? 'expression tag' 18 18 1 9QQU GLU A 27 ? UNP P31948 LEU 226 'engineered mutation' 27 19 1 9QQU ARG A 28 ? UNP P31948 LYS 227 'engineered mutation' 28 20 1 9QQU GLU A 47 ? UNP P31948 LYS 246 'engineered mutation' 47 21 1 9QQU ILE A 53 ? UNP P31948 LYS 252 'engineered mutation' 53 22 1 9QQU MET A 73 ? UNP P31948 LYS 272 'engineered mutation' 73 23 1 9QQU ASP A 77 ? UNP P31948 ASN 276 'engineered mutation' 77 24 1 9QQU ALA A 95 ? UNP P31948 GLU 294 'engineered mutation' 95 25 1 9QQU LYS A 98 ? UNP P31948 ARG 297 'engineered mutation' 98 26 1 9QQU ALA A 108 ? UNP P31948 GLY 307 'engineered mutation' 108 27 1 9QQU GLY A 115 ? UNP P31948 GLU 314 'engineered mutation' 115 28 1 9QQU LYS A 122 ? UNP P31948 HIS 321 'engineered mutation' 122 29 1 9QQU TYR A 123 ? UNP P31948 PHE 322 'engineered mutation' 123 30 1 9QQU THR A 129 ? UNP P31948 ALA 328 'engineered mutation' 129 31 1 9QQU LYS A 141 ? UNP P31948 GLN 340 'engineered mutation' 141 32 1 9QQU GLU A 142 ? UNP P31948 GLN 341 'engineered mutation' 142 33 2 9QQU ACE B 1 ? UNP P07900 ? ? acetylation 1 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1330 ? 1 MORE -20 ? 1 'SSA (A^2)' 8570 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 12 ? LEU A 19 ? GLU A 12 LEU A 19 1 ? 8 HELX_P HELX_P2 AA2 PRO A 20 ? LYS A 39 ? PRO A 20 LYS A 39 1 ? 20 HELX_P HELX_P3 AA3 ASP A 41 ? ASP A 56 ? ASP A 41 ASP A 56 1 ? 16 HELX_P HELX_P4 AA4 ASN A 59 ? GLY A 74 ? ASN A 59 GLY A 74 1 ? 16 HELX_P HELX_P5 AA5 ASP A 75 ? ASN A 93 ? ASP A 75 ASN A 93 1 ? 19 HELX_P HELX_P6 AA6 ASP A 96 ? GLU A 114 ? ASP A 96 GLU A 114 1 ? 19 HELX_P HELX_P7 AA7 LYS A 116 ? HIS A 131 ? LYS A 116 HIS A 131 1 ? 16 HELX_P HELX_P8 AA8 THR A 133 ? LYS A 148 ? THR A 133 LYS A 148 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id ACE _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id MET _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id ACE _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id MET _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.451 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ACE _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id MET _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 2 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id ACE _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id MET _pdbx_modification_feature.modified_residue_auth_asym_id B _pdbx_modification_feature.modified_residue_auth_seq_id 2 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id MET _pdbx_modification_feature.ref_pcm_id 4 _pdbx_modification_feature.ref_comp_id ACE _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal acetylation' # _pdbx_entry_details.entry_id 9QQU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 O _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 2 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 C _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 MET _pdbx_validate_rmsd_angle.auth_seq_id_2 2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 110.80 _pdbx_validate_rmsd_angle.angle_target_value 122.70 _pdbx_validate_rmsd_angle.angle_deviation -11.90 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B SO4 101 ? D SO4 . 2 1 B SO4 101 ? D SO4 . 3 1 A HOH 335 ? E HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -25.160 -5.698 -4.985 0.322296224733 0.274125403787 0.27043743271 0.000380924607632 -0.013913363768 0.0217335962361 2.21176172305 1.3846599538 1.4433294034 0.560287361046 -0.398659947665 0.160640199572 0.00350561278345 -0.0456526236731 0.0252269824492 -0.00142071451318 0.172610671486 -0.05569224378 -0.00443058781198 -0.173678234407 0.122679530386 'X-RAY DIFFRACTION' 2 ? refined -25.396 -2.306 2.104 0.551055532841 0.398842956139 0.393457802058 -0.0424416167392 0.116616151107 -0.0361371688944 4.41756821295 0.708671144513 1.50300869903 1.35624378373 1.67135231306 1.02809218342 -0.10964767573 -0.21085196918 0.179469824845 0.0388618204003 0.364640964547 0.07487632799 -0.771582246999 -0.564021933966 -0.169378659721 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 12 A 150 '( CHAIN A AND RESID 12:150 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 B 1 B 6 '( CHAIN B AND RESID 1:6 )' ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A THR 11 ? A THR 11 12 1 Y 1 A GLU 151 ? A GLU 151 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 SO4 S S N N 311 SO4 O1 O N N 312 SO4 O2 O N N 313 SO4 O3 O N N 314 SO4 O4 O N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TYR N N N N 333 TYR CA C N S 334 TYR C C N N 335 TYR O O N N 336 TYR CB C N N 337 TYR CG C Y N 338 TYR CD1 C Y N 339 TYR CD2 C Y N 340 TYR CE1 C Y N 341 TYR CE2 C Y N 342 TYR CZ C Y N 343 TYR OH O N N 344 TYR OXT O N N 345 TYR H H N N 346 TYR H2 H N N 347 TYR HA H N N 348 TYR HB2 H N N 349 TYR HB3 H N N 350 TYR HD1 H N N 351 TYR HD2 H N N 352 TYR HE1 H N N 353 TYR HE2 H N N 354 TYR HH H N N 355 TYR HXT H N N 356 VAL N N N N 357 VAL CA C N S 358 VAL C C N N 359 VAL O O N N 360 VAL CB C N N 361 VAL CG1 C N N 362 VAL CG2 C N N 363 VAL OXT O N N 364 VAL H H N N 365 VAL H2 H N N 366 VAL HA H N N 367 VAL HB H N N 368 VAL HG11 H N N 369 VAL HG12 H N N 370 VAL HG13 H N N 371 VAL HG21 H N N 372 VAL HG22 H N N 373 VAL HG23 H N N 374 VAL HXT H N N 375 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 SER N CA sing N N 283 SER N H sing N N 284 SER N H2 sing N N 285 SER CA C sing N N 286 SER CA CB sing N N 287 SER CA HA sing N N 288 SER C O doub N N 289 SER C OXT sing N N 290 SER CB OG sing N N 291 SER CB HB2 sing N N 292 SER CB HB3 sing N N 293 SER OG HG sing N N 294 SER OXT HXT sing N N 295 SO4 S O1 doub N N 296 SO4 S O2 doub N N 297 SO4 S O3 sing N N 298 SO4 S O4 sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 VAL N CA sing N N 340 VAL N H sing N N 341 VAL N H2 sing N N 342 VAL CA C sing N N 343 VAL CA CB sing N N 344 VAL CA HA sing N N 345 VAL C O doub N N 346 VAL C OXT sing N N 347 VAL CB CG1 sing N N 348 VAL CB CG2 sing N N 349 VAL CB HB sing N N 350 VAL CG1 HG11 sing N N 351 VAL CG1 HG12 sing N N 352 VAL CG1 HG13 sing N N 353 VAL CG2 HG21 sing N N 354 VAL CG2 HG22 sing N N 355 VAL CG2 HG23 sing N N 356 VAL OXT HXT sing N N 357 # _pdbx_audit_support.funding_organization 'European Union (EU)' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number 101004806 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ELR _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9QQU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014773 _atom_sites.fract_transf_matrix[1][2] 0.008529 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017058 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017790 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #