data_9QVE # _entry.id 9QVE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QVE pdb_00009qve 10.2210/pdb9qve/pdb WWPDB D_1292147078 ? ? EMDB EMD-53395 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-07 ? 2 'EM metadata' 1 0 2025-05-07 ? 3 'Additional map' 1 0 2025-05-07 1 4 FSC 1 0 2025-05-07 ? 5 'Half map' 1 0 2025-05-07 1 6 'Half map' 1 0 2025-05-07 2 7 Image 1 0 2025-05-07 ? 8 Mask 1 0 2025-05-07 1 9 'Primary map' 1 0 2025-05-07 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'EM metadata' repository 'Initial release' ? ? 3 3 'Additional map' repository 'Initial release' ? ? 4 4 FSC repository 'Initial release' ? ? 5 5 'Half map' repository 'Initial release' ? ? 6 6 'Half map' repository 'Initial release' ? ? 7 7 Image repository 'Initial release' ? ? 8 8 Mask repository 'Initial release' ? ? 9 9 'Primary map' repository 'Initial release' ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9QVE _pdbx_database_status.recvd_initial_deposition_date 2025-04-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Satellite Tobacco Necrosis Virus-1' _pdbx_database_related.db_id EMD-53395 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_contact_author.id 2 _pdbx_contact_author.email george.lomonossoff@jic.ac.uk _pdbx_contact_author.name_first George _pdbx_contact_author.name_last Lomonossoff _pdbx_contact_author.name_mi M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0700-906X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Saunders, K.' 1 0000-0002-5606-9627 'Shah, S.' 2 0000-0003-3574-1979 'Peyret, H.' 3 0000-0002-7808-5089 'Meshcheriakova, Y.' 4 0009-0008-8791-1398 'Richardson, J.' 5 0009-0005-4603-4382 'Eltschkner, S.' 6 0000-0002-9854-0800 'Lawson, D.M.' 7 0000-0002-7637-4303 'Lomonossoff, G.' 8 0000-0003-0700-906X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The specificity of RNA packaging in isometric RNA plant viruses is principally determined by replication' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saunders, K.' 1 0000-0002-5606-9627 primary 'Shah, S.' 2 0000-0003-3574-1979 primary 'Peyret, H.' 3 0000-0002-7808-5089 primary 'Meshcheriakova, Y.' 4 0009-0008-8791-1398 primary 'Richardson, J.' 5 0009-0005-4603-4382 primary 'Eltschkner, S.' 6 0000-0002-9854-0800 primary 'Lawson, D.M.' 7 0000-0002-7637-4303 primary 'Lomonossoff, G.' 8 0000-0003-0700-906X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Capsid protein' 21739.645 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Coat protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAKQQNNRRKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAI TVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGA TAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA ; _entity_poly.pdbx_seq_one_letter_code_can ;MAKQQNNRRKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAI TVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGA TAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'MAGNESIUM ION' _pdbx_entity_nonpoly.comp_id MG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LYS n 1 4 GLN n 1 5 GLN n 1 6 ASN n 1 7 ASN n 1 8 ARG n 1 9 ARG n 1 10 LYS n 1 11 SER n 1 12 ALA n 1 13 THR n 1 14 MET n 1 15 ARG n 1 16 ALA n 1 17 VAL n 1 18 LYS n 1 19 ARG n 1 20 MET n 1 21 ILE n 1 22 ASN n 1 23 THR n 1 24 HIS n 1 25 LEU n 1 26 GLU n 1 27 HIS n 1 28 LYS n 1 29 ARG n 1 30 PHE n 1 31 ALA n 1 32 LEU n 1 33 ILE n 1 34 ASN n 1 35 SER n 1 36 GLY n 1 37 ASN n 1 38 THR n 1 39 ASN n 1 40 ALA n 1 41 THR n 1 42 ALA n 1 43 GLY n 1 44 THR n 1 45 VAL n 1 46 GLN n 1 47 ASN n 1 48 LEU n 1 49 SER n 1 50 ASN n 1 51 GLY n 1 52 ILE n 1 53 ILE n 1 54 GLN n 1 55 GLY n 1 56 ASP n 1 57 ASP n 1 58 ILE n 1 59 ASN n 1 60 GLN n 1 61 ARG n 1 62 SER n 1 63 GLY n 1 64 ASP n 1 65 GLN n 1 66 VAL n 1 67 ARG n 1 68 ILE n 1 69 VAL n 1 70 SER n 1 71 HIS n 1 72 LYS n 1 73 LEU n 1 74 HIS n 1 75 VAL n 1 76 ARG n 1 77 GLY n 1 78 THR n 1 79 ALA n 1 80 ILE n 1 81 THR n 1 82 VAL n 1 83 SER n 1 84 GLN n 1 85 THR n 1 86 PHE n 1 87 ARG n 1 88 PHE n 1 89 ILE n 1 90 TRP n 1 91 PHE n 1 92 ARG n 1 93 ASP n 1 94 ASN n 1 95 MET n 1 96 ASN n 1 97 ARG n 1 98 GLY n 1 99 THR n 1 100 THR n 1 101 PRO n 1 102 THR n 1 103 VAL n 1 104 LEU n 1 105 GLU n 1 106 VAL n 1 107 LEU n 1 108 ASN n 1 109 THR n 1 110 ALA n 1 111 ASN n 1 112 PHE n 1 113 MET n 1 114 SER n 1 115 GLN n 1 116 TYR n 1 117 ASN n 1 118 PRO n 1 119 ILE n 1 120 THR n 1 121 LEU n 1 122 GLN n 1 123 GLN n 1 124 LYS n 1 125 ARG n 1 126 PHE n 1 127 THR n 1 128 ILE n 1 129 LEU n 1 130 LYS n 1 131 ASP n 1 132 VAL n 1 133 THR n 1 134 LEU n 1 135 ASN n 1 136 CYS n 1 137 SER n 1 138 LEU n 1 139 THR n 1 140 GLY n 1 141 GLU n 1 142 SER n 1 143 ILE n 1 144 LYS n 1 145 ASP n 1 146 ARG n 1 147 ILE n 1 148 ILE n 1 149 ASN n 1 150 LEU n 1 151 PRO n 1 152 GLY n 1 153 GLN n 1 154 LEU n 1 155 VAL n 1 156 ASN n 1 157 TYR n 1 158 ASN n 1 159 GLY n 1 160 ALA n 1 161 THR n 1 162 ALA n 1 163 VAL n 1 164 ALA n 1 165 ALA n 1 166 SER n 1 167 ASN n 1 168 GLY n 1 169 PRO n 1 170 GLY n 1 171 ALA n 1 172 ILE n 1 173 PHE n 1 174 MET n 1 175 LEU n 1 176 GLN n 1 177 ILE n 1 178 GLY n 1 179 ASP n 1 180 SER n 1 181 LEU n 1 182 VAL n 1 183 GLY n 1 184 LEU n 1 185 TRP n 1 186 ASP n 1 187 SER n 1 188 SER n 1 189 TYR n 1 190 GLU n 1 191 ALA n 1 192 VAL n 1 193 TYR n 1 194 THR n 1 195 ASP n 1 196 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 196 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Satellite tobacco necrosis virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12445 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Nicotiana benthamiana' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4100 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'pEff PVX-based vector' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 ALA 12 12 ? ? ? A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 MET 174 174 174 MET MET A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 TRP 185 185 185 TRP TRP A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 ALA 196 196 196 ALA ALA A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 301 MG MG A . C 2 MG 1 302 302 MG MG A . D 2 MG 1 303 303 MG MG A . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9QVE _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9QVE _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QVE _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 9QVE _struct.title 'Satellite Tobacco Necrosis Virus-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QVE _struct_keywords.text 'ssRNA plant virus, icosahedral, RNA packaging, VIRUS LIKE PARTICLE' _struct_keywords.pdbx_keywords 'VIRUS LIKE PARTICLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAPSD_STNV1 _struct_ref.pdbx_db_accession P03606 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAKQQNNRRKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAI TVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGA TAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9QVE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 196 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03606 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 196 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details 'UCSF CHIMERA 1.17.3_b42480.' _pdbx_struct_assembly.oligomeric_details 60-meric _pdbx_struct_assembly.oligomeric_count 60 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression ;1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55,56,57,58,59,60 ; _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.000000 -0.000000 -0.000000 0.00000 -0.000000 1.000000 -0.000000 0.00000 -0.000000 -0.000000 1.000000 0.00000 2 'point symmetry operation' ? ? -0.809017 -0.500000 0.309017 470.00000 -0.500000 0.309017 -0.809017 470.00000 0.309017 -0.809017 -0.500000 470.00000 3 'point symmetry operation' ? ? 0.000000 1.000000 0.000000 -0.00000 0.000000 -0.000000 -1.000000 470.00000 -1.000000 0.000000 0.000000 470.00000 4 'point symmetry operation' ? ? 0.809017 -0.500000 -0.309017 235.00000 -0.500000 -0.309017 -0.809017 615.23799 0.309017 0.809017 -0.500000 89.76201 5 'point symmetry operation' ? ? 0.500000 0.309017 -0.809017 235.00000 -0.309017 -0.809017 -0.500000 615.23799 -0.809017 0.500000 -0.309017 380.23799 6 'point symmetry operation' ? ? -0.309017 -0.809017 -0.500000 615.23799 -0.809017 0.500000 -0.309017 380.23799 0.500000 0.309017 -0.809017 235.00000 7 'point symmetry operation' ? ? -0.809017 0.500000 -0.309017 380.23799 0.500000 0.309017 -0.809017 235.00000 -0.309017 -0.809017 -0.500000 615.23799 8 'point symmetry operation' ? ? -0.809017 -0.500000 -0.309017 615.23799 0.500000 -0.309017 -0.809017 380.23799 0.309017 -0.809017 0.500000 235.00000 9 'point symmetry operation' ? ? -0.309017 0.809017 -0.500000 235.00000 -0.809017 -0.500000 -0.309017 615.23799 -0.500000 0.309017 0.809017 89.76201 10 'point symmetry operation' ? ? 0.500000 -0.309017 -0.809017 380.23799 -0.309017 0.809017 -0.500000 235.00000 0.809017 0.500000 0.309017 -145.23799 11 'point symmetry operation' ? ? 0.000000 -0.000000 -1.000000 470.00000 -1.000000 0.000000 0.000000 470.00000 -0.000000 1.000000 0.000000 -0.00000 12 'point symmetry operation' ? ? -0.500000 -0.309017 -0.809017 615.23799 0.309017 0.809017 -0.500000 89.76201 0.809017 -0.500000 -0.309017 235.00000 13 'point symmetry operation' ? ? -0.500000 0.309017 -0.809017 470.00000 0.309017 -0.809017 -0.500000 470.00000 -0.809017 -0.500000 0.309017 470.00000 14 'point symmetry operation' ? ? -0.309017 -0.809017 -0.500000 615.23799 0.809017 -0.500000 0.309017 89.76201 -0.500000 -0.309017 0.809017 235.00000 15 'point symmetry operation' ? ? -0.809017 0.500000 -0.309017 380.23799 -0.500000 -0.309017 0.809017 235.00000 0.309017 0.809017 0.500000 -145.23799 16 'point symmetry operation' ? ? 0.500000 0.309017 -0.809017 235.00000 0.309017 0.809017 0.500000 -145.23799 0.809017 -0.500000 0.309017 89.76201 17 'point symmetry operation' ? ? -0.500000 0.309017 -0.809017 470.00000 -0.309017 0.809017 0.500000 0.00000 0.809017 0.500000 -0.309017 -0.00000 18 'point symmetry operation' ? ? 0.000000 0.000000 -1.000000 470.00000 1.000000 -0.000000 0.000000 -0.00000 0.000000 -1.000000 0.000000 470.00000 19 'point symmetry operation' ? ? -0.500000 -0.309017 -0.809017 615.23799 -0.309017 -0.809017 0.500000 380.23799 -0.809017 0.500000 0.309017 235.00000 20 'point symmetry operation' ? ? 0.000000 -1.000000 -0.000000 470.00000 -0.000000 0.000000 1.000000 0.00000 -1.000000 0.000000 0.000000 470.00000 21 'point symmetry operation' ? ? -0.809017 0.500000 0.309017 235.00000 0.500000 0.309017 0.809017 -145.23799 0.309017 0.809017 -0.500000 89.76201 22 'point symmetry operation' ? ? 0.809017 0.500000 -0.309017 -0.00000 0.500000 -0.309017 0.809017 0.00000 0.309017 -0.809017 -0.500000 470.00000 23 'point symmetry operation' ? ? -0.309017 0.809017 -0.500000 235.00000 0.809017 0.500000 0.309017 -145.23799 0.500000 -0.309017 -0.809017 380.23799 24 'point symmetry operation' ? ? 0.500000 -0.309017 -0.809017 380.23799 0.309017 -0.809017 0.500000 235.00000 -0.809017 -0.500000 -0.309017 615.23799 25 'point symmetry operation' ? ? -0.809017 -0.500000 -0.309017 615.23799 -0.500000 0.309017 0.809017 89.76201 -0.309017 0.809017 -0.500000 235.00000 26 'point symmetry operation' ? ? -0.309017 -0.809017 0.500000 380.23799 -0.809017 0.500000 0.309017 235.00000 -0.500000 -0.309017 -0.809017 615.23799 27 'point symmetry operation' ? ? -0.309017 0.809017 0.500000 -0.00000 0.809017 0.500000 -0.309017 -0.00000 -0.500000 0.309017 -0.809017 470.00000 28 'point symmetry operation' ? ? 1.000000 -0.000000 0.000000 -0.00000 -0.000000 -1.000000 0.000000 470.00000 0.000000 0.000000 -1.000000 470.00000 29 'point symmetry operation' ? ? 0.309017 0.809017 -0.500000 89.76201 0.809017 -0.500000 -0.309017 235.00000 -0.500000 -0.309017 -0.809017 615.23799 30 'point symmetry operation' ? ? 0.309017 -0.809017 -0.500000 470.00000 -0.809017 -0.500000 0.309017 470.00000 -0.500000 0.309017 -0.809017 470.00000 31 'point symmetry operation' ? ? -1.000000 0.000000 0.000000 470.00000 0.000000 1.000000 0.000000 -0.00000 0.000000 0.000000 -1.000000 470.00000 32 'point symmetry operation' ? ? 0.809017 0.500000 -0.309017 -0.00000 -0.500000 0.309017 -0.809017 470.00000 -0.309017 0.809017 0.500000 -0.00000 33 'point symmetry operation' ? ? -0.000000 -1.000000 0.000000 470.00000 0.000000 0.000000 -1.000000 470.00000 1.000000 -0.000000 -0.000000 -0.00000 34 'point symmetry operation' ? ? -0.809017 0.500000 0.309017 235.00000 -0.500000 -0.309017 -0.809017 615.23799 -0.309017 -0.809017 0.500000 380.23799 35 'point symmetry operation' ? ? -0.500000 -0.309017 0.809017 235.00000 -0.309017 -0.809017 -0.500000 615.23799 0.809017 -0.500000 0.309017 89.76201 36 'point symmetry operation' ? ? 0.309017 0.809017 0.500000 -145.23799 -0.809017 0.500000 -0.309017 380.23799 -0.500000 -0.309017 0.809017 235.00000 37 'point symmetry operation' ? ? 0.809017 -0.500000 0.309017 89.76201 0.500000 0.309017 -0.809017 235.00000 0.309017 0.809017 0.500000 -145.23799 38 'point symmetry operation' ? ? 0.809017 0.500000 0.309017 -145.23799 0.500000 -0.309017 -0.809017 380.23799 -0.309017 0.809017 -0.500000 235.00000 39 'point symmetry operation' ? ? 0.309017 -0.809017 0.500000 235.00000 -0.809017 -0.500000 -0.309017 615.23799 0.500000 -0.309017 -0.809017 380.23799 40 'point symmetry operation' ? ? -0.500000 0.309017 0.809017 89.76201 -0.309017 0.809017 -0.500000 235.00000 -0.809017 -0.500000 -0.309017 615.23799 41 'point symmetry operation' ? ? -0.000000 0.000000 1.000000 -0.00000 -1.000000 0.000000 -0.000000 470.00000 0.000000 -1.000000 -0.000000 470.00000 42 'point symmetry operation' ? ? 0.500000 0.309017 0.809017 -145.23799 0.309017 0.809017 -0.500000 89.76201 -0.809017 0.500000 0.309017 235.00000 43 'point symmetry operation' ? ? 0.500000 -0.309017 0.809017 0.00000 0.309017 -0.809017 -0.500000 470.00000 0.809017 0.500000 -0.309017 -0.00000 44 'point symmetry operation' ? ? 0.309017 0.809017 0.500000 -145.23799 0.809017 -0.500000 0.309017 89.76201 0.500000 0.309017 -0.809017 235.00000 45 'point symmetry operation' ? ? 0.809017 -0.500000 0.309017 89.76201 -0.500000 -0.309017 0.809017 235.00000 -0.309017 -0.809017 -0.500000 615.23799 46 'point symmetry operation' ? ? -0.500000 -0.309017 0.809017 235.00000 0.309017 0.809017 0.500000 -145.23799 -0.809017 0.500000 -0.309017 380.23799 47 'point symmetry operation' ? ? 0.500000 -0.309017 0.809017 -0.00000 -0.309017 0.809017 0.500000 0.00000 -0.809017 -0.500000 0.309017 470.00000 48 'point symmetry operation' ? ? -0.000000 -0.000000 1.000000 0.00000 1.000000 -0.000000 -0.000000 -0.00000 -0.000000 1.000000 -0.000000 -0.00000 49 'point symmetry operation' ? ? 0.500000 0.309017 0.809017 -145.23799 -0.309017 -0.809017 0.500000 380.23799 0.809017 -0.500000 -0.309017 235.00000 50 'point symmetry operation' ? ? -0.000000 1.000000 -0.000000 0.00000 -0.000000 -0.000000 1.000000 0.00000 1.000000 -0.000000 -0.000000 -0.00000 51 'point symmetry operation' ? ? 0.809017 -0.500000 -0.309017 235.00000 0.500000 0.309017 0.809017 -145.23799 -0.309017 -0.809017 0.500000 380.23799 52 'point symmetry operation' ? ? -0.809017 -0.500000 0.309017 470.00000 0.500000 -0.309017 0.809017 0.00000 -0.309017 0.809017 0.500000 -0.00000 53 'point symmetry operation' ? ? 0.309017 -0.809017 0.500000 235.00000 0.809017 0.500000 0.309017 -145.23799 -0.500000 0.309017 0.809017 89.76201 54 'point symmetry operation' ? ? -0.500000 0.309017 0.809017 89.76201 0.309017 -0.809017 0.500000 235.00000 0.809017 0.500000 0.309017 -145.23799 55 'point symmetry operation' ? ? 0.809017 0.500000 0.309017 -145.23799 -0.500000 0.309017 0.809017 89.76201 0.309017 -0.809017 0.500000 235.00000 56 'point symmetry operation' ? ? 0.309017 0.809017 -0.500000 89.76201 -0.809017 0.500000 0.309017 235.00000 0.500000 0.309017 0.809017 -145.23799 57 'point symmetry operation' ? ? 0.309017 -0.809017 -0.500000 470.00000 0.809017 0.500000 -0.309017 -0.00000 0.500000 -0.309017 0.809017 -0.00000 58 'point symmetry operation' ? ? -1.000000 0.000000 -0.000000 470.00000 0.000000 -1.000000 -0.000000 470.00000 -0.000000 -0.000000 1.000000 0.00000 59 'point symmetry operation' ? ? -0.309017 -0.809017 0.500000 380.23799 0.809017 -0.500000 -0.309017 235.00000 0.500000 0.309017 0.809017 -145.23799 60 'point symmetry operation' ? ? -0.309017 0.809017 0.500000 0.00000 -0.809017 -0.500000 0.309017 470.00000 0.500000 -0.309017 0.809017 -0.00000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 13 ? THR A 23 ? THR A 13 THR A 23 1 ? 11 HELX_P HELX_P2 AA2 SER A 49 ? ILE A 52 ? SER A 49 ILE A 52 5 ? 4 HELX_P HELX_P3 AA3 ASN A 117 ? GLN A 123 ? ASN A 117 GLN A 123 1 ? 7 HELX_P HELX_P4 AA4 VAL A 163 ? ASN A 167 ? VAL A 163 ASN A 167 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 26 OE1 ? ? ? 1_555 B MG . MG ? ? A GLU 26 A MG 301 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc2 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 56 A MG 302 1_555 ? ? ? ? ? ? ? 3.000 ? ? metalc3 metalc ? ? A ASP 56 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 56 A MG 302 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc4 metalc ? ? A THR 139 O ? ? ? 1_555 D MG . MG ? ? A THR 139 A MG 303 1_555 ? ? ? ? ? ? ? 2.411 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OD1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id ASP _pdbx_struct_conn_angle.ptnr1_label_seq_id 56 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id ASP _pdbx_struct_conn_angle.ptnr1_auth_seq_id 56 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MG _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id C _pdbx_struct_conn_angle.ptnr2_label_comp_id MG _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id MG _pdbx_struct_conn_angle.ptnr2_auth_seq_id 302 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id OD2 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id ASP _pdbx_struct_conn_angle.ptnr3_label_seq_id 56 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id ASP _pdbx_struct_conn_angle.ptnr3_auth_seq_id 56 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 47.0 _pdbx_struct_conn_angle.value_esd ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 27 ? THR A 38 ? HIS A 27 THR A 38 AA1 2 LEU A 184 ? THR A 194 ? LEU A 184 THR A 194 AA1 3 GLN A 65 ? THR A 78 ? GLN A 65 THR A 78 AA1 4 ILE A 143 ? PRO A 151 ? ILE A 143 PRO A 151 AA2 1 HIS A 27 ? THR A 38 ? HIS A 27 THR A 38 AA2 2 LEU A 184 ? THR A 194 ? LEU A 184 THR A 194 AA2 3 GLN A 65 ? THR A 78 ? GLN A 65 THR A 78 AA2 4 LEU A 154 ? ASN A 156 ? LEU A 154 ASN A 156 AA3 1 THR A 44 ? ASN A 47 ? THR A 44 ASN A 47 AA3 2 ALA A 171 ? GLY A 178 ? ALA A 171 GLY A 178 AA3 3 GLN A 84 ? ASP A 93 ? GLN A 84 ASP A 93 AA3 4 PHE A 126 ? CYS A 136 ? PHE A 126 CYS A 136 AA4 1 ILE A 53 ? GLN A 54 ? ILE A 53 GLN A 54 AA4 2 GLN A 60 ? ARG A 61 ? GLN A 60 ARG A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 37 ? N ASN A 37 O TRP A 185 ? O TRP A 185 AA1 2 3 O VAL A 192 ? O VAL A 192 N SER A 70 ? N SER A 70 AA1 3 4 N LEU A 73 ? N LEU A 73 O ILE A 148 ? O ILE A 148 AA2 1 2 N ASN A 37 ? N ASN A 37 O TRP A 185 ? O TRP A 185 AA2 2 3 O VAL A 192 ? O VAL A 192 N SER A 70 ? N SER A 70 AA2 3 4 N VAL A 66 ? N VAL A 66 O VAL A 155 ? O VAL A 155 AA3 1 2 N GLN A 46 ? N GLN A 46 O MET A 174 ? O MET A 174 AA3 2 3 O LEU A 175 ? O LEU A 175 N ILE A 89 ? N ILE A 89 AA3 3 4 N PHE A 86 ? N PHE A 86 O LEU A 134 ? O LEU A 134 AA4 1 2 N ILE A 53 ? N ILE A 53 O ARG A 61 ? O ARG A 61 # _pdbx_entry_details.entry_id 9QVE _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ILE _pdbx_validate_close_contact.auth_seq_id_1 52 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 61 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 81 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 72.57 _pdbx_validate_torsion.psi -63.73 # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 9QVE _em_3d_fitting.method ? _em_3d_fitting.target_criteria 'cross-correlation coefficient' _em_3d_fitting.details ? _em_3d_fitting.overall_b_value 43 _em_3d_fitting.ref_space REAL _em_3d_fitting.ref_protocol 'FLEXIBLE FIT' # _em_3d_fitting_list.id 1 _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.pdb_entry_id 2BUK _em_3d_fitting_list.pdb_chain_id ? _em_3d_fitting_list.pdb_chain_residue_range ? _em_3d_fitting_list.details ? _em_3d_fitting_list.chain_id ? _em_3d_fitting_list.chain_residue_range ? _em_3d_fitting_list.source_name PDB _em_3d_fitting_list.type 'experimental model' _em_3d_fitting_list.accession_code 2BUK _em_3d_fitting_list.initial_refinement_model_id ? # _em_3d_reconstruction.entry_id 9QVE _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm 'FOURIER SPACE' _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.77 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 207142 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages 1 _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type POINT # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details '1 x phosphate-buffered saline' _em_buffer.pH 7.4 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type VIRUS _em_entity_assembly.name 'Satellite tobacco necrosis virus 1' _em_entity_assembly.details ;The complete STNV coat protein gene was inserted into the pEff vector. Expression was initiated by infiltrating leaves of Nicotiana benthamiana with suspensions of Agrobacterium tumefaciens strain LBA4404 harbouring this vector. ; _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # loop_ _em_image_scans.entry_id _em_image_scans.id _em_image_scans.number_digital_images _em_image_scans.details _em_image_scans.scanner_model _em_image_scans.sampling_size _em_image_scans.od_range _em_image_scans.quant_bit_size _em_image_scans.citation_id _em_image_scans.dimension_height _em_image_scans.dimension_width _em_image_scans.frames_per_image _em_image_scans.image_recording_id _em_image_scans.used_frames_per_image 9QVE 1 ? ? ? ? ? ? ? 4096 4096 ? 1 ? 9QVE 2 ? ? ? ? ? ? ? 4096 4096 ? 2 ? 9QVE 3 ? ? ? ? ? ? ? 4096 4096 ? 3 ? # _em_imaging.entry_id 9QVE _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'TFS TALOS F200C' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model 'GATAN ELSA 698 SINGLE TILT LIQUID NITROGEN CRYO TRANSFER HOLDER' _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 200 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_min 700 _em_imaging.nominal_defocus_max 1800 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification 150000 _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure 'COMA FREE' _em_imaging.c2_aperture_diameter 50 _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN _em_imaging.objective_aperture ? _em_imaging.microscope_serial_number ? _em_imaging.microscope_version ? # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 300 _em_sample_support.grid_type 'Quantifoil R1.2/1.3' _em_sample_support.details 'glow discharged for 60 seconds at 8 mA using an ACE 200 (Leica Microsystems)' _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_virus_entity.id 1 _em_virus_entity.virus_host_category ? _em_virus_entity.virus_type 'VIRUS-LIKE PARTICLE' _em_virus_entity.virus_isolate STRAIN _em_virus_entity.entity_assembly_id 1 _em_virus_entity.enveloped NO _em_virus_entity.empty NO _em_virus_entity.details ? # _em_vitrification.entry_id 9QVE _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity 100 _em_vitrification.temp ? _em_vitrification.chamber_temperature 277 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 9QVE _em_experiment.id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.aggregation_state PARTICLE _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 9QVE _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry I # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A ALA 12 ? A ALA 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MG MG MG N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _em_admin.current_status REL _em_admin.deposition_date 2025-04-11 _em_admin.deposition_site PDBE _em_admin.entry_id 9QVE _em_admin.last_update 2025-05-07 _em_admin.map_release_date 2025-05-07 _em_admin.title 'Satellite Tobacco Necrosis Virus-1' # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 1.30 # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 12445 _em_entity_assembly_naturalsource.organism 'Satellite tobacco necrosis virus 1' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? _em_entity_assembly_naturalsource.details ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 4100 _em_entity_assembly_recombinant.organism 'Nicotiana benthamiana' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # loop_ _em_image_recording.average_exposure_time _em_image_recording.avg_electron_dose_per_subtomogram _em_image_recording.avg_electron_dose_per_image _em_image_recording.details _em_image_recording.detector_mode _em_image_recording.film_or_detector_model _em_image_recording.id _em_image_recording.imaging_id _em_image_recording.num_diffraction_images _em_image_recording.num_grids_imaged _em_image_recording.num_real_images 2.85 ? 30 'The particles were densely packed showing mostly 5-fold views' ? 'TFS FALCON 4i (4k x 4k)' 1 1 ? 1 2703 2.82 ? 30 'Regions with a lower particle density were selected, giving additional views, but still dominated by 5-folds.' ? 'TFS FALCON 4i (4k x 4k)' 2 1 ? 1 575 3.49 ? 40 'Data were collected with a positive 20 degree tilt giving a better distribution of views.' ? 'TFS FALCON 4i (4k x 4k)' 3 1 ? 1 985 # _em_particle_selection.details 'combined figure from the 3 datasets' _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.method ? _em_particle_selection.num_particles_selected 2394377 _em_particle_selection.reference_model ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version _em_software.reference_DOI 'PARTICLE SELECTION' ? 1 1 ? ? cryoSPARC 4.5.3 ? 'IMAGE ACQUISITION' ? 2 ? ? 1 EPU 3.7.1.6940 ? MASKING ? 3 ? ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? cryoSPARC 4.5.3 ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? ? 'MODEL FITTING' ? 7 ? 1 ? 'UCSF ChimeraX' 1.8 ? 'MODEL FITTING' ? 8 ? 1 ? Coot '0.9.8.95 EL (ccp4)' ? OTHER ? 9 ? ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? cryoSPARC 4.5.3 ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? cryoSPARC 4.5.3 ? CLASSIFICATION ? 12 1 ? ? cryoSPARC 4.5.3 ? RECONSTRUCTION ? 13 1 ? ? cryoSPARC 4.5.3 ? 'MODEL REFINEMENT' ? 14 ? 1 ? PHENIX 1.21.2_5419: ? # _em_specimen.concentration 2.92 _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_shell.diameter 200 _em_virus_shell.entity_assembly_id 1 _em_virus_shell.id 1 _em_virus_shell.name capsid _em_virus_shell.triangulation 1 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/X01097X/1 1 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/Y005732/1 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ZX8 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9QVE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H MG N O S # loop_