data_9R1L # _entry.id 9R1L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9R1L pdb_00009r1l 10.2210/pdb9r1l/pdb WWPDB D_1292147388 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-06 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9R1L _pdbx_database_status.recvd_initial_deposition_date 2025-04-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email d.n.woolfson@bristol.ac.uk _pdbx_contact_author.name_first Derek _pdbx_contact_author.name_last Woolfson _pdbx_contact_author.name_mi N. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0394-3202 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Petrenas, R.' 1 0000-0002-2997-7187 'Ozga, K.' 2 0000-0002-2837-283X 'Chubb, J.J.' 3 0009-0006-2256-7640 'Woolfson, D.N.' 4 0000-0002-0394-3202 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'X-ray crystal structure of a de novo designed SN38 binder, sc-apCC-4-SN38-1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Petrenas, R.' 1 0000-0002-2997-7187 primary 'Ozga, K.' 2 0000-0002-2837-283X primary 'Chubb, J.J.' 3 0009-0006-2256-7640 primary 'Woolfson, D.N.' 4 0000-0002-0394-3202 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man sc-apCC-4-SN38-1 16672.861 1 ? ? ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 3 non-polymer syn ETHANOLAMINE 61.083 2 ? ? ? ? 4 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMQLEEIAQQLEEGAKQTKKNAWQLKKIAQGEPSAQGQLEEIAQQAEEIAKQSKKIAWQLK KIAQGPDSVQLEEIAQQLEEIAKQAKKGAWQLKKIAQGGTSGGQLEEIAQQAEEGAKQAKKIAWQLKKIAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMQLEEIAQQLEEGAKQTKKNAWQLKKIAQGEPSAQGQLEEIAQQAEEIAKQSKKIAWQLK KIAQGPDSVQLEEIAQQLEEIAKQAKKGAWQLKKIAQGGTSGGQLEEIAQQAEEGAKQAKKIAWQLKKIAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 ETHANOLAMINE ETA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLN n 1 23 LEU n 1 24 GLU n 1 25 GLU n 1 26 ILE n 1 27 ALA n 1 28 GLN n 1 29 GLN n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 GLY n 1 34 ALA n 1 35 LYS n 1 36 GLN n 1 37 THR n 1 38 LYS n 1 39 LYS n 1 40 ASN n 1 41 ALA n 1 42 TRP n 1 43 GLN n 1 44 LEU n 1 45 LYS n 1 46 LYS n 1 47 ILE n 1 48 ALA n 1 49 GLN n 1 50 GLY n 1 51 GLU n 1 52 PRO n 1 53 SER n 1 54 ALA n 1 55 GLN n 1 56 GLY n 1 57 GLN n 1 58 LEU n 1 59 GLU n 1 60 GLU n 1 61 ILE n 1 62 ALA n 1 63 GLN n 1 64 GLN n 1 65 ALA n 1 66 GLU n 1 67 GLU n 1 68 ILE n 1 69 ALA n 1 70 LYS n 1 71 GLN n 1 72 SER n 1 73 LYS n 1 74 LYS n 1 75 ILE n 1 76 ALA n 1 77 TRP n 1 78 GLN n 1 79 LEU n 1 80 LYS n 1 81 LYS n 1 82 ILE n 1 83 ALA n 1 84 GLN n 1 85 GLY n 1 86 PRO n 1 87 ASP n 1 88 SER n 1 89 VAL n 1 90 GLN n 1 91 LEU n 1 92 GLU n 1 93 GLU n 1 94 ILE n 1 95 ALA n 1 96 GLN n 1 97 GLN n 1 98 LEU n 1 99 GLU n 1 100 GLU n 1 101 ILE n 1 102 ALA n 1 103 LYS n 1 104 GLN n 1 105 ALA n 1 106 LYS n 1 107 LYS n 1 108 GLY n 1 109 ALA n 1 110 TRP n 1 111 GLN n 1 112 LEU n 1 113 LYS n 1 114 LYS n 1 115 ILE n 1 116 ALA n 1 117 GLN n 1 118 GLY n 1 119 GLY n 1 120 THR n 1 121 SER n 1 122 GLY n 1 123 GLY n 1 124 GLN n 1 125 LEU n 1 126 GLU n 1 127 GLU n 1 128 ILE n 1 129 ALA n 1 130 GLN n 1 131 GLN n 1 132 ALA n 1 133 GLU n 1 134 GLU n 1 135 GLY n 1 136 ALA n 1 137 LYS n 1 138 GLN n 1 139 ALA n 1 140 LYS n 1 141 LYS n 1 142 ILE n 1 143 ALA n 1 144 TRP n 1 145 GLN n 1 146 LEU n 1 147 LYS n 1 148 LYS n 1 149 ILE n 1 150 ALA n 1 151 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 151 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ETA 'L-peptide COOH carboxy terminus' . ETHANOLAMINE ? 'C2 H7 N O' 61.083 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 GLN 22 2 2 GLN GLN A . n A 1 23 LEU 23 3 3 LEU LEU A . n A 1 24 GLU 24 4 4 GLU GLU A . n A 1 25 GLU 25 5 5 GLU GLU A . n A 1 26 ILE 26 6 6 ILE ILE A . n A 1 27 ALA 27 7 7 ALA ALA A . n A 1 28 GLN 28 8 8 GLN GLN A . n A 1 29 GLN 29 9 9 GLN GLN A . n A 1 30 LEU 30 10 10 LEU LEU A . n A 1 31 GLU 31 11 11 GLU GLU A . n A 1 32 GLU 32 12 12 GLU GLU A . n A 1 33 GLY 33 13 13 GLY GLY A . n A 1 34 ALA 34 14 14 ALA ALA A . n A 1 35 LYS 35 15 15 LYS LYS A . n A 1 36 GLN 36 16 16 GLN GLN A . n A 1 37 THR 37 17 17 THR THR A . n A 1 38 LYS 38 18 18 LYS LYS A . n A 1 39 LYS 39 19 19 LYS LYS A . n A 1 40 ASN 40 20 20 ASN ASN A . n A 1 41 ALA 41 21 21 ALA ALA A . n A 1 42 TRP 42 22 22 TRP TRP A . n A 1 43 GLN 43 23 23 GLN GLN A . n A 1 44 LEU 44 24 24 LEU LEU A . n A 1 45 LYS 45 25 25 LYS LYS A . n A 1 46 LYS 46 26 26 LYS LYS A . n A 1 47 ILE 47 27 27 ILE ILE A . n A 1 48 ALA 48 28 28 ALA ALA A . n A 1 49 GLN 49 29 29 GLN GLN A . n A 1 50 GLY 50 30 30 GLY GLY A . n A 1 51 GLU 51 31 31 GLU GLU A . n A 1 52 PRO 52 32 32 PRO PRO A . n A 1 53 SER 53 33 33 SER SER A . n A 1 54 ALA 54 34 34 ALA ALA A . n A 1 55 GLN 55 35 35 GLN GLN A . n A 1 56 GLY 56 36 36 GLY GLY A . n A 1 57 GLN 57 37 37 GLN GLN A . n A 1 58 LEU 58 38 38 LEU LEU A . n A 1 59 GLU 59 39 39 GLU GLU A . n A 1 60 GLU 60 40 40 GLU GLU A . n A 1 61 ILE 61 41 41 ILE ILE A . n A 1 62 ALA 62 42 42 ALA ALA A . n A 1 63 GLN 63 43 43 GLN GLN A . n A 1 64 GLN 64 44 44 GLN GLN A . n A 1 65 ALA 65 45 45 ALA ALA A . n A 1 66 GLU 66 46 46 GLU GLU A . n A 1 67 GLU 67 47 47 GLU GLU A . n A 1 68 ILE 68 48 48 ILE ILE A . n A 1 69 ALA 69 49 49 ALA ALA A . n A 1 70 LYS 70 50 50 LYS LYS A . n A 1 71 GLN 71 51 51 GLN GLN A . n A 1 72 SER 72 52 52 SER SER A . n A 1 73 LYS 73 53 53 LYS LYS A . n A 1 74 LYS 74 54 54 LYS LYS A . n A 1 75 ILE 75 55 55 ILE ILE A . n A 1 76 ALA 76 56 56 ALA ALA A . n A 1 77 TRP 77 57 57 TRP TRP A . n A 1 78 GLN 78 58 58 GLN GLN A . n A 1 79 LEU 79 59 59 LEU LEU A . n A 1 80 LYS 80 60 60 LYS LYS A . n A 1 81 LYS 81 61 61 LYS LYS A . n A 1 82 ILE 82 62 62 ILE ILE A . n A 1 83 ALA 83 63 63 ALA ALA A . n A 1 84 GLN 84 64 64 GLN GLN A . n A 1 85 GLY 85 65 65 GLY GLY A . n A 1 86 PRO 86 66 66 PRO PRO A . n A 1 87 ASP 87 67 67 ASP ASP A . n A 1 88 SER 88 68 68 SER SER A . n A 1 89 VAL 89 69 69 VAL VAL A . n A 1 90 GLN 90 70 70 GLN GLN A . n A 1 91 LEU 91 71 71 LEU LEU A . n A 1 92 GLU 92 72 72 GLU GLU A . n A 1 93 GLU 93 73 73 GLU GLU A . n A 1 94 ILE 94 74 74 ILE ILE A . n A 1 95 ALA 95 75 75 ALA ALA A . n A 1 96 GLN 96 76 76 GLN GLN A . n A 1 97 GLN 97 77 77 GLN GLN A . n A 1 98 LEU 98 78 78 LEU LEU A . n A 1 99 GLU 99 79 79 GLU GLU A . n A 1 100 GLU 100 80 80 GLU GLU A . n A 1 101 ILE 101 81 81 ILE ILE A . n A 1 102 ALA 102 82 82 ALA ALA A . n A 1 103 LYS 103 83 83 LYS LYS A . n A 1 104 GLN 104 84 84 GLN GLN A . n A 1 105 ALA 105 85 85 ALA ALA A . n A 1 106 LYS 106 86 86 LYS LYS A . n A 1 107 LYS 107 87 87 LYS LYS A . n A 1 108 GLY 108 88 88 GLY GLY A . n A 1 109 ALA 109 89 89 ALA ALA A . n A 1 110 TRP 110 90 90 TRP TRP A . n A 1 111 GLN 111 91 91 GLN GLN A . n A 1 112 LEU 112 92 92 LEU LEU A . n A 1 113 LYS 113 93 93 LYS LYS A . n A 1 114 LYS 114 94 94 LYS LYS A . n A 1 115 ILE 115 95 95 ILE ILE A . n A 1 116 ALA 116 96 96 ALA ALA A . n A 1 117 GLN 117 97 97 GLN GLN A . n A 1 118 GLY 118 98 98 GLY GLY A . n A 1 119 GLY 119 99 99 GLY GLY A . n A 1 120 THR 120 100 100 THR THR A . n A 1 121 SER 121 101 101 SER SER A . n A 1 122 GLY 122 102 102 GLY GLY A . n A 1 123 GLY 123 103 103 GLY GLY A . n A 1 124 GLN 124 104 104 GLN GLN A . n A 1 125 LEU 125 105 105 LEU LEU A . n A 1 126 GLU 126 106 106 GLU GLU A . n A 1 127 GLU 127 107 107 GLU GLU A . n A 1 128 ILE 128 108 108 ILE ILE A . n A 1 129 ALA 129 109 109 ALA ALA A . n A 1 130 GLN 130 110 110 GLN GLN A . n A 1 131 GLN 131 111 111 GLN GLN A . n A 1 132 ALA 132 112 112 ALA ALA A . n A 1 133 GLU 133 113 113 GLU GLU A . n A 1 134 GLU 134 114 114 GLU GLU A . n A 1 135 GLY 135 115 115 GLY GLY A . n A 1 136 ALA 136 116 116 ALA ALA A . n A 1 137 LYS 137 117 117 LYS LYS A . n A 1 138 GLN 138 118 118 GLN GLN A . n A 1 139 ALA 139 119 119 ALA ALA A . n A 1 140 LYS 140 120 120 LYS LYS A . n A 1 141 LYS 141 121 121 LYS LYS A . n A 1 142 ILE 142 122 122 ILE ILE A . n A 1 143 ALA 143 123 123 ALA ALA A . n A 1 144 TRP 144 124 124 TRP TRP A . n A 1 145 GLN 145 125 125 GLN GLN A . n A 1 146 LEU 146 126 126 LEU LEU A . n A 1 147 LYS 147 127 127 LYS LYS A . n A 1 148 LYS 148 128 128 LYS LYS A . n A 1 149 ILE 149 129 129 ILE ILE A . n A 1 150 ALA 150 130 130 ALA ALA A . n A 1 151 GLN 151 131 131 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 301 301 PEG PEG A . C 3 ETA 1 302 401 ETA GLY A . D 3 ETA 1 303 501 ETA GLY A . E 4 HOH 1 401 15 HOH HOH A . E 4 HOH 2 402 6 HOH HOH A . E 4 HOH 3 403 20 HOH HOH A . E 4 HOH 4 404 4 HOH HOH A . E 4 HOH 5 405 2 HOH HOH A . E 4 HOH 6 406 5 HOH HOH A . E 4 HOH 7 407 12 HOH HOH A . E 4 HOH 8 408 8 HOH HOH A . E 4 HOH 9 409 16 HOH HOH A . E 4 HOH 10 410 7 HOH HOH A . E 4 HOH 11 411 21 HOH HOH A . E 4 HOH 12 412 1 HOH HOH A . E 4 HOH 13 413 22 HOH HOH A . E 4 HOH 14 414 13 HOH HOH A . E 4 HOH 15 415 19 HOH HOH A . E 4 HOH 16 416 18 HOH HOH A . E 4 HOH 17 417 23 HOH HOH A . E 4 HOH 18 418 17 HOH HOH A . E 4 HOH 19 419 3 HOH HOH A . E 4 HOH 20 420 11 HOH HOH A . E 4 HOH 21 421 10 HOH HOH A . E 4 HOH 22 422 9 HOH HOH A . E 4 HOH 23 423 24 HOH HOH A . E 4 HOH 24 424 14 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER -1 ? OG ? A SER 19 OG 2 1 Y 1 A MET 1 ? CG ? A MET 21 CG 3 1 Y 1 A MET 1 ? SD ? A MET 21 SD 4 1 Y 1 A MET 1 ? CE ? A MET 21 CE 5 1 Y 1 A GLU 5 ? CG ? A GLU 25 CG 6 1 Y 1 A GLU 5 ? CD ? A GLU 25 CD 7 1 Y 1 A GLU 5 ? OE1 ? A GLU 25 OE1 8 1 Y 1 A GLU 5 ? OE2 ? A GLU 25 OE2 9 1 Y 1 A GLN 8 ? CD ? A GLN 28 CD 10 1 Y 1 A GLN 8 ? OE1 ? A GLN 28 OE1 11 1 Y 1 A GLN 8 ? NE2 ? A GLN 28 NE2 12 1 Y 1 A GLU 12 ? CG ? A GLU 32 CG 13 1 Y 1 A GLU 12 ? CD ? A GLU 32 CD 14 1 Y 1 A GLU 12 ? OE1 ? A GLU 32 OE1 15 1 Y 1 A GLU 12 ? OE2 ? A GLU 32 OE2 16 1 Y 1 A LYS 15 ? CE ? A LYS 35 CE 17 1 Y 1 A LYS 15 ? NZ ? A LYS 35 NZ 18 1 Y 1 A GLN 16 ? CD ? A GLN 36 CD 19 1 Y 1 A GLN 16 ? OE1 ? A GLN 36 OE1 20 1 Y 1 A GLN 16 ? NE2 ? A GLN 36 NE2 21 1 Y 1 A LYS 26 ? CD ? A LYS 46 CD 22 1 Y 1 A LYS 26 ? CE ? A LYS 46 CE 23 1 Y 1 A LYS 26 ? NZ ? A LYS 46 NZ 24 1 Y 1 A GLN 43 ? CG ? A GLN 63 CG 25 1 Y 1 A GLN 43 ? CD ? A GLN 63 CD 26 1 Y 1 A GLN 43 ? OE1 ? A GLN 63 OE1 27 1 Y 1 A GLN 43 ? NE2 ? A GLN 63 NE2 28 1 Y 1 A LYS 83 ? CE ? A LYS 103 CE 29 1 Y 1 A LYS 83 ? NZ ? A LYS 103 NZ 30 1 Y 1 A LYS 86 ? CD ? A LYS 106 CD 31 1 Y 1 A LYS 86 ? CE ? A LYS 106 CE 32 1 Y 1 A LYS 86 ? NZ ? A LYS 106 NZ 33 1 Y 1 A LYS 87 ? CD ? A LYS 107 CD 34 1 Y 1 A LYS 87 ? CE ? A LYS 107 CE 35 1 Y 1 A LYS 87 ? NZ ? A LYS 107 NZ 36 1 Y 1 A LYS 94 ? CE ? A LYS 114 CE 37 1 Y 1 A LYS 94 ? NZ ? A LYS 114 NZ 38 1 Y 1 A GLN 97 ? CG ? A GLN 117 CG 39 1 Y 1 A GLN 97 ? CD ? A GLN 117 CD 40 1 Y 1 A GLN 97 ? OE1 ? A GLN 117 OE1 41 1 Y 1 A GLN 97 ? NE2 ? A GLN 117 NE2 42 1 Y 1 A SER 101 ? OG ? A SER 121 OG 43 1 Y 1 A GLU 106 ? CG ? A GLU 126 CG 44 1 Y 1 A GLU 106 ? CD ? A GLU 126 CD 45 1 Y 1 A GLU 106 ? OE1 ? A GLU 126 OE1 46 1 Y 1 A GLU 106 ? OE2 ? A GLU 126 OE2 47 1 Y 1 A GLN 110 ? CG ? A GLN 130 CG 48 1 Y 1 A GLN 110 ? CD ? A GLN 130 CD 49 1 Y 1 A GLN 110 ? OE1 ? A GLN 130 OE1 50 1 Y 1 A GLN 110 ? NE2 ? A GLN 130 NE2 51 1 Y 1 A LYS 117 ? CD ? A LYS 137 CD 52 1 Y 1 A LYS 117 ? CE ? A LYS 137 CE 53 1 Y 1 A LYS 117 ? NZ ? A LYS 137 NZ 54 1 Y 1 A LYS 121 ? CD ? A LYS 141 CD 55 1 Y 1 A LYS 121 ? CE ? A LYS 141 CE 56 1 Y 1 A LYS 121 ? NZ ? A LYS 141 NZ 57 1 Y 1 A LYS 127 ? CE ? A LYS 147 CE 58 1 Y 1 A LYS 127 ? NZ ? A LYS 147 NZ 59 1 Y 1 A LYS 128 ? CG ? A LYS 148 CG 60 1 Y 1 A LYS 128 ? CD ? A LYS 148 CD 61 1 Y 1 A LYS 128 ? CE ? A LYS 148 CE 62 1 Y 1 A LYS 128 ? NZ ? A LYS 148 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 101.160 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9R1L _cell.details ? _cell.formula_units_Z ? _cell.length_a 27.763 _cell.length_a_esd ? _cell.length_b 37.581 _cell.length_b_esd ? _cell.length_c 54.860 _cell.length_c_esd ? _cell.volume 56156.445 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9R1L _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9R1L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 26.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M SPG buffer pH 6.0, 25 % w/v PEG 1500' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X CdTe 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-03-28 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.6199 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.6199 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 35.35 _reflns.entry_id 9R1L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.85 _reflns.d_resolution_low 27.24 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9615 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.73 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.39 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.85 _reflns_shell.d_res_low 1.916 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.30 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 912 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.876 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.59 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.69 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9R1L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.85 _refine.ls_d_res_low 27.24 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9615 _refine.ls_number_reflns_R_free 437 _refine.ls_number_reflns_R_work 9181 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.48 _refine.ls_percent_reflns_R_free 4.54 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2063 _refine.ls_R_factor_R_free 0.2186 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2056 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.5070 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2183 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 27.24 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1012 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 973 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0038 ? 1009 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.5677 ? 1356 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0298 ? 150 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0022 ? 180 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 20.4032 ? 373 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.85 2.11 . . 137 3005 98.62 . . . . 0.2637 . . . . . . . . . . . . . . . 0.2941 'X-RAY DIFFRACTION' 2.11 2.66 . . 156 3044 99.94 . . . . 0.2272 . . . . . . . . . . . . . . . 0.2443 'X-RAY DIFFRACTION' 2.66 27.24 . . 144 3132 99.88 . . . . 0.1903 . . . . . . . . . . . . . . . 0.2008 # _struct.entry_id 9R1L _struct.title 'X-ray crystal structure of a de novo designed SN38 binder, sc-apCC-4-SN38-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9R1L _struct_keywords.text 'de novo, coiled-coil, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9R1L _struct_ref.pdbx_db_accession 9R1L _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9R1L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9R1L _struct_ref_seq.db_align_beg -19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -19 _struct_ref_seq.pdbx_auth_seq_align_end 131 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 830 ? 1 MORE 2 ? 1 'SSA (A^2)' 7060 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 19 ? GLY A 50 ? SER A -1 GLY A 30 1 ? 32 HELX_P HELX_P2 AA2 ALA A 54 ? GLY A 85 ? ALA A 34 GLY A 65 1 ? 32 HELX_P HELX_P3 AA3 ASP A 87 ? GLY A 119 ? ASP A 67 GLY A 99 1 ? 33 HELX_P HELX_P4 AA4 SER A 121 ? GLN A 151 ? SER A 101 GLN A 131 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9R1L _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -7.58591152368 -3.92838505977 12.2508063714 0.272660165939 ? -0.0498798481817 ? 0.0353844846809 ? 0.356788029018 ? 0.113725164837 ? 0.390421790123 ? 3.77841679654 ? -5.15006482799 ? 5.14778562019 ? 7.02048335839 ? -7.00686830215 ? 6.98444522566 ? -0.082535108437 ? -0.560712949002 ? -0.271912087203 ? -0.291166187373 ? 0.485833921371 ? 0.21404144958 ? 0.596935527838 ? -0.863253149665 ? -0.471755745567 ? 2 'X-RAY DIFFRACTION' ? refined -1.21616099667 -3.43600668553 7.56343843693 0.338443699588 ? 0.00189152455411 ? -0.00376343046415 ? 0.254132547062 ? 0.0230018549267 ? 0.326328054274 ? 1.76399668632 ? -3.86428462417 ? 2.88932028285 ? 8.50602403949 ? -6.36183915108 ? 4.7738384017 ? 0.178541893745 ? -0.0264300153592 ? -0.102500229719 ? -0.512129885687 ? -0.120203262511 ? -0.283461684059 ? 0.518955494582 ? 0.0421869772678 ? -0.153682751315 ? 3 'X-RAY DIFFRACTION' ? refined 1.48350298131 1.44646198052 16.547619883 0.22555962489 ? -0.0376694735339 ? 0.0169122231811 ? 0.173862143486 ? -0.0267401071702 ? 0.172638302476 ? 3.94700757482 ? -3.52200908097 ? 2.1089296006 ? 8.3736832293 ? -3.75639975424 ? 6.37702368998 ? -0.153358097932 ? -0.05562874274 ? 0.0226340014236 ? 0.554985973901 ? 0.199170692543 ? -0.245896506122 ? -0.546412357537 ? -0.308266383433 ? -0.0246856011853 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 2 A 0 ? A 32 A 30 ? ? ;chain 'A' and (resid 0 through 30 ) ; 2 'X-RAY DIFFRACTION' 2 A 33 A 31 ? A 66 A 64 ? ? ;chain 'A' and (resid 31 through 64 ) ; 3 'X-RAY DIFFRACTION' 3 A 67 A 65 ? A 133 A 131 ? ? ;chain 'A' and (resid 65 through 131 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 ETA CA C N N 74 ETA N N N N 75 ETA C C N N 76 ETA O O N N 77 ETA HA1 H N N 78 ETA HA2 H N N 79 ETA H H N N 80 ETA H2 H N N 81 ETA HB1 H N N 82 ETA HB2 H N N 83 ETA HO H N N 84 GLN N N N N 85 GLN CA C N S 86 GLN C C N N 87 GLN O O N N 88 GLN CB C N N 89 GLN CG C N N 90 GLN CD C N N 91 GLN OE1 O N N 92 GLN NE2 N N N 93 GLN OXT O N N 94 GLN H H N N 95 GLN H2 H N N 96 GLN HA H N N 97 GLN HB2 H N N 98 GLN HB3 H N N 99 GLN HG2 H N N 100 GLN HG3 H N N 101 GLN HE21 H N N 102 GLN HE22 H N N 103 GLN HXT H N N 104 GLU N N N N 105 GLU CA C N S 106 GLU C C N N 107 GLU O O N N 108 GLU CB C N N 109 GLU CG C N N 110 GLU CD C N N 111 GLU OE1 O N N 112 GLU OE2 O N N 113 GLU OXT O N N 114 GLU H H N N 115 GLU H2 H N N 116 GLU HA H N N 117 GLU HB2 H N N 118 GLU HB3 H N N 119 GLU HG2 H N N 120 GLU HG3 H N N 121 GLU HE2 H N N 122 GLU HXT H N N 123 GLY N N N N 124 GLY CA C N N 125 GLY C C N N 126 GLY O O N N 127 GLY OXT O N N 128 GLY H H N N 129 GLY H2 H N N 130 GLY HA2 H N N 131 GLY HA3 H N N 132 GLY HXT H N N 133 HIS N N N N 134 HIS CA C N S 135 HIS C C N N 136 HIS O O N N 137 HIS CB C N N 138 HIS CG C Y N 139 HIS ND1 N Y N 140 HIS CD2 C Y N 141 HIS CE1 C Y N 142 HIS NE2 N Y N 143 HIS OXT O N N 144 HIS H H N N 145 HIS H2 H N N 146 HIS HA H N N 147 HIS HB2 H N N 148 HIS HB3 H N N 149 HIS HD1 H N N 150 HIS HD2 H N N 151 HIS HE1 H N N 152 HIS HE2 H N N 153 HIS HXT H N N 154 HOH O O N N 155 HOH H1 H N N 156 HOH H2 H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PEG C1 C N N 247 PEG O1 O N N 248 PEG C2 C N N 249 PEG O2 O N N 250 PEG C3 C N N 251 PEG C4 C N N 252 PEG O4 O N N 253 PEG H11 H N N 254 PEG H12 H N N 255 PEG HO1 H N N 256 PEG H21 H N N 257 PEG H22 H N N 258 PEG H31 H N N 259 PEG H32 H N N 260 PEG H41 H N N 261 PEG H42 H N N 262 PEG HO4 H N N 263 PRO N N N N 264 PRO CA C N S 265 PRO C C N N 266 PRO O O N N 267 PRO CB C N N 268 PRO CG C N N 269 PRO CD C N N 270 PRO OXT O N N 271 PRO H H N N 272 PRO HA H N N 273 PRO HB2 H N N 274 PRO HB3 H N N 275 PRO HG2 H N N 276 PRO HG3 H N N 277 PRO HD2 H N N 278 PRO HD3 H N N 279 PRO HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 VAL N N N N 339 VAL CA C N S 340 VAL C C N N 341 VAL O O N N 342 VAL CB C N N 343 VAL CG1 C N N 344 VAL CG2 C N N 345 VAL OXT O N N 346 VAL H H N N 347 VAL H2 H N N 348 VAL HA H N N 349 VAL HB H N N 350 VAL HG11 H N N 351 VAL HG12 H N N 352 VAL HG13 H N N 353 VAL HG21 H N N 354 VAL HG22 H N N 355 VAL HG23 H N N 356 VAL HXT H N N 357 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 ETA CA N sing N N 70 ETA CA C sing N N 71 ETA CA HA1 sing N N 72 ETA CA HA2 sing N N 73 ETA N H sing N N 74 ETA N H2 sing N N 75 ETA C O sing N N 76 ETA C HB1 sing N N 77 ETA C HB2 sing N N 78 ETA O HO sing N N 79 GLN N CA sing N N 80 GLN N H sing N N 81 GLN N H2 sing N N 82 GLN CA C sing N N 83 GLN CA CB sing N N 84 GLN CA HA sing N N 85 GLN C O doub N N 86 GLN C OXT sing N N 87 GLN CB CG sing N N 88 GLN CB HB2 sing N N 89 GLN CB HB3 sing N N 90 GLN CG CD sing N N 91 GLN CG HG2 sing N N 92 GLN CG HG3 sing N N 93 GLN CD OE1 doub N N 94 GLN CD NE2 sing N N 95 GLN NE2 HE21 sing N N 96 GLN NE2 HE22 sing N N 97 GLN OXT HXT sing N N 98 GLU N CA sing N N 99 GLU N H sing N N 100 GLU N H2 sing N N 101 GLU CA C sing N N 102 GLU CA CB sing N N 103 GLU CA HA sing N N 104 GLU C O doub N N 105 GLU C OXT sing N N 106 GLU CB CG sing N N 107 GLU CB HB2 sing N N 108 GLU CB HB3 sing N N 109 GLU CG CD sing N N 110 GLU CG HG2 sing N N 111 GLU CG HG3 sing N N 112 GLU CD OE1 doub N N 113 GLU CD OE2 sing N N 114 GLU OE2 HE2 sing N N 115 GLU OXT HXT sing N N 116 GLY N CA sing N N 117 GLY N H sing N N 118 GLY N H2 sing N N 119 GLY CA C sing N N 120 GLY CA HA2 sing N N 121 GLY CA HA3 sing N N 122 GLY C O doub N N 123 GLY C OXT sing N N 124 GLY OXT HXT sing N N 125 HIS N CA sing N N 126 HIS N H sing N N 127 HIS N H2 sing N N 128 HIS CA C sing N N 129 HIS CA CB sing N N 130 HIS CA HA sing N N 131 HIS C O doub N N 132 HIS C OXT sing N N 133 HIS CB CG sing N N 134 HIS CB HB2 sing N N 135 HIS CB HB3 sing N N 136 HIS CG ND1 sing Y N 137 HIS CG CD2 doub Y N 138 HIS ND1 CE1 doub Y N 139 HIS ND1 HD1 sing N N 140 HIS CD2 NE2 sing Y N 141 HIS CD2 HD2 sing N N 142 HIS CE1 NE2 sing Y N 143 HIS CE1 HE1 sing N N 144 HIS NE2 HE2 sing N N 145 HIS OXT HXT sing N N 146 HOH O H1 sing N N 147 HOH O H2 sing N N 148 ILE N CA sing N N 149 ILE N H sing N N 150 ILE N H2 sing N N 151 ILE CA C sing N N 152 ILE CA CB sing N N 153 ILE CA HA sing N N 154 ILE C O doub N N 155 ILE C OXT sing N N 156 ILE CB CG1 sing N N 157 ILE CB CG2 sing N N 158 ILE CB HB sing N N 159 ILE CG1 CD1 sing N N 160 ILE CG1 HG12 sing N N 161 ILE CG1 HG13 sing N N 162 ILE CG2 HG21 sing N N 163 ILE CG2 HG22 sing N N 164 ILE CG2 HG23 sing N N 165 ILE CD1 HD11 sing N N 166 ILE CD1 HD12 sing N N 167 ILE CD1 HD13 sing N N 168 ILE OXT HXT sing N N 169 LEU N CA sing N N 170 LEU N H sing N N 171 LEU N H2 sing N N 172 LEU CA C sing N N 173 LEU CA CB sing N N 174 LEU CA HA sing N N 175 LEU C O doub N N 176 LEU C OXT sing N N 177 LEU CB CG sing N N 178 LEU CB HB2 sing N N 179 LEU CB HB3 sing N N 180 LEU CG CD1 sing N N 181 LEU CG CD2 sing N N 182 LEU CG HG sing N N 183 LEU CD1 HD11 sing N N 184 LEU CD1 HD12 sing N N 185 LEU CD1 HD13 sing N N 186 LEU CD2 HD21 sing N N 187 LEU CD2 HD22 sing N N 188 LEU CD2 HD23 sing N N 189 LEU OXT HXT sing N N 190 LYS N CA sing N N 191 LYS N H sing N N 192 LYS N H2 sing N N 193 LYS CA C sing N N 194 LYS CA CB sing N N 195 LYS CA HA sing N N 196 LYS C O doub N N 197 LYS C OXT sing N N 198 LYS CB CG sing N N 199 LYS CB HB2 sing N N 200 LYS CB HB3 sing N N 201 LYS CG CD sing N N 202 LYS CG HG2 sing N N 203 LYS CG HG3 sing N N 204 LYS CD CE sing N N 205 LYS CD HD2 sing N N 206 LYS CD HD3 sing N N 207 LYS CE NZ sing N N 208 LYS CE HE2 sing N N 209 LYS CE HE3 sing N N 210 LYS NZ HZ1 sing N N 211 LYS NZ HZ2 sing N N 212 LYS NZ HZ3 sing N N 213 LYS OXT HXT sing N N 214 MET N CA sing N N 215 MET N H sing N N 216 MET N H2 sing N N 217 MET CA C sing N N 218 MET CA CB sing N N 219 MET CA HA sing N N 220 MET C O doub N N 221 MET C OXT sing N N 222 MET CB CG sing N N 223 MET CB HB2 sing N N 224 MET CB HB3 sing N N 225 MET CG SD sing N N 226 MET CG HG2 sing N N 227 MET CG HG3 sing N N 228 MET SD CE sing N N 229 MET CE HE1 sing N N 230 MET CE HE2 sing N N 231 MET CE HE3 sing N N 232 MET OXT HXT sing N N 233 PEG C1 O1 sing N N 234 PEG C1 C2 sing N N 235 PEG C1 H11 sing N N 236 PEG C1 H12 sing N N 237 PEG O1 HO1 sing N N 238 PEG C2 O2 sing N N 239 PEG C2 H21 sing N N 240 PEG C2 H22 sing N N 241 PEG O2 C3 sing N N 242 PEG C3 C4 sing N N 243 PEG C3 H31 sing N N 244 PEG C3 H32 sing N N 245 PEG C4 O4 sing N N 246 PEG C4 H41 sing N N 247 PEG C4 H42 sing N N 248 PEG O4 HO4 sing N N 249 PRO N CA sing N N 250 PRO N CD sing N N 251 PRO N H sing N N 252 PRO CA C sing N N 253 PRO CA CB sing N N 254 PRO CA HA sing N N 255 PRO C O doub N N 256 PRO C OXT sing N N 257 PRO CB CG sing N N 258 PRO CB HB2 sing N N 259 PRO CB HB3 sing N N 260 PRO CG CD sing N N 261 PRO CG HG2 sing N N 262 PRO CG HG3 sing N N 263 PRO CD HD2 sing N N 264 PRO CD HD3 sing N N 265 PRO OXT HXT sing N N 266 SER N CA sing N N 267 SER N H sing N N 268 SER N H2 sing N N 269 SER CA C sing N N 270 SER CA CB sing N N 271 SER CA HA sing N N 272 SER C O doub N N 273 SER C OXT sing N N 274 SER CB OG sing N N 275 SER CB HB2 sing N N 276 SER CB HB3 sing N N 277 SER OG HG sing N N 278 SER OXT HXT sing N N 279 THR N CA sing N N 280 THR N H sing N N 281 THR N H2 sing N N 282 THR CA C sing N N 283 THR CA CB sing N N 284 THR CA HA sing N N 285 THR C O doub N N 286 THR C OXT sing N N 287 THR CB OG1 sing N N 288 THR CB CG2 sing N N 289 THR CB HB sing N N 290 THR OG1 HG1 sing N N 291 THR CG2 HG21 sing N N 292 THR CG2 HG22 sing N N 293 THR CG2 HG23 sing N N 294 THR OXT HXT sing N N 295 TRP N CA sing N N 296 TRP N H sing N N 297 TRP N H2 sing N N 298 TRP CA C sing N N 299 TRP CA CB sing N N 300 TRP CA HA sing N N 301 TRP C O doub N N 302 TRP C OXT sing N N 303 TRP CB CG sing N N 304 TRP CB HB2 sing N N 305 TRP CB HB3 sing N N 306 TRP CG CD1 doub Y N 307 TRP CG CD2 sing Y N 308 TRP CD1 NE1 sing Y N 309 TRP CD1 HD1 sing N N 310 TRP CD2 CE2 doub Y N 311 TRP CD2 CE3 sing Y N 312 TRP NE1 CE2 sing Y N 313 TRP NE1 HE1 sing N N 314 TRP CE2 CZ2 sing Y N 315 TRP CE3 CZ3 doub Y N 316 TRP CE3 HE3 sing N N 317 TRP CZ2 CH2 doub Y N 318 TRP CZ2 HZ2 sing N N 319 TRP CZ3 CH2 sing Y N 320 TRP CZ3 HZ3 sing N N 321 TRP CH2 HH2 sing N N 322 TRP OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9R1L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.036019 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007106 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026609 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018580 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #