data_9R1N # _entry.id 9R1N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9R1N pdb_00009r1n 10.2210/pdb9r1n/pdb WWPDB D_1292147395 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-06 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9R1N _pdbx_database_status.recvd_initial_deposition_date 2025-04-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email d.n.woolfson@bristol.ac.uk _pdbx_contact_author.name_first Derek _pdbx_contact_author.name_last Woolfson _pdbx_contact_author.name_mi N. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0394-3202 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Petrenas, R.' 1 0000-0002-2997-7187 'Ozga, K.' 2 0000-0002-2837-283X 'Chubb, J.J.' 3 0009-0006-2256-7640 'Woolfson, D.N.' 4 0000-0002-0394-3202 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'X-ray crystal structure of a de novo designed 1,6-diphenylhexatriene binder, sc-apCC-4-DPH-2' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Petrenas, R.' 1 0000-0002-2997-7187 primary 'Ozga, K.' 2 0000-0002-2837-283X primary 'Chubb, J.J.' 3 0009-0006-2256-7640 primary 'Woolfson, D.N.' 4 0000-0002-0394-3202 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man sc-apCC-4-DPH-2 16621.941 1 ? ? ? ? 2 non-polymer syn 'PENTAETHYLENE GLYCOL' 238.278 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 water nat water 18.015 8 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMQLEEIAQQIEEIAKQVKKIAWQLKKIAQGEPSAQGQLEEIAQQIEEIAKQVKKIAWQLK KIAQGPDSVQLEEIAQQGEEAAKQAKKIAQQLKKIAQGGTSGGQLEEIAQQGEEAAKQAKKIAQQLKKIAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMQLEEIAQQIEEIAKQVKKIAWQLKKIAQGEPSAQGQLEEIAQQIEEIAKQVKKIAWQLK KIAQGPDSVQLEEIAQQGEEAAKQAKKIAQQLKKIAQGGTSGGQLEEIAQQGEEAAKQAKKIAQQLKKIAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PENTAETHYLENE GLYCOL' 1PE 3 GLYCEROL GOL 4 1,2-ETHANEDIOL EDO 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLN n 1 23 LEU n 1 24 GLU n 1 25 GLU n 1 26 ILE n 1 27 ALA n 1 28 GLN n 1 29 GLN n 1 30 ILE n 1 31 GLU n 1 32 GLU n 1 33 ILE n 1 34 ALA n 1 35 LYS n 1 36 GLN n 1 37 VAL n 1 38 LYS n 1 39 LYS n 1 40 ILE n 1 41 ALA n 1 42 TRP n 1 43 GLN n 1 44 LEU n 1 45 LYS n 1 46 LYS n 1 47 ILE n 1 48 ALA n 1 49 GLN n 1 50 GLY n 1 51 GLU n 1 52 PRO n 1 53 SER n 1 54 ALA n 1 55 GLN n 1 56 GLY n 1 57 GLN n 1 58 LEU n 1 59 GLU n 1 60 GLU n 1 61 ILE n 1 62 ALA n 1 63 GLN n 1 64 GLN n 1 65 ILE n 1 66 GLU n 1 67 GLU n 1 68 ILE n 1 69 ALA n 1 70 LYS n 1 71 GLN n 1 72 VAL n 1 73 LYS n 1 74 LYS n 1 75 ILE n 1 76 ALA n 1 77 TRP n 1 78 GLN n 1 79 LEU n 1 80 LYS n 1 81 LYS n 1 82 ILE n 1 83 ALA n 1 84 GLN n 1 85 GLY n 1 86 PRO n 1 87 ASP n 1 88 SER n 1 89 VAL n 1 90 GLN n 1 91 LEU n 1 92 GLU n 1 93 GLU n 1 94 ILE n 1 95 ALA n 1 96 GLN n 1 97 GLN n 1 98 GLY n 1 99 GLU n 1 100 GLU n 1 101 ALA n 1 102 ALA n 1 103 LYS n 1 104 GLN n 1 105 ALA n 1 106 LYS n 1 107 LYS n 1 108 ILE n 1 109 ALA n 1 110 GLN n 1 111 GLN n 1 112 LEU n 1 113 LYS n 1 114 LYS n 1 115 ILE n 1 116 ALA n 1 117 GLN n 1 118 GLY n 1 119 GLY n 1 120 THR n 1 121 SER n 1 122 GLY n 1 123 GLY n 1 124 GLN n 1 125 LEU n 1 126 GLU n 1 127 GLU n 1 128 ILE n 1 129 ALA n 1 130 GLN n 1 131 GLN n 1 132 GLY n 1 133 GLU n 1 134 GLU n 1 135 ALA n 1 136 ALA n 1 137 LYS n 1 138 GLN n 1 139 ALA n 1 140 LYS n 1 141 LYS n 1 142 ILE n 1 143 ALA n 1 144 GLN n 1 145 GLN n 1 146 LEU n 1 147 LYS n 1 148 LYS n 1 149 ILE n 1 150 ALA n 1 151 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 151 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1PE non-polymer . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6' 238.278 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 GLY 2 -19 ? ? ? A . n A 1 3 SER 3 -18 ? ? ? A . n A 1 4 SER 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 HIS 9 -12 ? ? ? A . n A 1 10 HIS 10 -11 ? ? ? A . n A 1 11 SER 11 -10 ? ? ? A . n A 1 12 SER 12 -9 ? ? ? A . n A 1 13 GLY 13 -8 ? ? ? A . n A 1 14 LEU 14 -7 ? ? ? A . n A 1 15 VAL 15 -6 ? ? ? A . n A 1 16 PRO 16 -5 ? ? ? A . n A 1 17 ARG 17 -4 ? ? ? A . n A 1 18 GLY 18 -3 ? ? ? A . n A 1 19 SER 19 -2 -2 SER SER A . n A 1 20 HIS 20 -1 -1 HIS HIS A . n A 1 21 MET 21 0 0 MET MET A . n A 1 22 GLN 22 1 1 GLN GLN A . n A 1 23 LEU 23 2 2 LEU LEU A . n A 1 24 GLU 24 3 3 GLU GLU A . n A 1 25 GLU 25 4 4 GLU GLU A . n A 1 26 ILE 26 5 5 ILE ILE A . n A 1 27 ALA 27 6 6 ALA ALA A . n A 1 28 GLN 28 7 7 GLN GLN A . n A 1 29 GLN 29 8 8 GLN GLN A . n A 1 30 ILE 30 9 9 ILE ILE A . n A 1 31 GLU 31 10 10 GLU GLU A . n A 1 32 GLU 32 11 11 GLU GLU A . n A 1 33 ILE 33 12 12 ILE ILE A . n A 1 34 ALA 34 13 13 ALA ALA A . n A 1 35 LYS 35 14 14 LYS LYS A . n A 1 36 GLN 36 15 15 GLN GLN A . n A 1 37 VAL 37 16 16 VAL VAL A . n A 1 38 LYS 38 17 17 LYS LYS A . n A 1 39 LYS 39 18 18 LYS LYS A . n A 1 40 ILE 40 19 19 ILE ILE A . n A 1 41 ALA 41 20 20 ALA ALA A . n A 1 42 TRP 42 21 21 TRP TRP A . n A 1 43 GLN 43 22 22 GLN GLN A . n A 1 44 LEU 44 23 23 LEU LEU A . n A 1 45 LYS 45 24 24 LYS LYS A . n A 1 46 LYS 46 25 25 LYS LYS A . n A 1 47 ILE 47 26 26 ILE ILE A . n A 1 48 ALA 48 27 27 ALA ALA A . n A 1 49 GLN 49 28 28 GLN GLN A . n A 1 50 GLY 50 29 29 GLY GLY A . n A 1 51 GLU 51 30 30 GLU GLU A . n A 1 52 PRO 52 31 31 PRO PRO A . n A 1 53 SER 53 32 32 SER SER A . n A 1 54 ALA 54 33 33 ALA ALA A . n A 1 55 GLN 55 34 34 GLN GLN A . n A 1 56 GLY 56 35 35 GLY GLY A . n A 1 57 GLN 57 36 36 GLN GLN A . n A 1 58 LEU 58 37 37 LEU LEU A . n A 1 59 GLU 59 38 38 GLU GLU A . n A 1 60 GLU 60 39 39 GLU GLU A . n A 1 61 ILE 61 40 40 ILE ILE A . n A 1 62 ALA 62 41 41 ALA ALA A . n A 1 63 GLN 63 42 42 GLN GLN A . n A 1 64 GLN 64 43 43 GLN GLN A . n A 1 65 ILE 65 44 44 ILE ILE A . n A 1 66 GLU 66 45 45 GLU GLU A . n A 1 67 GLU 67 46 46 GLU GLU A . n A 1 68 ILE 68 47 47 ILE ILE A . n A 1 69 ALA 69 48 48 ALA ALA A . n A 1 70 LYS 70 49 49 LYS LYS A . n A 1 71 GLN 71 50 50 GLN GLN A . n A 1 72 VAL 72 51 51 VAL VAL A . n A 1 73 LYS 73 52 52 LYS LYS A . n A 1 74 LYS 74 53 53 LYS LYS A . n A 1 75 ILE 75 54 54 ILE ILE A . n A 1 76 ALA 76 55 55 ALA ALA A . n A 1 77 TRP 77 56 56 TRP TRP A . n A 1 78 GLN 78 57 57 GLN GLN A . n A 1 79 LEU 79 58 58 LEU LEU A . n A 1 80 LYS 80 59 59 LYS LYS A . n A 1 81 LYS 81 60 60 LYS LYS A . n A 1 82 ILE 82 61 61 ILE ILE A . n A 1 83 ALA 83 62 62 ALA ALA A . n A 1 84 GLN 84 63 63 GLN GLN A . n A 1 85 GLY 85 64 64 GLY GLY A . n A 1 86 PRO 86 65 65 PRO PRO A . n A 1 87 ASP 87 66 66 ASP ASP A . n A 1 88 SER 88 67 67 SER SER A . n A 1 89 VAL 89 68 68 VAL VAL A . n A 1 90 GLN 90 69 69 GLN GLN A . n A 1 91 LEU 91 70 70 LEU LEU A . n A 1 92 GLU 92 71 71 GLU GLU A . n A 1 93 GLU 93 72 72 GLU GLU A . n A 1 94 ILE 94 73 73 ILE ILE A . n A 1 95 ALA 95 74 74 ALA ALA A . n A 1 96 GLN 96 75 75 GLN GLN A . n A 1 97 GLN 97 76 76 GLN GLN A . n A 1 98 GLY 98 77 77 GLY GLY A . n A 1 99 GLU 99 78 78 GLU GLU A . n A 1 100 GLU 100 79 79 GLU GLU A . n A 1 101 ALA 101 80 80 ALA ALA A . n A 1 102 ALA 102 81 81 ALA ALA A . n A 1 103 LYS 103 82 82 LYS LYS A . n A 1 104 GLN 104 83 83 GLN GLN A . n A 1 105 ALA 105 84 84 ALA ALA A . n A 1 106 LYS 106 85 85 LYS LYS A . n A 1 107 LYS 107 86 86 LYS LYS A . n A 1 108 ILE 108 87 87 ILE ILE A . n A 1 109 ALA 109 88 88 ALA ALA A . n A 1 110 GLN 110 89 89 GLN GLN A . n A 1 111 GLN 111 90 90 GLN GLN A . n A 1 112 LEU 112 91 91 LEU LEU A . n A 1 113 LYS 113 92 92 LYS LYS A . n A 1 114 LYS 114 93 93 LYS LYS A . n A 1 115 ILE 115 94 94 ILE ILE A . n A 1 116 ALA 116 95 95 ALA ALA A . n A 1 117 GLN 117 96 96 GLN GLN A . n A 1 118 GLY 118 97 97 GLY GLY A . n A 1 119 GLY 119 98 98 GLY GLY A . n A 1 120 THR 120 99 99 THR THR A . n A 1 121 SER 121 100 100 SER SER A . n A 1 122 GLY 122 101 101 GLY GLY A . n A 1 123 GLY 123 102 102 GLY GLY A . n A 1 124 GLN 124 103 103 GLN GLN A . n A 1 125 LEU 125 104 104 LEU LEU A . n A 1 126 GLU 126 105 105 GLU GLU A . n A 1 127 GLU 127 106 106 GLU GLU A . n A 1 128 ILE 128 107 107 ILE ILE A . n A 1 129 ALA 129 108 108 ALA ALA A . n A 1 130 GLN 130 109 109 GLN GLN A . n A 1 131 GLN 131 110 110 GLN GLN A . n A 1 132 GLY 132 111 111 GLY GLY A . n A 1 133 GLU 133 112 112 GLU GLU A . n A 1 134 GLU 134 113 113 GLU GLU A . n A 1 135 ALA 135 114 114 ALA ALA A . n A 1 136 ALA 136 115 115 ALA ALA A . n A 1 137 LYS 137 116 116 LYS LYS A . n A 1 138 GLN 138 117 117 GLN GLN A . n A 1 139 ALA 139 118 118 ALA ALA A . n A 1 140 LYS 140 119 119 LYS LYS A . n A 1 141 LYS 141 120 120 LYS LYS A . n A 1 142 ILE 142 121 121 ILE ILE A . n A 1 143 ALA 143 122 122 ALA ALA A . n A 1 144 GLN 144 123 123 GLN GLN A . n A 1 145 GLN 145 124 124 GLN GLN A . n A 1 146 LEU 146 125 125 LEU LEU A . n A 1 147 LYS 147 126 126 LYS LYS A . n A 1 148 LYS 148 127 127 LYS LYS A . n A 1 149 ILE 149 128 128 ILE ILE A . n A 1 150 ALA 150 129 129 ALA ALA A . n A 1 151 GLN 151 130 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 1PE 1 201 201 1PE 1PE A . C 3 GOL 1 202 301 GOL GOL A . D 4 EDO 1 203 401 EDO EDO A . E 5 HOH 1 301 3 HOH HOH A . E 5 HOH 2 302 2 HOH HOH A . E 5 HOH 3 303 1 HOH HOH A . E 5 HOH 4 304 9 HOH HOH A . E 5 HOH 5 305 5 HOH HOH A . E 5 HOH 6 306 4 HOH HOH A . E 5 HOH 7 307 8 HOH HOH A . E 5 HOH 8 308 6 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 7 ? CD ? A GLN 28 CD 2 1 Y 1 A GLN 7 ? OE1 ? A GLN 28 OE1 3 1 Y 1 A GLN 7 ? NE2 ? A GLN 28 NE2 4 1 Y 1 A GLU 11 ? CD ? A GLU 32 CD 5 1 Y 1 A GLU 11 ? OE1 ? A GLU 32 OE1 6 1 Y 1 A GLU 11 ? OE2 ? A GLU 32 OE2 7 1 Y 1 A LYS 14 ? CG ? A LYS 35 CG 8 1 Y 1 A LYS 14 ? CD ? A LYS 35 CD 9 1 Y 1 A LYS 14 ? CE ? A LYS 35 CE 10 1 Y 1 A LYS 14 ? NZ ? A LYS 35 NZ 11 1 Y 1 A LYS 17 ? CE ? A LYS 38 CE 12 1 Y 1 A LYS 17 ? NZ ? A LYS 38 NZ 13 1 Y 1 A SER 32 ? OG ? A SER 53 OG 14 1 Y 1 A GLN 34 ? CG ? A GLN 55 CG 15 1 Y 1 A GLN 34 ? CD ? A GLN 55 CD 16 1 Y 1 A GLN 34 ? OE1 ? A GLN 55 OE1 17 1 Y 1 A GLN 34 ? NE2 ? A GLN 55 NE2 18 1 Y 1 A GLU 38 ? CD ? A GLU 59 CD 19 1 Y 1 A GLU 38 ? OE1 ? A GLU 59 OE1 20 1 Y 1 A GLU 38 ? OE2 ? A GLU 59 OE2 21 1 Y 1 A GLU 39 ? CG ? A GLU 60 CG 22 1 Y 1 A GLU 39 ? CD ? A GLU 60 CD 23 1 Y 1 A GLU 39 ? OE1 ? A GLU 60 OE1 24 1 Y 1 A GLU 39 ? OE2 ? A GLU 60 OE2 25 1 Y 1 A GLN 42 ? CD ? A GLN 63 CD 26 1 Y 1 A GLN 42 ? OE1 ? A GLN 63 OE1 27 1 Y 1 A GLN 42 ? NE2 ? A GLN 63 NE2 28 1 Y 1 A GLU 46 ? CG ? A GLU 67 CG 29 1 Y 1 A GLU 46 ? CD ? A GLU 67 CD 30 1 Y 1 A GLU 46 ? OE1 ? A GLU 67 OE1 31 1 Y 1 A GLU 46 ? OE2 ? A GLU 67 OE2 32 1 Y 1 A LYS 49 ? CE ? A LYS 70 CE 33 1 Y 1 A LYS 49 ? NZ ? A LYS 70 NZ 34 1 Y 1 A GLN 50 ? CD ? A GLN 71 CD 35 1 Y 1 A GLN 50 ? OE1 ? A GLN 71 OE1 36 1 Y 1 A GLN 50 ? NE2 ? A GLN 71 NE2 37 1 Y 1 A LYS 52 ? CE ? A LYS 73 CE 38 1 Y 1 A LYS 52 ? NZ ? A LYS 73 NZ 39 1 Y 1 A LYS 53 ? CD ? A LYS 74 CD 40 1 Y 1 A LYS 53 ? CE ? A LYS 74 CE 41 1 Y 1 A LYS 53 ? NZ ? A LYS 74 NZ 42 1 Y 1 A GLN 57 ? CD ? A GLN 78 CD 43 1 Y 1 A GLN 57 ? OE1 ? A GLN 78 OE1 44 1 Y 1 A GLN 57 ? NE2 ? A GLN 78 NE2 45 1 Y 1 A GLN 69 ? CG ? A GLN 90 CG 46 1 Y 1 A GLN 69 ? CD ? A GLN 90 CD 47 1 Y 1 A GLN 69 ? OE1 ? A GLN 90 OE1 48 1 Y 1 A GLN 69 ? NE2 ? A GLN 90 NE2 49 1 Y 1 A GLU 79 ? CD ? A GLU 100 CD 50 1 Y 1 A GLU 79 ? OE1 ? A GLU 100 OE1 51 1 Y 1 A GLU 79 ? OE2 ? A GLU 100 OE2 52 1 Y 1 A LYS 82 ? CD ? A LYS 103 CD 53 1 Y 1 A LYS 82 ? CE ? A LYS 103 CE 54 1 Y 1 A LYS 82 ? NZ ? A LYS 103 NZ 55 1 Y 1 A LYS 85 ? CD ? A LYS 106 CD 56 1 Y 1 A LYS 85 ? CE ? A LYS 106 CE 57 1 Y 1 A LYS 85 ? NZ ? A LYS 106 NZ 58 1 Y 1 A LYS 86 ? CD ? A LYS 107 CD 59 1 Y 1 A LYS 86 ? CE ? A LYS 107 CE 60 1 Y 1 A LYS 86 ? NZ ? A LYS 107 NZ 61 1 Y 1 A GLN 117 ? CD ? A GLN 138 CD 62 1 Y 1 A GLN 117 ? OE1 ? A GLN 138 OE1 63 1 Y 1 A GLN 117 ? NE2 ? A GLN 138 NE2 64 1 Y 1 A LYS 119 ? CG ? A LYS 140 CG 65 1 Y 1 A LYS 119 ? CD ? A LYS 140 CD 66 1 Y 1 A LYS 119 ? CE ? A LYS 140 CE 67 1 Y 1 A LYS 119 ? NZ ? A LYS 140 NZ 68 1 Y 1 A LYS 120 ? CE ? A LYS 141 CE 69 1 Y 1 A LYS 120 ? NZ ? A LYS 141 NZ 70 1 Y 1 A GLN 123 ? CG ? A GLN 144 CG 71 1 Y 1 A GLN 123 ? CD ? A GLN 144 CD 72 1 Y 1 A GLN 123 ? OE1 ? A GLN 144 OE1 73 1 Y 1 A GLN 123 ? NE2 ? A GLN 144 NE2 74 1 Y 1 A LYS 127 ? CG ? A LYS 148 CG 75 1 Y 1 A LYS 127 ? CD ? A LYS 148 CD 76 1 Y 1 A LYS 127 ? CE ? A LYS 148 CE 77 1 Y 1 A LYS 127 ? NZ ? A LYS 148 NZ 78 1 N 1 A 1PE 201 ? OH2 ? B 1PE 1 OH2 79 1 N 1 A 1PE 201 ? C12 ? B 1PE 1 C12 80 1 N 1 A 1PE 201 ? C22 ? B 1PE 1 C22 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9R1N _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.100 _cell.length_a_esd ? _cell.length_b 68.100 _cell.length_b_esd ? _cell.length_c 120.793 _cell.length_c_esd ? _cell.volume 485143.760 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9R1N _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall 'P 65 2 (x,y,z+1/12)' _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9R1N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.17 M Ammonium sulfate, 25.5% w/v Polyethylene glycol 4,000, 15% v/v Glycerol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X CdTe 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-05-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.6199 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.6199 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 52.29 _reflns.entry_id 9R1N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 42.2 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6975 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.89 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 91.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.12 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.486 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.89 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 674 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.895 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 61.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9R1N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 42.20 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6969 _refine.ls_number_reflns_R_free 345 _refine.ls_number_reflns_R_work 6624 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2374 _refine.ls_R_factor_R_free 0.2428 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2371 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.3058 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2533 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 42.20 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 974 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 943 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0029 ? 969 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.4566 ? 1295 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0318 ? 151 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0032 ? 167 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 21.7244 ? 359 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.40 3.02 . . 174 3205 99.94 . . . . 0.2326 . . . . . . . . . . . . . . . 0.2590 'X-RAY DIFFRACTION' 3.02 42.20 . . 171 3419 99.89 . . . . 0.2384 . . . . . . . . . . . . . . . 0.2379 # _struct.entry_id 9R1N _struct.title 'X-ray crystal structure of a de novo designed 1,6-diphenylhexatriene binder, sc-apCC-4-DPH-2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9R1N _struct_keywords.text 'de novo, coiled-coil, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9R1N _struct_ref.pdbx_db_accession 9R1N _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9R1N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9R1N _struct_ref_seq.db_align_beg -20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -20 _struct_ref_seq.pdbx_auth_seq_align_end 130 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7240 ? 1 MORE -47 ? 1 'SSA (A^2)' 13210 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_554 y,x,-z-1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -40.2643333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 19 ? GLN A 49 ? SER A -2 GLN A 28 1 ? 31 HELX_P HELX_P2 AA2 GLY A 56 ? ALA A 83 ? GLY A 35 ALA A 62 1 ? 28 HELX_P HELX_P3 AA3 ASP A 87 ? GLY A 118 ? ASP A 66 GLY A 97 1 ? 32 HELX_P HELX_P4 AA4 SER A 121 ? ALA A 150 ? SER A 100 ALA A 129 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9R1N _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 31 ? ? -36.16 118.49 2 1 GLN A 34 ? ? 80.65 115.22 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -6.73584748359 -18.1987025276 3.89703304675 0.502730874301 ? 0.0598413403297 ? 0.0870254661425 ? 0.595827282524 ? -0.139301519959 ? 0.616097456359 ? 3.77862562464 ? -1.26623382026 ? 5.00384667577 ? 3.55596257143 ? -0.123499530036 ? 7.53812961096 ? -0.640711921985 ? -0.440547082977 ? 1.56242953772 ? 0.250417138308 ? -0.175604821998 ? 0.0758966327635 ? -1.20346840817 ? -0.424416106112 ? 0.706727513232 ? 2 'X-RAY DIFFRACTION' ? refined -21.0547502367 -16.8991532519 -13.0688124615 0.759908078541 ? 0.248968775844 ? -0.0729036492956 ? 1.02956308963 ? -0.122932842326 ? 1.1118247861 ? 4.96945320773 ? -1.30150443705 ? -3.31289606815 ? 2.54556162689 ? 1.83882896381 ? 2.98207758819 ? 0.95875660793 ? -1.39396801979 ? 2.47836453162 ? 0.217738114916 ? -0.383748416011 ? 1.02142788929 ? -0.820197618346 ? -1.06747329975 ? -0.324573241158 ? 3 'X-RAY DIFFRACTION' ? refined 0.864314090149 -25.6017908801 -0.420262775685 0.286562341163 ? -0.0158721452345 ? 0.0605983698775 ? 0.608881659148 ? -0.0162816342941 ? 0.513038052428 ? 4.54078155649 ? -1.00978618615 ? 3.03202712403 ? 1.42368443314 ? -1.30319095905 ? 6.8004946091 ? 0.138160326892 ? -0.0414519853803 ? 0.327280995981 ? -0.0378167750602 ? -0.28157976724 ? -0.331280587323 ? 0.037119954055 ? 0.62565830684 ? 0.116981479792 ? 4 'X-RAY DIFFRACTION' ? refined -17.5374346834 -22.5410096525 -41.4281164637 0.548437346852 ? 0.156476509384 ? 0.0823394827305 ? 0.545140509123 ? -0.0696995923 ? 0.568212212531 ? 1.38028272571 ? -2.3298509863 ? 1.81842464819 ? 4.91847911243 ? -3.18442237267 ? 9.68124056469 ? 0.357302777671 ? 0.360255838864 ? -0.0146572473867 ? -0.701746005353 ? -0.412829421905 ? -0.0991493560284 ? 0.434315847939 ? 0.136068425171 ? 0.0218042364393 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A -2 ? A 30 A 27 ? ? ;chain 'A' and (resid -2 through 27 ) ; 2 'X-RAY DIFFRACTION' 2 A 31 A 28 ? A 38 A 35 ? ? ;chain 'A' and (resid 28 through 35 ) ; 3 'X-RAY DIFFRACTION' 3 A 39 A 36 ? A 98 A 95 ? ? ;chain 'A' and (resid 36 through 95 ) ; 4 'X-RAY DIFFRACTION' 4 A 99 A 96 ? A 132 A 129 ? ? ;chain 'A' and (resid 96 through 129 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A GLY -19 ? A GLY 2 3 1 Y 1 A SER -18 ? A SER 3 4 1 Y 1 A SER -17 ? A SER 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A HIS -12 ? A HIS 9 10 1 Y 1 A HIS -11 ? A HIS 10 11 1 Y 1 A SER -10 ? A SER 11 12 1 Y 1 A SER -9 ? A SER 12 13 1 Y 1 A GLY -8 ? A GLY 13 14 1 Y 1 A LEU -7 ? A LEU 14 15 1 Y 1 A VAL -6 ? A VAL 15 16 1 Y 1 A PRO -5 ? A PRO 16 17 1 Y 1 A ARG -4 ? A ARG 17 18 1 Y 1 A GLY -3 ? A GLY 18 19 1 Y 1 A GLN 130 ? A GLN 151 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1PE OH2 O N N 1 1PE C12 C N N 2 1PE C22 C N N 3 1PE OH3 O N N 4 1PE C13 C N N 5 1PE C23 C N N 6 1PE OH4 O N N 7 1PE C14 C N N 8 1PE C24 C N N 9 1PE OH5 O N N 10 1PE C15 C N N 11 1PE C25 C N N 12 1PE OH6 O N N 13 1PE C16 C N N 14 1PE C26 C N N 15 1PE OH7 O N N 16 1PE HO2 H N N 17 1PE H121 H N N 18 1PE H122 H N N 19 1PE H221 H N N 20 1PE H222 H N N 21 1PE H131 H N N 22 1PE H132 H N N 23 1PE H231 H N N 24 1PE H232 H N N 25 1PE H141 H N N 26 1PE H142 H N N 27 1PE H241 H N N 28 1PE H242 H N N 29 1PE H151 H N N 30 1PE H152 H N N 31 1PE H251 H N N 32 1PE H252 H N N 33 1PE H161 H N N 34 1PE H162 H N N 35 1PE H261 H N N 36 1PE H262 H N N 37 1PE HO7 H N N 38 ALA N N N N 39 ALA CA C N S 40 ALA C C N N 41 ALA O O N N 42 ALA CB C N N 43 ALA OXT O N N 44 ALA H H N N 45 ALA H2 H N N 46 ALA HA H N N 47 ALA HB1 H N N 48 ALA HB2 H N N 49 ALA HB3 H N N 50 ALA HXT H N N 51 ARG N N N N 52 ARG CA C N S 53 ARG C C N N 54 ARG O O N N 55 ARG CB C N N 56 ARG CG C N N 57 ARG CD C N N 58 ARG NE N N N 59 ARG CZ C N N 60 ARG NH1 N N N 61 ARG NH2 N N N 62 ARG OXT O N N 63 ARG H H N N 64 ARG H2 H N N 65 ARG HA H N N 66 ARG HB2 H N N 67 ARG HB3 H N N 68 ARG HG2 H N N 69 ARG HG3 H N N 70 ARG HD2 H N N 71 ARG HD3 H N N 72 ARG HE H N N 73 ARG HH11 H N N 74 ARG HH12 H N N 75 ARG HH21 H N N 76 ARG HH22 H N N 77 ARG HXT H N N 78 ASP N N N N 79 ASP CA C N S 80 ASP C C N N 81 ASP O O N N 82 ASP CB C N N 83 ASP CG C N N 84 ASP OD1 O N N 85 ASP OD2 O N N 86 ASP OXT O N N 87 ASP H H N N 88 ASP H2 H N N 89 ASP HA H N N 90 ASP HB2 H N N 91 ASP HB3 H N N 92 ASP HD2 H N N 93 ASP HXT H N N 94 EDO C1 C N N 95 EDO O1 O N N 96 EDO C2 C N N 97 EDO O2 O N N 98 EDO H11 H N N 99 EDO H12 H N N 100 EDO HO1 H N N 101 EDO H21 H N N 102 EDO H22 H N N 103 EDO HO2 H N N 104 GLN N N N N 105 GLN CA C N S 106 GLN C C N N 107 GLN O O N N 108 GLN CB C N N 109 GLN CG C N N 110 GLN CD C N N 111 GLN OE1 O N N 112 GLN NE2 N N N 113 GLN OXT O N N 114 GLN H H N N 115 GLN H2 H N N 116 GLN HA H N N 117 GLN HB2 H N N 118 GLN HB3 H N N 119 GLN HG2 H N N 120 GLN HG3 H N N 121 GLN HE21 H N N 122 GLN HE22 H N N 123 GLN HXT H N N 124 GLU N N N N 125 GLU CA C N S 126 GLU C C N N 127 GLU O O N N 128 GLU CB C N N 129 GLU CG C N N 130 GLU CD C N N 131 GLU OE1 O N N 132 GLU OE2 O N N 133 GLU OXT O N N 134 GLU H H N N 135 GLU H2 H N N 136 GLU HA H N N 137 GLU HB2 H N N 138 GLU HB3 H N N 139 GLU HG2 H N N 140 GLU HG3 H N N 141 GLU HE2 H N N 142 GLU HXT H N N 143 GLY N N N N 144 GLY CA C N N 145 GLY C C N N 146 GLY O O N N 147 GLY OXT O N N 148 GLY H H N N 149 GLY H2 H N N 150 GLY HA2 H N N 151 GLY HA3 H N N 152 GLY HXT H N N 153 GOL C1 C N N 154 GOL O1 O N N 155 GOL C2 C N N 156 GOL O2 O N N 157 GOL C3 C N N 158 GOL O3 O N N 159 GOL H11 H N N 160 GOL H12 H N N 161 GOL HO1 H N N 162 GOL H2 H N N 163 GOL HO2 H N N 164 GOL H31 H N N 165 GOL H32 H N N 166 GOL HO3 H N N 167 HIS N N N N 168 HIS CA C N S 169 HIS C C N N 170 HIS O O N N 171 HIS CB C N N 172 HIS CG C Y N 173 HIS ND1 N Y N 174 HIS CD2 C Y N 175 HIS CE1 C Y N 176 HIS NE2 N Y N 177 HIS OXT O N N 178 HIS H H N N 179 HIS H2 H N N 180 HIS HA H N N 181 HIS HB2 H N N 182 HIS HB3 H N N 183 HIS HD1 H N N 184 HIS HD2 H N N 185 HIS HE1 H N N 186 HIS HE2 H N N 187 HIS HXT H N N 188 HOH O O N N 189 HOH H1 H N N 190 HOH H2 H N N 191 ILE N N N N 192 ILE CA C N S 193 ILE C C N N 194 ILE O O N N 195 ILE CB C N S 196 ILE CG1 C N N 197 ILE CG2 C N N 198 ILE CD1 C N N 199 ILE OXT O N N 200 ILE H H N N 201 ILE H2 H N N 202 ILE HA H N N 203 ILE HB H N N 204 ILE HG12 H N N 205 ILE HG13 H N N 206 ILE HG21 H N N 207 ILE HG22 H N N 208 ILE HG23 H N N 209 ILE HD11 H N N 210 ILE HD12 H N N 211 ILE HD13 H N N 212 ILE HXT H N N 213 LEU N N N N 214 LEU CA C N S 215 LEU C C N N 216 LEU O O N N 217 LEU CB C N N 218 LEU CG C N N 219 LEU CD1 C N N 220 LEU CD2 C N N 221 LEU OXT O N N 222 LEU H H N N 223 LEU H2 H N N 224 LEU HA H N N 225 LEU HB2 H N N 226 LEU HB3 H N N 227 LEU HG H N N 228 LEU HD11 H N N 229 LEU HD12 H N N 230 LEU HD13 H N N 231 LEU HD21 H N N 232 LEU HD22 H N N 233 LEU HD23 H N N 234 LEU HXT H N N 235 LYS N N N N 236 LYS CA C N S 237 LYS C C N N 238 LYS O O N N 239 LYS CB C N N 240 LYS CG C N N 241 LYS CD C N N 242 LYS CE C N N 243 LYS NZ N N N 244 LYS OXT O N N 245 LYS H H N N 246 LYS H2 H N N 247 LYS HA H N N 248 LYS HB2 H N N 249 LYS HB3 H N N 250 LYS HG2 H N N 251 LYS HG3 H N N 252 LYS HD2 H N N 253 LYS HD3 H N N 254 LYS HE2 H N N 255 LYS HE3 H N N 256 LYS HZ1 H N N 257 LYS HZ2 H N N 258 LYS HZ3 H N N 259 LYS HXT H N N 260 MET N N N N 261 MET CA C N S 262 MET C C N N 263 MET O O N N 264 MET CB C N N 265 MET CG C N N 266 MET SD S N N 267 MET CE C N N 268 MET OXT O N N 269 MET H H N N 270 MET H2 H N N 271 MET HA H N N 272 MET HB2 H N N 273 MET HB3 H N N 274 MET HG2 H N N 275 MET HG3 H N N 276 MET HE1 H N N 277 MET HE2 H N N 278 MET HE3 H N N 279 MET HXT H N N 280 PRO N N N N 281 PRO CA C N S 282 PRO C C N N 283 PRO O O N N 284 PRO CB C N N 285 PRO CG C N N 286 PRO CD C N N 287 PRO OXT O N N 288 PRO H H N N 289 PRO HA H N N 290 PRO HB2 H N N 291 PRO HB3 H N N 292 PRO HG2 H N N 293 PRO HG3 H N N 294 PRO HD2 H N N 295 PRO HD3 H N N 296 PRO HXT H N N 297 SER N N N N 298 SER CA C N S 299 SER C C N N 300 SER O O N N 301 SER CB C N N 302 SER OG O N N 303 SER OXT O N N 304 SER H H N N 305 SER H2 H N N 306 SER HA H N N 307 SER HB2 H N N 308 SER HB3 H N N 309 SER HG H N N 310 SER HXT H N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TRP N N N N 329 TRP CA C N S 330 TRP C C N N 331 TRP O O N N 332 TRP CB C N N 333 TRP CG C Y N 334 TRP CD1 C Y N 335 TRP CD2 C Y N 336 TRP NE1 N Y N 337 TRP CE2 C Y N 338 TRP CE3 C Y N 339 TRP CZ2 C Y N 340 TRP CZ3 C Y N 341 TRP CH2 C Y N 342 TRP OXT O N N 343 TRP H H N N 344 TRP H2 H N N 345 TRP HA H N N 346 TRP HB2 H N N 347 TRP HB3 H N N 348 TRP HD1 H N N 349 TRP HE1 H N N 350 TRP HE3 H N N 351 TRP HZ2 H N N 352 TRP HZ3 H N N 353 TRP HH2 H N N 354 TRP HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1PE OH2 C12 sing N N 1 1PE OH2 HO2 sing N N 2 1PE C12 C22 sing N N 3 1PE C12 H121 sing N N 4 1PE C12 H122 sing N N 5 1PE C22 OH3 sing N N 6 1PE C22 H221 sing N N 7 1PE C22 H222 sing N N 8 1PE OH3 C23 sing N N 9 1PE C13 C23 sing N N 10 1PE C13 OH4 sing N N 11 1PE C13 H131 sing N N 12 1PE C13 H132 sing N N 13 1PE C23 H231 sing N N 14 1PE C23 H232 sing N N 15 1PE OH4 C24 sing N N 16 1PE C14 C24 sing N N 17 1PE C14 OH5 sing N N 18 1PE C14 H141 sing N N 19 1PE C14 H142 sing N N 20 1PE C24 H241 sing N N 21 1PE C24 H242 sing N N 22 1PE OH5 C25 sing N N 23 1PE C15 C25 sing N N 24 1PE C15 OH6 sing N N 25 1PE C15 H151 sing N N 26 1PE C15 H152 sing N N 27 1PE C25 H251 sing N N 28 1PE C25 H252 sing N N 29 1PE OH6 C26 sing N N 30 1PE C16 C26 sing N N 31 1PE C16 OH7 sing N N 32 1PE C16 H161 sing N N 33 1PE C16 H162 sing N N 34 1PE C26 H261 sing N N 35 1PE C26 H262 sing N N 36 1PE OH7 HO7 sing N N 37 ALA N CA sing N N 38 ALA N H sing N N 39 ALA N H2 sing N N 40 ALA CA C sing N N 41 ALA CA CB sing N N 42 ALA CA HA sing N N 43 ALA C O doub N N 44 ALA C OXT sing N N 45 ALA CB HB1 sing N N 46 ALA CB HB2 sing N N 47 ALA CB HB3 sing N N 48 ALA OXT HXT sing N N 49 ARG N CA sing N N 50 ARG N H sing N N 51 ARG N H2 sing N N 52 ARG CA C sing N N 53 ARG CA CB sing N N 54 ARG CA HA sing N N 55 ARG C O doub N N 56 ARG C OXT sing N N 57 ARG CB CG sing N N 58 ARG CB HB2 sing N N 59 ARG CB HB3 sing N N 60 ARG CG CD sing N N 61 ARG CG HG2 sing N N 62 ARG CG HG3 sing N N 63 ARG CD NE sing N N 64 ARG CD HD2 sing N N 65 ARG CD HD3 sing N N 66 ARG NE CZ sing N N 67 ARG NE HE sing N N 68 ARG CZ NH1 sing N N 69 ARG CZ NH2 doub N N 70 ARG NH1 HH11 sing N N 71 ARG NH1 HH12 sing N N 72 ARG NH2 HH21 sing N N 73 ARG NH2 HH22 sing N N 74 ARG OXT HXT sing N N 75 ASP N CA sing N N 76 ASP N H sing N N 77 ASP N H2 sing N N 78 ASP CA C sing N N 79 ASP CA CB sing N N 80 ASP CA HA sing N N 81 ASP C O doub N N 82 ASP C OXT sing N N 83 ASP CB CG sing N N 84 ASP CB HB2 sing N N 85 ASP CB HB3 sing N N 86 ASP CG OD1 doub N N 87 ASP CG OD2 sing N N 88 ASP OD2 HD2 sing N N 89 ASP OXT HXT sing N N 90 EDO C1 O1 sing N N 91 EDO C1 C2 sing N N 92 EDO C1 H11 sing N N 93 EDO C1 H12 sing N N 94 EDO O1 HO1 sing N N 95 EDO C2 O2 sing N N 96 EDO C2 H21 sing N N 97 EDO C2 H22 sing N N 98 EDO O2 HO2 sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 GOL C1 O1 sing N N 146 GOL C1 C2 sing N N 147 GOL C1 H11 sing N N 148 GOL C1 H12 sing N N 149 GOL O1 HO1 sing N N 150 GOL C2 O2 sing N N 151 GOL C2 C3 sing N N 152 GOL C2 H2 sing N N 153 GOL O2 HO2 sing N N 154 GOL C3 O3 sing N N 155 GOL C3 H31 sing N N 156 GOL C3 H32 sing N N 157 GOL O3 HO3 sing N N 158 HIS N CA sing N N 159 HIS N H sing N N 160 HIS N H2 sing N N 161 HIS CA C sing N N 162 HIS CA CB sing N N 163 HIS CA HA sing N N 164 HIS C O doub N N 165 HIS C OXT sing N N 166 HIS CB CG sing N N 167 HIS CB HB2 sing N N 168 HIS CB HB3 sing N N 169 HIS CG ND1 sing Y N 170 HIS CG CD2 doub Y N 171 HIS ND1 CE1 doub Y N 172 HIS ND1 HD1 sing N N 173 HIS CD2 NE2 sing Y N 174 HIS CD2 HD2 sing N N 175 HIS CE1 NE2 sing Y N 176 HIS CE1 HE1 sing N N 177 HIS NE2 HE2 sing N N 178 HIS OXT HXT sing N N 179 HOH O H1 sing N N 180 HOH O H2 sing N N 181 ILE N CA sing N N 182 ILE N H sing N N 183 ILE N H2 sing N N 184 ILE CA C sing N N 185 ILE CA CB sing N N 186 ILE CA HA sing N N 187 ILE C O doub N N 188 ILE C OXT sing N N 189 ILE CB CG1 sing N N 190 ILE CB CG2 sing N N 191 ILE CB HB sing N N 192 ILE CG1 CD1 sing N N 193 ILE CG1 HG12 sing N N 194 ILE CG1 HG13 sing N N 195 ILE CG2 HG21 sing N N 196 ILE CG2 HG22 sing N N 197 ILE CG2 HG23 sing N N 198 ILE CD1 HD11 sing N N 199 ILE CD1 HD12 sing N N 200 ILE CD1 HD13 sing N N 201 ILE OXT HXT sing N N 202 LEU N CA sing N N 203 LEU N H sing N N 204 LEU N H2 sing N N 205 LEU CA C sing N N 206 LEU CA CB sing N N 207 LEU CA HA sing N N 208 LEU C O doub N N 209 LEU C OXT sing N N 210 LEU CB CG sing N N 211 LEU CB HB2 sing N N 212 LEU CB HB3 sing N N 213 LEU CG CD1 sing N N 214 LEU CG CD2 sing N N 215 LEU CG HG sing N N 216 LEU CD1 HD11 sing N N 217 LEU CD1 HD12 sing N N 218 LEU CD1 HD13 sing N N 219 LEU CD2 HD21 sing N N 220 LEU CD2 HD22 sing N N 221 LEU CD2 HD23 sing N N 222 LEU OXT HXT sing N N 223 LYS N CA sing N N 224 LYS N H sing N N 225 LYS N H2 sing N N 226 LYS CA C sing N N 227 LYS CA CB sing N N 228 LYS CA HA sing N N 229 LYS C O doub N N 230 LYS C OXT sing N N 231 LYS CB CG sing N N 232 LYS CB HB2 sing N N 233 LYS CB HB3 sing N N 234 LYS CG CD sing N N 235 LYS CG HG2 sing N N 236 LYS CG HG3 sing N N 237 LYS CD CE sing N N 238 LYS CD HD2 sing N N 239 LYS CD HD3 sing N N 240 LYS CE NZ sing N N 241 LYS CE HE2 sing N N 242 LYS CE HE3 sing N N 243 LYS NZ HZ1 sing N N 244 LYS NZ HZ2 sing N N 245 LYS NZ HZ3 sing N N 246 LYS OXT HXT sing N N 247 MET N CA sing N N 248 MET N H sing N N 249 MET N H2 sing N N 250 MET CA C sing N N 251 MET CA CB sing N N 252 MET CA HA sing N N 253 MET C O doub N N 254 MET C OXT sing N N 255 MET CB CG sing N N 256 MET CB HB2 sing N N 257 MET CB HB3 sing N N 258 MET CG SD sing N N 259 MET CG HG2 sing N N 260 MET CG HG3 sing N N 261 MET SD CE sing N N 262 MET CE HE1 sing N N 263 MET CE HE2 sing N N 264 MET CE HE3 sing N N 265 MET OXT HXT sing N N 266 PRO N CA sing N N 267 PRO N CD sing N N 268 PRO N H sing N N 269 PRO CA C sing N N 270 PRO CA CB sing N N 271 PRO CA HA sing N N 272 PRO C O doub N N 273 PRO C OXT sing N N 274 PRO CB CG sing N N 275 PRO CB HB2 sing N N 276 PRO CB HB3 sing N N 277 PRO CG CD sing N N 278 PRO CG HG2 sing N N 279 PRO CG HG3 sing N N 280 PRO CD HD2 sing N N 281 PRO CD HD3 sing N N 282 PRO OXT HXT sing N N 283 SER N CA sing N N 284 SER N H sing N N 285 SER N H2 sing N N 286 SER CA C sing N N 287 SER CA CB sing N N 288 SER CA HA sing N N 289 SER C O doub N N 290 SER C OXT sing N N 291 SER CB OG sing N N 292 SER CB HB2 sing N N 293 SER CB HB3 sing N N 294 SER OG HG sing N N 295 SER OXT HXT sing N N 296 THR N CA sing N N 297 THR N H sing N N 298 THR N H2 sing N N 299 THR CA C sing N N 300 THR CA CB sing N N 301 THR CA HA sing N N 302 THR C O doub N N 303 THR C OXT sing N N 304 THR CB OG1 sing N N 305 THR CB CG2 sing N N 306 THR CB HB sing N N 307 THR OG1 HG1 sing N N 308 THR CG2 HG21 sing N N 309 THR CG2 HG22 sing N N 310 THR CG2 HG23 sing N N 311 THR OXT HXT sing N N 312 TRP N CA sing N N 313 TRP N H sing N N 314 TRP N H2 sing N N 315 TRP CA C sing N N 316 TRP CA CB sing N N 317 TRP CA HA sing N N 318 TRP C O doub N N 319 TRP C OXT sing N N 320 TRP CB CG sing N N 321 TRP CB HB2 sing N N 322 TRP CB HB3 sing N N 323 TRP CG CD1 doub Y N 324 TRP CG CD2 sing Y N 325 TRP CD1 NE1 sing Y N 326 TRP CD1 HD1 sing N N 327 TRP CD2 CE2 doub Y N 328 TRP CD2 CE3 sing Y N 329 TRP NE1 CE2 sing Y N 330 TRP NE1 HE1 sing N N 331 TRP CE2 CZ2 sing Y N 332 TRP CE3 CZ3 doub Y N 333 TRP CE3 HE3 sing N N 334 TRP CZ2 CH2 doub Y N 335 TRP CZ2 HZ2 sing N N 336 TRP CZ3 CH2 sing Y N 337 TRP CZ3 HZ3 sing N N 338 TRP CH2 HH2 sing N N 339 TRP OXT HXT sing N N 340 VAL N CA sing N N 341 VAL N H sing N N 342 VAL N H2 sing N N 343 VAL CA C sing N N 344 VAL CA CB sing N N 345 VAL CA HA sing N N 346 VAL C O doub N N 347 VAL C OXT sing N N 348 VAL CB CG1 sing N N 349 VAL CB CG2 sing N N 350 VAL CB HB sing N N 351 VAL CG1 HG11 sing N N 352 VAL CG1 HG12 sing N N 353 VAL CG1 HG13 sing N N 354 VAL CG2 HG21 sing N N 355 VAL CG2 HG22 sing N N 356 VAL CG2 HG23 sing N N 357 VAL OXT HXT sing N N 358 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9R1N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014684 _atom_sites.fract_transf_matrix[1][2] 0.008478 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016956 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008279 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #