data_9RA5 # _entry.id 9RA5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9RA5 pdb_00009ra5 10.2210/pdb9ra5/pdb WWPDB D_1292148048 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-03 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9RA5 _pdbx_database_status.recvd_initial_deposition_date 2025-05-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email origene.nyanguile@hevs.ch _pdbx_contact_author.name_first Origene _pdbx_contact_author.name_last Nyanguile _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1516-1109 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Duquerroy, S.' 1 0000-0003-4386-8013 'Nyanguile, O.' 2 0000-0003-1516-1109 'Gsponer, N.' 3 0000-0002-5929-8513 'Nicolet, N.' 4 ? 'Marti, R.' 5 0000-0001-6308-4908 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Double stapled peptide scan yields 3/4i, a potent fusion inhibitor of Respiratory Syncytial Virus' ? ? ? ? ? ? ? ? ? ? ? ? ? US ? ? 1 'Antimicrob Agents Chemother' AMACCQ 0788 1098-6596 ? ? 61 ? ? ? 'A Short Double-Stapled Peptide Inhibits Respiratory Syncytial Virus Entry and Spreading.' 2017 ? 10.1016/j.virol.2009.10.040 28137809 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gsponer, N.' 1 0000-0002-5929-8513 primary 'Nicolet, N.' 2 ? primary 'Marti, R.' 3 0000-0001-6308-4908 primary 'Duquerroy, S.' 4 0000-0003-4386-8013 primary 'Nyanguile, O.' 5 0000-0003-1516-1109 1 'Gaillard, V.' 6 ? 1 'Galloux, M.' 7 ? 1 'Garcin, D.' 8 0000-0003-1556-897X 1 'Eleouet, J.F.' 9 0000-0002-7361-4885 1 'Le Goffic, R.' 10 0000-0002-2012-0064 1 'Larcher, T.' 11 ? 1 'Rameix-Welti, M.A.' 12 ? 1 'Boukadiri, A.' 13 ? 1 'Heritier, J.' 14 ? 1 'Segura, J.M.' 15 ? 1 'Baechler, E.' 16 ? 1 'Arrell, M.' 17 ? 1 'Mottet-Osman, G.' 18 ? 1 'Nyanguile, O.' 19 0000-0003-1516-1109 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Fusion glycoprotein F1' 5564.542 1 ? ? ? 'Peptides were synthesized by Fmoc/tBu solid-phase peptide chemistry on a Rink Amide AM resin' 2 polymer syn 'Double stapled peptide 3/4i' 2347.857 1 ? ? ? 'Peptides were synthesized by Fmoc/tBu solid-phase peptide chemistry' 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 5 water nat water 18.015 36 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name F1 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes '(ACE)HLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNK(NH2)' XHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKX A ? 2 'polypeptide(L)' no yes '(ACE)E(2JN)IN(MK8)SLAFI(MK8)KSD(MK8)LLHNV(NH2)' XEXINLSLAFILKSDLLLHNVX D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 'POTASSIUM ION' K 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 HIS n 1 3 LEU n 1 4 GLU n 1 5 GLY n 1 6 GLU n 1 7 VAL n 1 8 ASN n 1 9 LYS n 1 10 ILE n 1 11 LYS n 1 12 SER n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 SER n 1 17 THR n 1 18 ASN n 1 19 LYS n 1 20 ALA n 1 21 VAL n 1 22 VAL n 1 23 SER n 1 24 LEU n 1 25 SER n 1 26 ASN n 1 27 GLY n 1 28 VAL n 1 29 SER n 1 30 VAL n 1 31 LEU n 1 32 THR n 1 33 SER n 1 34 LYS n 1 35 VAL n 1 36 LEU n 1 37 ASP n 1 38 LEU n 1 39 LYS n 1 40 ASN n 1 41 TYR n 1 42 ILE n 1 43 ASP n 1 44 LYS n 1 45 GLN n 1 46 LEU n 1 47 LEU n 1 48 PRO n 1 49 ILE n 1 50 VAL n 1 51 ASN n 1 52 LYS n 1 53 NH2 n 2 1 ACE n 2 2 GLU n 2 3 2JN n 2 4 ILE n 2 5 ASN n 2 6 MK8 n 2 7 SER n 2 8 LEU n 2 9 ALA n 2 10 PHE n 2 11 ILE n 2 12 MK8 n 2 13 LYS n 2 14 SER n 2 15 ASP n 2 16 MK8 n 2 17 LEU n 2 18 LEU n 2 19 HIS n 2 20 ASN n 2 21 VAL n 2 22 NH2 n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 53 'Human respiratory syncytial virus A' ? 208893 ? 2 1 sample 1 22 'human respiratory syncytial virus' ? 11250 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2JN 'D-peptide linking' . 2-methyl-D-norleucine ? 'C7 H15 N O2' 145.199 ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MK8 'L-peptide linking' n 2-methyl-L-norleucine ? 'C7 H15 N O2' 145.199 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 158 158 ACE ACE A . n A 1 2 HIS 2 159 159 HIS HIS A . n A 1 3 LEU 3 160 160 LEU LEU A . n A 1 4 GLU 4 161 161 GLU GLU A . n A 1 5 GLY 5 162 162 GLY GLY A . n A 1 6 GLU 6 163 163 GLU GLU A . n A 1 7 VAL 7 164 164 VAL VAL A . n A 1 8 ASN 8 165 165 ASN ASN A . n A 1 9 LYS 9 166 166 LYS LYS A . n A 1 10 ILE 10 167 167 ILE ILE A . n A 1 11 LYS 11 168 168 LYS LYS A . n A 1 12 SER 12 169 169 SER SER A . n A 1 13 ALA 13 170 170 ALA ALA A . n A 1 14 LEU 14 171 171 LEU LEU A . n A 1 15 LEU 15 172 172 LEU LEU A . n A 1 16 SER 16 173 173 SER SER A . n A 1 17 THR 17 174 174 THR THR A . n A 1 18 ASN 18 175 175 ASN ASN A . n A 1 19 LYS 19 176 176 LYS LYS A . n A 1 20 ALA 20 177 177 ALA ALA A . n A 1 21 VAL 21 178 178 VAL VAL A . n A 1 22 VAL 22 179 179 VAL VAL A . n A 1 23 SER 23 180 180 SER SER A . n A 1 24 LEU 24 181 181 LEU LEU A . n A 1 25 SER 25 182 182 SER SER A . n A 1 26 ASN 26 183 183 ASN ASN A . n A 1 27 GLY 27 184 184 GLY GLY A . n A 1 28 VAL 28 185 185 VAL VAL A . n A 1 29 SER 29 186 186 SER SER A . n A 1 30 VAL 30 187 187 VAL VAL A . n A 1 31 LEU 31 188 188 LEU LEU A . n A 1 32 THR 32 189 189 THR THR A . n A 1 33 SER 33 190 190 SER SER A . n A 1 34 LYS 34 191 191 LYS LYS A . n A 1 35 VAL 35 192 192 VAL VAL A . n A 1 36 LEU 36 193 193 LEU LEU A . n A 1 37 ASP 37 194 194 ASP ASP A . n A 1 38 LEU 38 195 195 LEU LEU A . n A 1 39 LYS 39 196 196 LYS LYS A . n A 1 40 ASN 40 197 197 ASN ASN A . n A 1 41 TYR 41 198 198 TYR TYR A . n A 1 42 ILE 42 199 199 ILE ILE A . n A 1 43 ASP 43 200 200 ASP ASP A . n A 1 44 LYS 44 201 201 LYS LYS A . n A 1 45 GLN 45 202 202 GLN GLN A . n A 1 46 LEU 46 203 203 LEU LEU A . n A 1 47 LEU 47 204 ? ? ? A . n A 1 48 PRO 48 205 ? ? ? A . n A 1 49 ILE 49 206 ? ? ? A . n A 1 50 VAL 50 207 ? ? ? A . n A 1 51 ASN 51 208 ? ? ? A . n A 1 52 LYS 52 209 ? ? ? A . n A 1 53 NH2 53 210 ? ? ? A . n B 2 1 ACE 1 496 496 ACE ACE D . n B 2 2 GLU 2 497 497 GLU GLU D . n B 2 3 2JN 3 498 498 2JN 2JN D . n B 2 4 ILE 4 499 499 ILE ILE D . n B 2 5 ASN 5 500 500 ASN ASN D . n B 2 6 MK8 6 501 501 MK8 MK8 D . n B 2 7 SER 7 502 502 SER SER D . n B 2 8 LEU 8 503 503 LEU LEU D . n B 2 9 ALA 9 504 504 ALA ALA D . n B 2 10 PHE 10 505 505 PHE PHE D . n B 2 11 ILE 11 506 506 ILE ILE D . n B 2 12 MK8 12 507 507 MK8 MK8 D . n B 2 13 LYS 13 508 508 LYS LYS D . n B 2 14 SER 14 509 509 SER SER D . n B 2 15 ASP 15 510 510 ASP ASP D . n B 2 16 MK8 16 511 511 MK8 MK8 D . n B 2 17 LEU 17 512 512 LEU LEU D . n B 2 18 LEU 18 513 513 LEU LEU D . n B 2 19 HIS 19 514 514 HIS HIS D . n B 2 20 ASN 20 515 515 ASN ASN D . n B 2 21 VAL 21 516 516 VAL VAL D . n B 2 22 NH2 22 517 517 NH2 NH2 D . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 2JN ? ? 2JN ? ? 'SUBJECT OF INVESTIGATION' ? 2 ACE ? ? ACE ? ? 'SUBJECT OF INVESTIGATION' ? 3 GOL ? ? GOL ? ? 'SUBJECT OF INVESTIGATION' ? 4 MK8 ? ? MK8 ? ? 'SUBJECT OF INVESTIGATION' ? 5 K ? ? K ? ? 'SUBJECT OF INVESTIGATION' ? 6 NH2 ? ? NH2 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 301 301 GOL GOL A . D 4 K 1 601 1 K K D . E 5 HOH 1 401 33 HOH HOH A . E 5 HOH 2 402 24 HOH HOH A . E 5 HOH 3 403 3 HOH HOH A . E 5 HOH 4 404 31 HOH HOH A . E 5 HOH 5 405 5 HOH HOH A . E 5 HOH 6 406 13 HOH HOH A . E 5 HOH 7 407 1 HOH HOH A . E 5 HOH 8 408 21 HOH HOH A . E 5 HOH 9 409 14 HOH HOH A . E 5 HOH 10 410 11 HOH HOH A . E 5 HOH 11 411 19 HOH HOH A . E 5 HOH 12 412 9 HOH HOH A . E 5 HOH 13 413 20 HOH HOH A . E 5 HOH 14 414 18 HOH HOH A . E 5 HOH 15 415 17 HOH HOH A . E 5 HOH 16 416 36 HOH HOH A . E 5 HOH 17 417 25 HOH HOH A . E 5 HOH 18 418 27 HOH HOH A . E 5 HOH 19 419 28 HOH HOH A . E 5 HOH 20 420 30 HOH HOH A . E 5 HOH 21 421 32 HOH HOH A . F 5 HOH 1 701 22 HOH HOH D . F 5 HOH 2 702 6 HOH HOH D . F 5 HOH 3 703 4 HOH HOH D . F 5 HOH 4 704 34 HOH HOH D . F 5 HOH 5 705 16 HOH HOH D . F 5 HOH 6 706 15 HOH HOH D . F 5 HOH 7 707 7 HOH HOH D . F 5 HOH 8 708 12 HOH HOH D . F 5 HOH 9 709 37 HOH HOH D . F 5 HOH 10 710 10 HOH HOH D . F 5 HOH 11 711 2 HOH HOH D . F 5 HOH 12 712 29 HOH HOH D . F 5 HOH 13 713 26 HOH HOH D . F 5 HOH 14 714 8 HOH HOH D . F 5 HOH 15 715 23 HOH HOH D . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.4 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'BUILT 20250327' ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.8.2 ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.0.5 ? 5 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9RA5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.32 _cell.length_a_esd ? _cell.length_b 78.32 _cell.length_b_esd ? _cell.length_c 78.32 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9RA5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9RA5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.5 _exptl_crystal.description cubic _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.01M MgCl2 0.05M KCl 15% PEG6000 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 77 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-10-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ;Monochromateur "channel-cut" ; _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.980111 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.980111 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9RA5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.625 _reflns.d_resolution_low 20 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10226 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 40.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.069 _reflns.pdbx_Rpim_I_all 0.011 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star 1.0 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.625 _reflns_shell.d_res_low 1.65 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 533 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 41.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 6.653 _reflns_shell.pdbx_Rpim_I_all 1.035 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.298 _reflns_shell.pdbx_CC_star 0.671 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 6.572 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] 0 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] 0 _refine.B_iso_max ? _refine.B_iso_mean 69.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.974 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9RA5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.625 _refine.ls_d_res_low 14.3 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10211 _refine.ls_number_reflns_R_free 496 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1941 _refine.ls_R_factor_R_free 0.2075 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1934 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.079 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.08 _refine.pdbx_overall_SU_R_Blow_DPI 0.085 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.099 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9RA5 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.625 _refine_hist.d_res_low 14.3 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 554 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 511 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.01 ? 1100 ? t_bond_d 2 ? HARMONIC 'X-RAY DIFFRACTION' ? 0.86 ? 2016 ? t_angle_deg 2 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 354 ? t_dihedral_angle_d 2 ? SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 173 ? t_gen_planes 5 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 536 ? t_it 10 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 73 ? t_chiral_improper_torsion 5 ? SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 4 ? t_sum_occupancies 1 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1064 ? t_ideal_dist_contact 4 ? SEMIHARMONIC 'X-RAY DIFFRACTION' ? 2.21 ? ? ? t_omega_torsion ? ? ? 'X-RAY DIFFRACTION' ? 17.54 ? ? ? t_other_torsion ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.625 _refine_ls_shell.d_res_low 1.65 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 14 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs 99.55 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3143 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.3258 # _struct.entry_id 9RA5 _struct.title 'Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex with Double stapled peptide 3/4i' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9RA5 _struct_keywords.text 'Human Respiratory Syncytial Virus, Fusion Protein, Fusion Inhibitor, Stapled Peptide, Six Helix Bundle, Complex, ANTIVIRAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP FUS_HRSVA P03420 ? 1 HLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNK 159 2 PDB 9RA5 9RA5 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9RA5 A 2 ? 52 ? P03420 159 ? 209 ? 159 209 2 2 9RA5 D 1 ? 22 ? 9RA5 496 ? 517 ? 496 517 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9RA5 ACE A 1 ? UNP P03420 ? ? acetylation 158 1 1 9RA5 NH2 A 53 ? UNP P03420 ? ? amidation 210 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12140 ? 1 MORE -96 ? 1 'SSA (A^2)' 10200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 2 ? LEU A 46 ? HIS A 159 LEU A 203 1 ? 45 HELX_P HELX_P2 AA2 GLU B 2 ? LEU B 18 ? GLU D 497 LEU D 513 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A HIS 2 N ? ? A ACE 158 A HIS 159 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? B ACE 1 C ? ? ? 1_555 B GLU 2 N ? ? D ACE 496 D GLU 497 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale3 covale both ? B GLU 2 C ? ? ? 1_555 B 2JN 3 N ? ? D GLU 497 D 2JN 498 1_555 ? ? ? ? ? ? ? 1.355 ? ? covale4 covale both ? B 2JN 3 C ? ? ? 1_555 B ILE 4 N ? ? D 2JN 498 D ILE 499 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale5 covale none ? B 2JN 3 CAI ? ? ? 1_555 B MK8 6 CE ? ? D 2JN 498 D MK8 501 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale6 covale both ? B ASN 5 C ? ? ? 1_555 B MK8 6 N ? ? D ASN 500 D MK8 501 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale7 covale both ? B MK8 6 C ? ? ? 1_555 B SER 7 N ? ? D MK8 501 D SER 502 1_555 ? ? ? ? ? ? ? 1.354 ? ? covale8 covale both ? B ILE 11 C ? ? ? 1_555 B MK8 12 N ? ? D ILE 506 D MK8 507 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale9 covale both ? B MK8 12 C ? ? ? 1_555 B LYS 13 N ? ? D MK8 507 D LYS 508 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale10 covale none ? B MK8 12 CE ? ? ? 1_555 B MK8 16 CE ? ? D MK8 507 D MK8 511 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale11 covale both ? B ASP 15 C ? ? ? 1_555 B MK8 16 N ? ? D ASP 510 D MK8 511 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale12 covale both ? B MK8 16 C ? ? ? 1_555 B LEU 17 N ? ? D MK8 511 D LEU 512 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale13 covale both ? B VAL 21 C ? ? ? 1_555 B NH2 22 N ? ? D VAL 516 D NH2 517 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 2JN B 3 ? . . . . 2JN D 498 ? 1_555 . . . . . . . DLE 1 2JN Norleucine 'Named protein modification' 2 2JN B 3 ? . . . . 2JN D 498 ? 1_555 . . . . . . . DLE 2 2JN Methylation 'Named protein modification' 3 MK8 B 6 ? . . . . MK8 D 501 ? 1_555 . . . . . . . LEU 1 MK8 Norleucine 'Named protein modification' 4 MK8 B 6 ? . . . . MK8 D 501 ? 1_555 . . . . . . . LEU 2 MK8 Methylation 'Named protein modification' 5 MK8 B 12 ? . . . . MK8 D 507 ? 1_555 . . . . . . . LEU 1 MK8 Norleucine 'Named protein modification' 6 MK8 B 12 ? . . . . MK8 D 507 ? 1_555 . . . . . . . LEU 2 MK8 Methylation 'Named protein modification' 7 MK8 B 16 ? . . . . MK8 D 511 ? 1_555 . . . . . . . LEU 1 MK8 Norleucine 'Named protein modification' 8 MK8 B 16 ? . . . . MK8 D 511 ? 1_555 . . . . . . . LEU 2 MK8 Methylation 'Named protein modification' 9 ACE A 1 ? HIS A 2 ? ACE A 158 ? 1_555 HIS A 159 ? 1_555 . . HIS 19 ACE None 'Terminal acetylation' 10 ACE B 1 ? GLU B 2 ? ACE D 496 ? 1_555 GLU D 497 ? 1_555 . . GLU 10 ACE None 'Terminal acetylation' 11 NH2 B 22 ? VAL B 21 ? NH2 D 517 ? 1_555 VAL D 516 ? 1_555 . . VAL 2 NH2 None 'Terminal amidation' 12 2JN B 3 ? MK8 B 6 ? 2JN D 498 ? 1_555 MK8 D 501 ? 1_555 CAI CE . . . None 'Non-standard linkage' 13 MK8 B 12 ? MK8 B 16 ? MK8 D 507 ? 1_555 MK8 D 511 ? 1_555 CE CE . . . None 'Non-standard linkage' # _pdbx_entry_details.entry_id 9RA5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 179 ? ? HG A SER 182 ? A 1.55 2 1 O D ILE 499 ? ? HG D SER 502 ? B 1.59 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? ? -2.1775 -7.0862 -9.5949 -0.1059 ? -0.0026 ? -0.0003 ? -0.1108 ? 0.0035 ? -0.1111 ? 9.6467 ? 3.4444 ? 4.8662 ? 5.7571 ? 2.9729 ? 10.207 ? 0.0507 ? 0.1898 ? -0.3053 ? 0.1898 ? -0.0459 ? 0.4439 ? -0.3053 ? 0.4439 ? -0.0048 ? 2 'X-RAY DIFFRACTION' ? ? -10.2036 -4.9167 -19.8517 -0.0909 ? 0.0263 ? -0.0092 ? -0.1049 ? 0.0362 ? -0.1812 ? 11.7558 ? 4.4425 ? 2.1857 ? 11.4146 ? -0.5526 ? 8.5877 ? 0.0812 ? -0.3718 ? 0.0598 ? -0.3718 ? -0.0181 ? 0.041 ? 0.0598 ? 0.041 ? -0.063 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 158 ? ? ? A 203 ? ? '{ A|* }' 2 'X-RAY DIFFRACTION' 1 ? ? A 301 ? ? ? A 301 ? ? '{ A|* }' 3 'X-RAY DIFFRACTION' 2 ? ? D 496 ? ? ? D 497 ? ? '{ D|* }' 4 'X-RAY DIFFRACTION' 2 ? ? D 498 ? ? ? D 498 ? ? '{ D|* }' 5 'X-RAY DIFFRACTION' 2 ? ? D 499 ? ? ? D 500 ? ? '{ D|* }' 6 'X-RAY DIFFRACTION' 2 ? ? D 501 ? ? ? D 501 ? ? '{ D|* }' 7 'X-RAY DIFFRACTION' 2 ? ? D 502 ? ? ? D 506 ? ? '{ D|* }' 8 'X-RAY DIFFRACTION' 2 ? ? D 507 ? ? ? D 507 ? ? '{ D|* }' 9 'X-RAY DIFFRACTION' 2 ? ? D 508 ? ? ? D 510 ? ? '{ D|* }' 10 'X-RAY DIFFRACTION' 2 ? ? D 511 ? ? ? D 511 ? ? '{ D|* }' 11 'X-RAY DIFFRACTION' 2 ? ? D 512 ? ? ? D 517 ? ? '{ D|* }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 204 ? A LEU 47 2 1 Y 1 A PRO 205 ? A PRO 48 3 1 Y 1 A ILE 206 ? A ILE 49 4 1 Y 1 A VAL 207 ? A VAL 50 5 1 Y 1 A ASN 208 ? A ASN 51 6 1 Y 1 A LYS 209 ? A LYS 52 7 1 Y 1 A NH2 210 ? A NH2 53 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2JN O O N N 1 2JN C C N N 2 2JN CA C N R 3 2JN CAA C N N 4 2JN N N N N 5 2JN CAO C N N 6 2JN CAM C N N 7 2JN CAK C N N 8 2JN CAI C N N 9 2JN OXT O N N 10 2JN H1 H N N 11 2JN H4 H N N 12 2JN H3 H N N 13 2JN H H N N 14 2JN H2 H N N 15 2JN H7 H N N 16 2JN H8 H N N 17 2JN H9 H N N 18 2JN H10 H N N 19 2JN H11 H N N 20 2JN H12 H N N 21 2JN H13 H N N 22 2JN H14 H N N 23 2JN H15 H N N 24 2JN HXT H N N 25 ACE C C N N 26 ACE O O N N 27 ACE CH3 C N N 28 ACE H H N N 29 ACE H1 H N N 30 ACE H2 H N N 31 ACE H3 H N N 32 ALA N N N N 33 ALA CA C N S 34 ALA C C N N 35 ALA O O N N 36 ALA CB C N N 37 ALA OXT O N N 38 ALA H H N N 39 ALA H2 H N N 40 ALA HA H N N 41 ALA HB1 H N N 42 ALA HB2 H N N 43 ALA HB3 H N N 44 ALA HXT H N N 45 ASN N N N N 46 ASN CA C N S 47 ASN C C N N 48 ASN O O N N 49 ASN CB C N N 50 ASN CG C N N 51 ASN OD1 O N N 52 ASN ND2 N N N 53 ASN OXT O N N 54 ASN H H N N 55 ASN H2 H N N 56 ASN HA H N N 57 ASN HB2 H N N 58 ASN HB3 H N N 59 ASN HD21 H N N 60 ASN HD22 H N N 61 ASN HXT H N N 62 ASP N N N N 63 ASP CA C N S 64 ASP C C N N 65 ASP O O N N 66 ASP CB C N N 67 ASP CG C N N 68 ASP OD1 O N N 69 ASP OD2 O N N 70 ASP OXT O N N 71 ASP H H N N 72 ASP H2 H N N 73 ASP HA H N N 74 ASP HB2 H N N 75 ASP HB3 H N N 76 ASP HD2 H N N 77 ASP HXT H N N 78 GLN N N N N 79 GLN CA C N S 80 GLN C C N N 81 GLN O O N N 82 GLN CB C N N 83 GLN CG C N N 84 GLN CD C N N 85 GLN OE1 O N N 86 GLN NE2 N N N 87 GLN OXT O N N 88 GLN H H N N 89 GLN H2 H N N 90 GLN HA H N N 91 GLN HB2 H N N 92 GLN HB3 H N N 93 GLN HG2 H N N 94 GLN HG3 H N N 95 GLN HE21 H N N 96 GLN HE22 H N N 97 GLN HXT H N N 98 GLU N N N N 99 GLU CA C N S 100 GLU C C N N 101 GLU O O N N 102 GLU CB C N N 103 GLU CG C N N 104 GLU CD C N N 105 GLU OE1 O N N 106 GLU OE2 O N N 107 GLU OXT O N N 108 GLU H H N N 109 GLU H2 H N N 110 GLU HA H N N 111 GLU HB2 H N N 112 GLU HB3 H N N 113 GLU HG2 H N N 114 GLU HG3 H N N 115 GLU HE2 H N N 116 GLU HXT H N N 117 GLY N N N N 118 GLY CA C N N 119 GLY C C N N 120 GLY O O N N 121 GLY OXT O N N 122 GLY H H N N 123 GLY H2 H N N 124 GLY HA2 H N N 125 GLY HA3 H N N 126 GLY HXT H N N 127 GOL C1 C N N 128 GOL O1 O N N 129 GOL C2 C N N 130 GOL O2 O N N 131 GOL C3 C N N 132 GOL O3 O N N 133 GOL H11 H N N 134 GOL H12 H N N 135 GOL HO1 H N N 136 GOL H2 H N N 137 GOL HO2 H N N 138 GOL H31 H N N 139 GOL H32 H N N 140 GOL HO3 H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 K K K N N 188 LEU N N N N 189 LEU CA C N S 190 LEU C C N N 191 LEU O O N N 192 LEU CB C N N 193 LEU CG C N N 194 LEU CD1 C N N 195 LEU CD2 C N N 196 LEU OXT O N N 197 LEU H H N N 198 LEU H2 H N N 199 LEU HA H N N 200 LEU HB2 H N N 201 LEU HB3 H N N 202 LEU HG H N N 203 LEU HD11 H N N 204 LEU HD12 H N N 205 LEU HD13 H N N 206 LEU HD21 H N N 207 LEU HD22 H N N 208 LEU HD23 H N N 209 LEU HXT H N N 210 LYS N N N N 211 LYS CA C N S 212 LYS C C N N 213 LYS O O N N 214 LYS CB C N N 215 LYS CG C N N 216 LYS CD C N N 217 LYS CE C N N 218 LYS NZ N N N 219 LYS OXT O N N 220 LYS H H N N 221 LYS H2 H N N 222 LYS HA H N N 223 LYS HB2 H N N 224 LYS HB3 H N N 225 LYS HG2 H N N 226 LYS HG3 H N N 227 LYS HD2 H N N 228 LYS HD3 H N N 229 LYS HE2 H N N 230 LYS HE3 H N N 231 LYS HZ1 H N N 232 LYS HZ2 H N N 233 LYS HZ3 H N N 234 LYS HXT H N N 235 MK8 C C N N 236 MK8 N N N N 237 MK8 O O N N 238 MK8 CA C N S 239 MK8 CB C N N 240 MK8 CD C N N 241 MK8 CE C N N 242 MK8 CG C N N 243 MK8 CB1 C N N 244 MK8 OXT O N N 245 MK8 H H N N 246 MK8 H2 H N N 247 MK8 HB H N N 248 MK8 HBA H N N 249 MK8 HD H N N 250 MK8 HDA H N N 251 MK8 HE H N N 252 MK8 HEA H N N 253 MK8 HEB H N N 254 MK8 HG H N N 255 MK8 HGA H N N 256 MK8 HB1 H N N 257 MK8 HB1A H N N 258 MK8 HB1B H N N 259 MK8 HXT H N N 260 NH2 N N N N 261 NH2 HN1 H N N 262 NH2 HN2 H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2JN C O doub N N 1 2JN C CA sing N N 2 2JN CAA CA sing N N 3 2JN CA N sing N N 4 2JN CA CAO sing N N 5 2JN CAO CAM sing N N 6 2JN CAM CAK sing N N 7 2JN CAK CAI sing N N 8 2JN C OXT sing N N 9 2JN CAA H1 sing N N 10 2JN CAA H4 sing N N 11 2JN CAA H3 sing N N 12 2JN N H sing N N 13 2JN N H2 sing N N 14 2JN CAO H7 sing N N 15 2JN CAO H8 sing N N 16 2JN CAM H9 sing N N 17 2JN CAM H10 sing N N 18 2JN CAK H11 sing N N 19 2JN CAK H12 sing N N 20 2JN CAI H13 sing N N 21 2JN CAI H14 sing N N 22 2JN CAI H15 sing N N 23 2JN OXT HXT sing N N 24 ACE C O doub N N 25 ACE C CH3 sing N N 26 ACE C H sing N N 27 ACE CH3 H1 sing N N 28 ACE CH3 H2 sing N N 29 ACE CH3 H3 sing N N 30 ALA N CA sing N N 31 ALA N H sing N N 32 ALA N H2 sing N N 33 ALA CA C sing N N 34 ALA CA CB sing N N 35 ALA CA HA sing N N 36 ALA C O doub N N 37 ALA C OXT sing N N 38 ALA CB HB1 sing N N 39 ALA CB HB2 sing N N 40 ALA CB HB3 sing N N 41 ALA OXT HXT sing N N 42 ASN N CA sing N N 43 ASN N H sing N N 44 ASN N H2 sing N N 45 ASN CA C sing N N 46 ASN CA CB sing N N 47 ASN CA HA sing N N 48 ASN C O doub N N 49 ASN C OXT sing N N 50 ASN CB CG sing N N 51 ASN CB HB2 sing N N 52 ASN CB HB3 sing N N 53 ASN CG OD1 doub N N 54 ASN CG ND2 sing N N 55 ASN ND2 HD21 sing N N 56 ASN ND2 HD22 sing N N 57 ASN OXT HXT sing N N 58 ASP N CA sing N N 59 ASP N H sing N N 60 ASP N H2 sing N N 61 ASP CA C sing N N 62 ASP CA CB sing N N 63 ASP CA HA sing N N 64 ASP C O doub N N 65 ASP C OXT sing N N 66 ASP CB CG sing N N 67 ASP CB HB2 sing N N 68 ASP CB HB3 sing N N 69 ASP CG OD1 doub N N 70 ASP CG OD2 sing N N 71 ASP OD2 HD2 sing N N 72 ASP OXT HXT sing N N 73 GLN N CA sing N N 74 GLN N H sing N N 75 GLN N H2 sing N N 76 GLN CA C sing N N 77 GLN CA CB sing N N 78 GLN CA HA sing N N 79 GLN C O doub N N 80 GLN C OXT sing N N 81 GLN CB CG sing N N 82 GLN CB HB2 sing N N 83 GLN CB HB3 sing N N 84 GLN CG CD sing N N 85 GLN CG HG2 sing N N 86 GLN CG HG3 sing N N 87 GLN CD OE1 doub N N 88 GLN CD NE2 sing N N 89 GLN NE2 HE21 sing N N 90 GLN NE2 HE22 sing N N 91 GLN OXT HXT sing N N 92 GLU N CA sing N N 93 GLU N H sing N N 94 GLU N H2 sing N N 95 GLU CA C sing N N 96 GLU CA CB sing N N 97 GLU CA HA sing N N 98 GLU C O doub N N 99 GLU C OXT sing N N 100 GLU CB CG sing N N 101 GLU CB HB2 sing N N 102 GLU CB HB3 sing N N 103 GLU CG CD sing N N 104 GLU CG HG2 sing N N 105 GLU CG HG3 sing N N 106 GLU CD OE1 doub N N 107 GLU CD OE2 sing N N 108 GLU OE2 HE2 sing N N 109 GLU OXT HXT sing N N 110 GLY N CA sing N N 111 GLY N H sing N N 112 GLY N H2 sing N N 113 GLY CA C sing N N 114 GLY CA HA2 sing N N 115 GLY CA HA3 sing N N 116 GLY C O doub N N 117 GLY C OXT sing N N 118 GLY OXT HXT sing N N 119 GOL C1 O1 sing N N 120 GOL C1 C2 sing N N 121 GOL C1 H11 sing N N 122 GOL C1 H12 sing N N 123 GOL O1 HO1 sing N N 124 GOL C2 O2 sing N N 125 GOL C2 C3 sing N N 126 GOL C2 H2 sing N N 127 GOL O2 HO2 sing N N 128 GOL C3 O3 sing N N 129 GOL C3 H31 sing N N 130 GOL C3 H32 sing N N 131 GOL O3 HO3 sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MK8 C CA sing N N 222 MK8 C OXT sing N N 223 MK8 N H sing N N 224 MK8 N H2 sing N N 225 MK8 O C doub N N 226 MK8 CA N sing N N 227 MK8 CA CB sing N N 228 MK8 CB HB sing N N 229 MK8 CB HBA sing N N 230 MK8 CD CG sing N N 231 MK8 CD HD sing N N 232 MK8 CD HDA sing N N 233 MK8 CE CD sing N N 234 MK8 CE HE sing N N 235 MK8 CE HEA sing N N 236 MK8 CE HEB sing N N 237 MK8 CG CB sing N N 238 MK8 CG HG sing N N 239 MK8 CG HGA sing N N 240 MK8 CB1 CA sing N N 241 MK8 CB1 HB1 sing N N 242 MK8 CB1 HB1A sing N N 243 MK8 CB1 HB1B sing N N 244 MK8 OXT HXT sing N N 245 NH2 N HN1 sing N N 246 NH2 N HN2 sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TYR N CA sing N N 317 TYR N H sing N N 318 TYR N H2 sing N N 319 TYR CA C sing N N 320 TYR CA CB sing N N 321 TYR CA HA sing N N 322 TYR C O doub N N 323 TYR C OXT sing N N 324 TYR CB CG sing N N 325 TYR CB HB2 sing N N 326 TYR CB HB3 sing N N 327 TYR CG CD1 doub Y N 328 TYR CG CD2 sing Y N 329 TYR CD1 CE1 sing Y N 330 TYR CD1 HD1 sing N N 331 TYR CD2 CE2 doub Y N 332 TYR CD2 HD2 sing N N 333 TYR CE1 CZ doub Y N 334 TYR CE1 HE1 sing N N 335 TYR CE2 CZ sing Y N 336 TYR CE2 HE2 sing N N 337 TYR CZ OH sing N N 338 TYR OH HH sing N N 339 TYR OXT HXT sing N N 340 VAL N CA sing N N 341 VAL N H sing N N 342 VAL N H2 sing N N 343 VAL CA C sing N N 344 VAL CA CB sing N N 345 VAL CA HA sing N N 346 VAL C O doub N N 347 VAL C OXT sing N N 348 VAL CB CG1 sing N N 349 VAL CB CG2 sing N N 350 VAL CB HB sing N N 351 VAL CG1 HG11 sing N N 352 VAL CG1 HG12 sing N N 353 VAL CG1 HG13 sing N N 354 VAL CG2 HG21 sing N N 355 VAL CG2 HG22 sing N N 356 VAL CG2 HG23 sing N N 357 VAL OXT HXT sing N N 358 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number 'HES-SO 78166/IA-INTERDISC17-2' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1G2C _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9RA5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012768 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012768 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012768 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H K N O # loop_ # loop_ #