data_9RM4 # _entry.id 9RM4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9RM4 pdb_00009rm4 10.2210/pdb9rm4/pdb WWPDB D_1292148348 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-07-23 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9RM4 _pdbx_database_status.recvd_initial_deposition_date 2025-06-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email frank.vondelft@cmd.ox.ac.uk _pdbx_contact_author.name_first Frank _pdbx_contact_author.name_last 'von Delft' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0378-0017 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ni, X.' 1 ? 'Marples, P.G.' 2 ? 'Godoy, A.S.' 3 ? 'Koekemoer, L.' 4 ? 'Aschenbrenner, J.C.' 5 ? 'Balcomb, B.H.' 6 ? 'Fairhead, M.' 7 ? 'Lithgo, R.M.' 8 ? 'Lee, A.' 9 ? 'Kenton, N.' 10 ? 'Thompson, W.' 11 ? 'Tomlinson, C.W.E.' 12 ? 'Wild, C.' 13 ? 'Winokan, M.' 14 ? 'Williams, E.P.' 15 ? 'Fearon, D.' 16 ? 'von Delft, F.' 17 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015373' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ni, X.' 1 ? primary 'Marples, P.G.' 2 ? primary 'Godoy, A.S.' 3 ? primary 'Koekemoer, L.' 4 ? primary 'Aschenbrenner, J.C.' 5 ? primary 'Balcomb, B.H.' 6 ? primary 'Fairhead, M.' 7 ? primary 'Lithgo, R.M.' 8 ? primary 'Lee, A.' 9 ? primary 'Kenton, N.' 10 ? primary 'Thompson, W.' 11 ? primary 'Tomlinson, C.W.E.' 12 ? primary 'Wild, C.' 13 ? primary 'Winokan, M.' 14 ? primary 'Williams, E.P.' 15 ? primary 'Fearon, D.' 16 ? primary 'von Delft, F.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine protease subunit NS2B,Serine protease NS3' 23167.125 2 3.4.21.91,3.6.1.15,3.6.4.13 ? ? ? 2 non-polymer syn '~{N}-[3-chloranyl-5-[(2-methyl-1-oxidanyl-propan-2-yl)carbamoyl]phenyl]-5-[(dimethylamino)methyl]-1~{H}-pyrrole-2-carboxamide' 392.880 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Flavivirin protease NS2B regulatory subunit,Non-structural protein 2B,Flavivirin protease NS3 catalytic subunit,Non-structural protein 3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEMKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQE GVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDI GAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE ; _entity_poly.pdbx_seq_one_letter_code_can ;SMGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEMKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQE GVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDI GAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE ; _entity_poly.pdbx_strand_id AAA,BBB _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[3-chloranyl-5-[(2-methyl-1-oxidanyl-propan-2-yl)carbamoyl]phenyl]-5-[(dimethylamino)methyl]-1~{H}-pyrrole-2-carboxamide' A1JHM 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLY n 1 4 LYS n 1 5 SER n 1 6 VAL n 1 7 ASP n 1 8 MET n 1 9 TYR n 1 10 ILE n 1 11 GLU n 1 12 ARG n 1 13 ALA n 1 14 GLY n 1 15 ASP n 1 16 ILE n 1 17 THR n 1 18 TRP n 1 19 GLU n 1 20 LYS n 1 21 ASP n 1 22 ALA n 1 23 GLU n 1 24 VAL n 1 25 THR n 1 26 GLY n 1 27 ASN n 1 28 SER n 1 29 PRO n 1 30 ARG n 1 31 LEU n 1 32 ASP n 1 33 VAL n 1 34 ALA n 1 35 LEU n 1 36 ASP n 1 37 GLU n 1 38 SER n 1 39 GLY n 1 40 ASP n 1 41 PHE n 1 42 SER n 1 43 LEU n 1 44 VAL n 1 45 GLU n 1 46 GLU n 1 47 MET n 1 48 LYS n 1 49 GLU n 1 50 VAL n 1 51 LYS n 1 52 LYS n 1 53 GLY n 1 54 GLU n 1 55 THR n 1 56 THR n 1 57 ASP n 1 58 GLY n 1 59 VAL n 1 60 TYR n 1 61 ARG n 1 62 VAL n 1 63 MET n 1 64 THR n 1 65 ARG n 1 66 ARG n 1 67 LEU n 1 68 LEU n 1 69 GLY n 1 70 SER n 1 71 THR n 1 72 GLN n 1 73 VAL n 1 74 GLY n 1 75 VAL n 1 76 GLY n 1 77 VAL n 1 78 MET n 1 79 GLN n 1 80 GLU n 1 81 GLY n 1 82 VAL n 1 83 PHE n 1 84 HIS n 1 85 THR n 1 86 MET n 1 87 TRP n 1 88 HIS n 1 89 VAL n 1 90 THR n 1 91 LYS n 1 92 GLY n 1 93 ALA n 1 94 ALA n 1 95 LEU n 1 96 ARG n 1 97 SER n 1 98 GLY n 1 99 GLU n 1 100 GLY n 1 101 ARG n 1 102 LEU n 1 103 ASP n 1 104 PRO n 1 105 TYR n 1 106 TRP n 1 107 GLY n 1 108 ASP n 1 109 VAL n 1 110 LYS n 1 111 GLN n 1 112 ASP n 1 113 LEU n 1 114 VAL n 1 115 SER n 1 116 TYR n 1 117 CYS n 1 118 GLY n 1 119 PRO n 1 120 TRP n 1 121 LYS n 1 122 LEU n 1 123 ASP n 1 124 ALA n 1 125 ALA n 1 126 TRP n 1 127 ASP n 1 128 GLY n 1 129 LEU n 1 130 SER n 1 131 GLU n 1 132 VAL n 1 133 GLN n 1 134 LEU n 1 135 LEU n 1 136 ALA n 1 137 VAL n 1 138 PRO n 1 139 PRO n 1 140 GLY n 1 141 GLU n 1 142 ARG n 1 143 ALA n 1 144 LYS n 1 145 ASN n 1 146 ILE n 1 147 GLN n 1 148 THR n 1 149 LEU n 1 150 PRO n 1 151 GLY n 1 152 ILE n 1 153 PHE n 1 154 LYS n 1 155 THR n 1 156 LYS n 1 157 ASP n 1 158 GLY n 1 159 ASP n 1 160 ILE n 1 161 GLY n 1 162 ALA n 1 163 VAL n 1 164 ALA n 1 165 LEU n 1 166 ASP n 1 167 TYR n 1 168 PRO n 1 169 ALA n 1 170 GLY n 1 171 THR n 1 172 SER n 1 173 GLY n 1 174 SER n 1 175 PRO n 1 176 ILE n 1 177 LEU n 1 178 ASP n 1 179 LYS n 1 180 CYS n 1 181 GLY n 1 182 ARG n 1 183 VAL n 1 184 ILE n 1 185 GLY n 1 186 LEU n 1 187 TYR n 1 188 GLY n 1 189 ASN n 1 190 GLY n 1 191 VAL n 1 192 VAL n 1 193 ILE n 1 194 LYS n 1 195 ASN n 1 196 GLY n 1 197 SER n 1 198 TYR n 1 199 VAL n 1 200 SER n 1 201 ALA n 1 202 ILE n 1 203 THR n 1 204 GLN n 1 205 GLY n 1 206 LYS n 1 207 ARG n 1 208 GLU n 1 209 GLU n 1 210 GLU n 1 211 THR n 1 212 PRO n 1 213 VAL n 1 214 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 46 ? ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 47 214 ? ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1JHM non-polymer . '~{N}-[3-chloranyl-5-[(2-methyl-1-oxidanyl-propan-2-yl)carbamoyl]phenyl]-5-[(dimethylamino)methyl]-1~{H}-pyrrole-2-carboxamide' ? 'C19 H25 Cl N4 O3' 392.880 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 44 ? ? ? AAA . n A 1 2 MET 2 45 ? ? ? AAA . n A 1 3 GLY 3 46 ? ? ? AAA . n A 1 4 LYS 4 47 ? ? ? AAA . n A 1 5 SER 5 48 ? ? ? AAA . n A 1 6 VAL 6 49 49 VAL VAL AAA . n A 1 7 ASP 7 50 50 ASP ASP AAA . n A 1 8 MET 8 51 51 MET MET AAA . n A 1 9 TYR 9 52 52 TYR TYR AAA . n A 1 10 ILE 10 53 53 ILE ILE AAA . n A 1 11 GLU 11 54 54 GLU GLU AAA . n A 1 12 ARG 12 55 55 ARG ARG AAA . n A 1 13 ALA 13 56 56 ALA ALA AAA . n A 1 14 GLY 14 57 57 GLY GLY AAA . n A 1 15 ASP 15 58 58 ASP ASP AAA . n A 1 16 ILE 16 59 59 ILE ILE AAA . n A 1 17 THR 17 60 60 THR THR AAA . n A 1 18 TRP 18 61 61 TRP TRP AAA . n A 1 19 GLU 19 62 62 GLU GLU AAA . n A 1 20 LYS 20 63 63 LYS LYS AAA . n A 1 21 ASP 21 64 64 ASP ASP AAA . n A 1 22 ALA 22 65 65 ALA ALA AAA . n A 1 23 GLU 23 66 66 GLU GLU AAA . n A 1 24 VAL 24 67 67 VAL VAL AAA . n A 1 25 THR 25 68 68 THR THR AAA . n A 1 26 GLY 26 69 69 GLY GLY AAA . n A 1 27 ASN 27 70 70 ASN ASN AAA . n A 1 28 SER 28 71 71 SER SER AAA . n A 1 29 PRO 29 72 72 PRO PRO AAA . n A 1 30 ARG 30 73 73 ARG ARG AAA . n A 1 31 LEU 31 74 74 LEU LEU AAA . n A 1 32 ASP 32 75 75 ASP ASP AAA . n A 1 33 VAL 33 76 76 VAL VAL AAA . n A 1 34 ALA 34 77 77 ALA ALA AAA . n A 1 35 LEU 35 78 78 LEU LEU AAA . n A 1 36 ASP 36 79 79 ASP ASP AAA . n A 1 37 GLU 37 80 80 GLU GLU AAA . n A 1 38 SER 38 81 81 SER SER AAA . n A 1 39 GLY 39 82 82 GLY GLY AAA . n A 1 40 ASP 40 83 83 ASP ASP AAA . n A 1 41 PHE 41 84 84 PHE PHE AAA . n A 1 42 SER 42 85 85 SER SER AAA . n A 1 43 LEU 43 86 86 LEU LEU AAA . n A 1 44 VAL 44 87 ? ? ? AAA . n A 1 45 GLU 45 88 ? ? ? AAA . n A 1 46 GLU 46 89 ? ? ? AAA . n A 1 47 MET 47 90 ? ? ? AAA . n A 1 48 LYS 48 91 ? ? ? AAA . n A 1 49 GLU 49 92 ? ? ? AAA . n A 1 50 VAL 50 93 ? ? ? AAA . n A 1 51 LYS 51 94 ? ? ? AAA . n A 1 52 LYS 52 95 ? ? ? AAA . n A 1 53 GLY 53 96 ? ? ? AAA . n A 1 54 GLU 54 97 ? ? ? AAA . n A 1 55 THR 55 98 ? ? ? AAA . n A 1 56 THR 56 99 ? ? ? AAA . n A 1 57 ASP 57 100 ? ? ? AAA . n A 1 58 GLY 58 101 ? ? ? AAA . n A 1 59 VAL 59 102 ? ? ? AAA . n A 1 60 TYR 60 103 ? ? ? AAA . n A 1 61 ARG 61 104 ? ? ? AAA . n A 1 62 VAL 62 105 ? ? ? AAA . n A 1 63 MET 63 106 ? ? ? AAA . n A 1 64 THR 64 107 ? ? ? AAA . n A 1 65 ARG 65 108 ? ? ? AAA . n A 1 66 ARG 66 109 ? ? ? AAA . n A 1 67 LEU 67 110 ? ? ? AAA . n A 1 68 LEU 68 111 ? ? ? AAA . n A 1 69 GLY 69 112 ? ? ? AAA . n A 1 70 SER 70 113 ? ? ? AAA . n A 1 71 THR 71 114 ? ? ? AAA . n A 1 72 GLN 72 115 ? ? ? AAA . n A 1 73 VAL 73 116 ? ? ? AAA . n A 1 74 GLY 74 117 ? ? ? AAA . n A 1 75 VAL 75 118 ? ? ? AAA . n A 1 76 GLY 76 119 ? ? ? AAA . n A 1 77 VAL 77 120 ? ? ? AAA . n A 1 78 MET 78 121 ? ? ? AAA . n A 1 79 GLN 79 122 ? ? ? AAA . n A 1 80 GLU 80 123 ? ? ? AAA . n A 1 81 GLY 81 124 ? ? ? AAA . n A 1 82 VAL 82 125 ? ? ? AAA . n A 1 83 PHE 83 126 ? ? ? AAA . n A 1 84 HIS 84 127 ? ? ? AAA . n A 1 85 THR 85 128 ? ? ? AAA . n A 1 86 MET 86 129 ? ? ? AAA . n A 1 87 TRP 87 130 ? ? ? AAA . n A 1 88 HIS 88 131 ? ? ? AAA . n A 1 89 VAL 89 132 ? ? ? AAA . n A 1 90 THR 90 133 ? ? ? AAA . n A 1 91 LYS 91 134 ? ? ? AAA . n A 1 92 GLY 92 135 ? ? ? AAA . n A 1 93 ALA 93 136 ? ? ? AAA . n A 1 94 ALA 94 137 ? ? ? AAA . n A 1 95 LEU 95 138 ? ? ? AAA . n A 1 96 ARG 96 139 ? ? ? AAA . n A 1 97 SER 97 140 ? ? ? AAA . n A 1 98 GLY 98 141 ? ? ? AAA . n A 1 99 GLU 99 142 ? ? ? AAA . n A 1 100 GLY 100 143 ? ? ? AAA . n A 1 101 ARG 101 144 ? ? ? AAA . n A 1 102 LEU 102 145 ? ? ? AAA . n A 1 103 ASP 103 146 ? ? ? AAA . n A 1 104 PRO 104 147 ? ? ? AAA . n A 1 105 TYR 105 148 ? ? ? AAA . n A 1 106 TRP 106 149 ? ? ? AAA . n A 1 107 GLY 107 150 ? ? ? AAA . n A 1 108 ASP 108 151 ? ? ? AAA . n A 1 109 VAL 109 152 ? ? ? AAA . n A 1 110 LYS 110 153 ? ? ? AAA . n A 1 111 GLN 111 154 ? ? ? AAA . n A 1 112 ASP 112 155 ? ? ? AAA . n A 1 113 LEU 113 156 ? ? ? AAA . n A 1 114 VAL 114 157 ? ? ? AAA . n A 1 115 SER 115 158 ? ? ? AAA . n A 1 116 TYR 116 159 ? ? ? AAA . n A 1 117 CYS 117 160 ? ? ? AAA . n A 1 118 GLY 118 161 ? ? ? AAA . n A 1 119 PRO 119 162 ? ? ? AAA . n A 1 120 TRP 120 163 ? ? ? AAA . n A 1 121 LYS 121 164 ? ? ? AAA . n A 1 122 LEU 122 165 ? ? ? AAA . n A 1 123 ASP 123 166 ? ? ? AAA . n A 1 124 ALA 124 167 ? ? ? AAA . n A 1 125 ALA 125 168 ? ? ? AAA . n A 1 126 TRP 126 169 ? ? ? AAA . n A 1 127 ASP 127 170 ? ? ? AAA . n A 1 128 GLY 128 171 ? ? ? AAA . n A 1 129 LEU 129 172 ? ? ? AAA . n A 1 130 SER 130 173 ? ? ? AAA . n A 1 131 GLU 131 174 ? ? ? AAA . n A 1 132 VAL 132 175 ? ? ? AAA . n A 1 133 GLN 133 176 ? ? ? AAA . n A 1 134 LEU 134 177 ? ? ? AAA . n A 1 135 LEU 135 178 ? ? ? AAA . n A 1 136 ALA 136 179 ? ? ? AAA . n A 1 137 VAL 137 180 ? ? ? AAA . n A 1 138 PRO 138 181 ? ? ? AAA . n A 1 139 PRO 139 182 ? ? ? AAA . n A 1 140 GLY 140 183 ? ? ? AAA . n A 1 141 GLU 141 184 ? ? ? AAA . n A 1 142 ARG 142 185 ? ? ? AAA . n A 1 143 ALA 143 186 ? ? ? AAA . n A 1 144 LYS 144 187 ? ? ? AAA . n A 1 145 ASN 145 188 ? ? ? AAA . n A 1 146 ILE 146 189 ? ? ? AAA . n A 1 147 GLN 147 190 ? ? ? AAA . n A 1 148 THR 148 191 ? ? ? AAA . n A 1 149 LEU 149 192 ? ? ? AAA . n A 1 150 PRO 150 193 ? ? ? AAA . n A 1 151 GLY 151 194 ? ? ? AAA . n A 1 152 ILE 152 195 ? ? ? AAA . n A 1 153 PHE 153 196 ? ? ? AAA . n A 1 154 LYS 154 197 ? ? ? AAA . n A 1 155 THR 155 198 ? ? ? AAA . n A 1 156 LYS 156 199 ? ? ? AAA . n A 1 157 ASP 157 200 ? ? ? AAA . n A 1 158 GLY 158 201 ? ? ? AAA . n A 1 159 ASP 159 202 ? ? ? AAA . n A 1 160 ILE 160 203 ? ? ? AAA . n A 1 161 GLY 161 204 ? ? ? AAA . n A 1 162 ALA 162 205 ? ? ? AAA . n A 1 163 VAL 163 206 ? ? ? AAA . n A 1 164 ALA 164 207 ? ? ? AAA . n A 1 165 LEU 165 208 ? ? ? AAA . n A 1 166 ASP 166 209 ? ? ? AAA . n A 1 167 TYR 167 210 ? ? ? AAA . n A 1 168 PRO 168 211 ? ? ? AAA . n A 1 169 ALA 169 212 ? ? ? AAA . n A 1 170 GLY 170 213 ? ? ? AAA . n A 1 171 THR 171 214 ? ? ? AAA . n A 1 172 SER 172 215 ? ? ? AAA . n A 1 173 GLY 173 216 ? ? ? AAA . n A 1 174 SER 174 217 ? ? ? AAA . n A 1 175 PRO 175 218 ? ? ? AAA . n A 1 176 ILE 176 219 ? ? ? AAA . n A 1 177 LEU 177 220 ? ? ? AAA . n A 1 178 ASP 178 221 ? ? ? AAA . n A 1 179 LYS 179 222 ? ? ? AAA . n A 1 180 CYS 180 223 ? ? ? AAA . n A 1 181 GLY 181 224 ? ? ? AAA . n A 1 182 ARG 182 225 ? ? ? AAA . n A 1 183 VAL 183 226 ? ? ? AAA . n A 1 184 ILE 184 227 ? ? ? AAA . n A 1 185 GLY 185 228 ? ? ? AAA . n A 1 186 LEU 186 229 ? ? ? AAA . n A 1 187 TYR 187 230 ? ? ? AAA . n A 1 188 GLY 188 231 ? ? ? AAA . n A 1 189 ASN 189 232 ? ? ? AAA . n A 1 190 GLY 190 233 ? ? ? AAA . n A 1 191 VAL 191 234 ? ? ? AAA . n A 1 192 VAL 192 235 ? ? ? AAA . n A 1 193 ILE 193 236 ? ? ? AAA . n A 1 194 LYS 194 237 ? ? ? AAA . n A 1 195 ASN 195 238 ? ? ? AAA . n A 1 196 GLY 196 239 ? ? ? AAA . n A 1 197 SER 197 240 ? ? ? AAA . n A 1 198 TYR 198 241 ? ? ? AAA . n A 1 199 VAL 199 242 ? ? ? AAA . n A 1 200 SER 200 243 ? ? ? AAA . n A 1 201 ALA 201 244 ? ? ? AAA . n A 1 202 ILE 202 245 ? ? ? AAA . n A 1 203 THR 203 246 ? ? ? AAA . n A 1 204 GLN 204 247 ? ? ? AAA . n A 1 205 GLY 205 248 ? ? ? AAA . n A 1 206 LYS 206 249 ? ? ? AAA . n A 1 207 ARG 207 250 ? ? ? AAA . n A 1 208 GLU 208 251 ? ? ? AAA . n A 1 209 GLU 209 252 ? ? ? AAA . n A 1 210 GLU 210 253 ? ? ? AAA . n A 1 211 THR 211 254 ? ? ? AAA . n A 1 212 PRO 212 255 ? ? ? AAA . n A 1 213 VAL 213 256 ? ? ? AAA . n A 1 214 GLU 214 257 ? ? ? AAA . n B 1 1 SER 1 -36 ? ? ? BBB . n B 1 2 MET 2 -35 ? ? ? BBB . n B 1 3 GLY 3 -34 ? ? ? BBB . n B 1 4 LYS 4 -33 ? ? ? BBB . n B 1 5 SER 5 -32 ? ? ? BBB . n B 1 6 VAL 6 -31 ? ? ? BBB . n B 1 7 ASP 7 -30 ? ? ? BBB . n B 1 8 MET 8 -29 ? ? ? BBB . n B 1 9 TYR 9 -28 ? ? ? BBB . n B 1 10 ILE 10 -27 ? ? ? BBB . n B 1 11 GLU 11 -26 ? ? ? BBB . n B 1 12 ARG 12 -25 ? ? ? BBB . n B 1 13 ALA 13 -24 ? ? ? BBB . n B 1 14 GLY 14 -23 ? ? ? BBB . n B 1 15 ASP 15 -22 ? ? ? BBB . n B 1 16 ILE 16 -21 ? ? ? BBB . n B 1 17 THR 17 -20 ? ? ? BBB . n B 1 18 TRP 18 -19 ? ? ? BBB . n B 1 19 GLU 19 -18 ? ? ? BBB . n B 1 20 LYS 20 -17 ? ? ? BBB . n B 1 21 ASP 21 -16 ? ? ? BBB . n B 1 22 ALA 22 -15 ? ? ? BBB . n B 1 23 GLU 23 -14 ? ? ? BBB . n B 1 24 VAL 24 -13 ? ? ? BBB . n B 1 25 THR 25 -12 ? ? ? BBB . n B 1 26 GLY 26 -11 ? ? ? BBB . n B 1 27 ASN 27 -10 ? ? ? BBB . n B 1 28 SER 28 -9 ? ? ? BBB . n B 1 29 PRO 29 -8 ? ? ? BBB . n B 1 30 ARG 30 -7 ? ? ? BBB . n B 1 31 LEU 31 -6 ? ? ? BBB . n B 1 32 ASP 32 -5 ? ? ? BBB . n B 1 33 VAL 33 -4 ? ? ? BBB . n B 1 34 ALA 34 -3 ? ? ? BBB . n B 1 35 LEU 35 -2 ? ? ? BBB . n B 1 36 ASP 36 -1 ? ? ? BBB . n B 1 37 GLU 37 0 ? ? ? BBB . n B 1 38 SER 38 1 ? ? ? BBB . n B 1 39 GLY 39 2 ? ? ? BBB . n B 1 40 ASP 40 3 ? ? ? BBB . n B 1 41 PHE 41 4 ? ? ? BBB . n B 1 42 SER 42 5 ? ? ? BBB . n B 1 43 LEU 43 6 ? ? ? BBB . n B 1 44 VAL 44 7 ? ? ? BBB . n B 1 45 GLU 45 8 ? ? ? BBB . n B 1 46 GLU 46 9 ? ? ? BBB . n B 1 47 MET 47 10 ? ? ? BBB . n B 1 48 LYS 48 11 ? ? ? BBB . n B 1 49 GLU 49 12 ? ? ? BBB . n B 1 50 VAL 50 13 ? ? ? BBB . n B 1 51 LYS 51 14 ? ? ? BBB . n B 1 52 LYS 52 15 ? ? ? BBB . n B 1 53 GLY 53 16 ? ? ? BBB . n B 1 54 GLU 54 17 ? ? ? BBB . n B 1 55 THR 55 18 18 THR THR BBB . n B 1 56 THR 56 19 19 THR THR BBB . n B 1 57 ASP 57 20 20 ASP ASP BBB . n B 1 58 GLY 58 21 21 GLY GLY BBB . n B 1 59 VAL 59 22 22 VAL VAL BBB . n B 1 60 TYR 60 23 23 TYR TYR BBB . n B 1 61 ARG 61 24 24 ARG ARG BBB . n B 1 62 VAL 62 25 25 VAL VAL BBB . n B 1 63 MET 63 26 26 MET MET BBB . n B 1 64 THR 64 27 27 THR THR BBB . n B 1 65 ARG 65 28 28 ARG ARG BBB . n B 1 66 ARG 66 29 29 ARG ARG BBB . n B 1 67 LEU 67 30 30 LEU LEU BBB . n B 1 68 LEU 68 31 31 LEU LEU BBB . n B 1 69 GLY 69 32 32 GLY GLY BBB . n B 1 70 SER 70 33 33 SER SER BBB . n B 1 71 THR 71 34 34 THR THR BBB . n B 1 72 GLN 72 35 35 GLN GLN BBB . n B 1 73 VAL 73 36 36 VAL VAL BBB . n B 1 74 GLY 74 37 37 GLY GLY BBB . n B 1 75 VAL 75 38 38 VAL VAL BBB . n B 1 76 GLY 76 39 39 GLY GLY BBB . n B 1 77 VAL 77 40 40 VAL VAL BBB . n B 1 78 MET 78 41 41 MET MET BBB . n B 1 79 GLN 79 42 42 GLN GLN BBB . n B 1 80 GLU 80 43 43 GLU GLU BBB . n B 1 81 GLY 81 44 44 GLY GLY BBB . n B 1 82 VAL 82 45 45 VAL VAL BBB . n B 1 83 PHE 83 46 46 PHE PHE BBB . n B 1 84 HIS 84 47 47 HIS HIS BBB . n B 1 85 THR 85 48 48 THR THR BBB . n B 1 86 MET 86 49 49 MET MET BBB . n B 1 87 TRP 87 50 50 TRP TRP BBB . n B 1 88 HIS 88 51 51 HIS HIS BBB . n B 1 89 VAL 89 52 52 VAL VAL BBB . n B 1 90 THR 90 53 53 THR THR BBB . n B 1 91 LYS 91 54 54 LYS LYS BBB . n B 1 92 GLY 92 55 55 GLY GLY BBB . n B 1 93 ALA 93 56 56 ALA ALA BBB . n B 1 94 ALA 94 57 57 ALA ALA BBB . n B 1 95 LEU 95 58 58 LEU LEU BBB . n B 1 96 ARG 96 59 59 ARG ARG BBB . n B 1 97 SER 97 60 60 SER SER BBB . n B 1 98 GLY 98 61 61 GLY GLY BBB . n B 1 99 GLU 99 62 62 GLU GLU BBB . n B 1 100 GLY 100 63 63 GLY GLY BBB . n B 1 101 ARG 101 64 64 ARG ARG BBB . n B 1 102 LEU 102 65 65 LEU LEU BBB . n B 1 103 ASP 103 66 66 ASP ASP BBB . n B 1 104 PRO 104 67 67 PRO PRO BBB . n B 1 105 TYR 105 68 68 TYR TYR BBB . n B 1 106 TRP 106 69 69 TRP TRP BBB . n B 1 107 GLY 107 70 70 GLY GLY BBB . n B 1 108 ASP 108 71 71 ASP ASP BBB . n B 1 109 VAL 109 72 72 VAL VAL BBB . n B 1 110 LYS 110 73 73 LYS LYS BBB . n B 1 111 GLN 111 74 74 GLN GLN BBB . n B 1 112 ASP 112 75 75 ASP ASP BBB . n B 1 113 LEU 113 76 76 LEU LEU BBB . n B 1 114 VAL 114 77 77 VAL VAL BBB . n B 1 115 SER 115 78 78 SER SER BBB . n B 1 116 TYR 116 79 79 TYR TYR BBB . n B 1 117 CYS 117 80 80 CYS CYS BBB . n B 1 118 GLY 118 81 81 GLY GLY BBB . n B 1 119 PRO 119 82 82 PRO PRO BBB . n B 1 120 TRP 120 83 83 TRP TRP BBB . n B 1 121 LYS 121 84 84 LYS LYS BBB . n B 1 122 LEU 122 85 85 LEU LEU BBB . n B 1 123 ASP 123 86 86 ASP ASP BBB . n B 1 124 ALA 124 87 87 ALA ALA BBB . n B 1 125 ALA 125 88 88 ALA ALA BBB . n B 1 126 TRP 126 89 89 TRP TRP BBB . n B 1 127 ASP 127 90 90 ASP ASP BBB . n B 1 128 GLY 128 91 91 GLY GLY BBB . n B 1 129 LEU 129 92 92 LEU LEU BBB . n B 1 130 SER 130 93 93 SER SER BBB . n B 1 131 GLU 131 94 94 GLU GLU BBB . n B 1 132 VAL 132 95 95 VAL VAL BBB . n B 1 133 GLN 133 96 96 GLN GLN BBB . n B 1 134 LEU 134 97 97 LEU LEU BBB . n B 1 135 LEU 135 98 98 LEU LEU BBB . n B 1 136 ALA 136 99 99 ALA ALA BBB . n B 1 137 VAL 137 100 100 VAL VAL BBB . n B 1 138 PRO 138 101 101 PRO PRO BBB . n B 1 139 PRO 139 102 102 PRO PRO BBB . n B 1 140 GLY 140 103 103 GLY GLY BBB . n B 1 141 GLU 141 104 104 GLU GLU BBB . n B 1 142 ARG 142 105 105 ARG ARG BBB . n B 1 143 ALA 143 106 106 ALA ALA BBB . n B 1 144 LYS 144 107 107 LYS LYS BBB . n B 1 145 ASN 145 108 108 ASN ASN BBB . n B 1 146 ILE 146 109 109 ILE ILE BBB . n B 1 147 GLN 147 110 110 GLN GLN BBB . n B 1 148 THR 148 111 111 THR THR BBB . n B 1 149 LEU 149 112 112 LEU LEU BBB . n B 1 150 PRO 150 113 113 PRO PRO BBB . n B 1 151 GLY 151 114 114 GLY GLY BBB . n B 1 152 ILE 152 115 115 ILE ILE BBB . n B 1 153 PHE 153 116 116 PHE PHE BBB . n B 1 154 LYS 154 117 117 LYS LYS BBB . n B 1 155 THR 155 118 118 THR THR BBB . n B 1 156 LYS 156 119 119 LYS LYS BBB . n B 1 157 ASP 157 120 120 ASP ASP BBB . n B 1 158 GLY 158 121 121 GLY GLY BBB . n B 1 159 ASP 159 122 122 ASP ASP BBB . n B 1 160 ILE 160 123 123 ILE ILE BBB . n B 1 161 GLY 161 124 124 GLY GLY BBB . n B 1 162 ALA 162 125 125 ALA ALA BBB . n B 1 163 VAL 163 126 126 VAL VAL BBB . n B 1 164 ALA 164 127 127 ALA ALA BBB . n B 1 165 LEU 165 128 128 LEU LEU BBB . n B 1 166 ASP 166 129 129 ASP ASP BBB . n B 1 167 TYR 167 130 130 TYR TYR BBB . n B 1 168 PRO 168 131 131 PRO PRO BBB . n B 1 169 ALA 169 132 132 ALA ALA BBB . n B 1 170 GLY 170 133 133 GLY GLY BBB . n B 1 171 THR 171 134 134 THR THR BBB . n B 1 172 SER 172 135 135 SER SER BBB . n B 1 173 GLY 173 136 136 GLY GLY BBB . n B 1 174 SER 174 137 137 SER SER BBB . n B 1 175 PRO 175 138 138 PRO PRO BBB . n B 1 176 ILE 176 139 139 ILE ILE BBB . n B 1 177 LEU 177 140 140 LEU LEU BBB . n B 1 178 ASP 178 141 141 ASP ASP BBB . n B 1 179 LYS 179 142 142 LYS LYS BBB . n B 1 180 CYS 180 143 143 CYS CYS BBB . n B 1 181 GLY 181 144 144 GLY GLY BBB . n B 1 182 ARG 182 145 145 ARG ARG BBB . n B 1 183 VAL 183 146 146 VAL VAL BBB . n B 1 184 ILE 184 147 147 ILE ILE BBB . n B 1 185 GLY 185 148 148 GLY GLY BBB . n B 1 186 LEU 186 149 149 LEU LEU BBB . n B 1 187 TYR 187 150 150 TYR TYR BBB . n B 1 188 GLY 188 151 151 GLY GLY BBB . n B 1 189 ASN 189 152 152 ASN ASN BBB . n B 1 190 GLY 190 153 153 GLY GLY BBB . n B 1 191 VAL 191 154 154 VAL VAL BBB . n B 1 192 VAL 192 155 155 VAL VAL BBB . n B 1 193 ILE 193 156 156 ILE ILE BBB . n B 1 194 LYS 194 157 157 LYS LYS BBB . n B 1 195 ASN 195 158 158 ASN ASN BBB . n B 1 196 GLY 196 159 159 GLY GLY BBB . n B 1 197 SER 197 160 160 SER SER BBB . n B 1 198 TYR 198 161 161 TYR TYR BBB . n B 1 199 VAL 199 162 162 VAL VAL BBB . n B 1 200 SER 200 163 163 SER SER BBB . n B 1 201 ALA 201 164 164 ALA ALA BBB . n B 1 202 ILE 202 165 165 ILE ILE BBB . n B 1 203 THR 203 166 166 THR THR BBB . n B 1 204 GLN 204 167 167 GLN GLN BBB . n B 1 205 GLY 205 168 168 GLY GLY BBB . n B 1 206 LYS 206 169 169 LYS LYS BBB . n B 1 207 ARG 207 170 170 ARG ARG BBB . n B 1 208 GLU 208 171 ? ? ? BBB . n B 1 209 GLU 209 172 ? ? ? BBB . n B 1 210 GLU 210 173 ? ? ? BBB . n B 1 211 THR 211 174 ? ? ? BBB . n B 1 212 PRO 212 175 ? ? ? BBB . n B 1 213 VAL 213 176 ? ? ? BBB . n B 1 214 GLU 214 177 ? ? ? BBB . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1JHM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1JHM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 A1JHM 1 201 201 A1JHM 373 BBB . D 3 NA 1 202 1 NA NA BBB . E 4 HOH 1 301 26 HOH HOH AAA . E 4 HOH 2 302 9 HOH HOH AAA . E 4 HOH 3 303 2 HOH HOH AAA . E 4 HOH 4 304 12 HOH HOH AAA . E 4 HOH 5 305 23 HOH HOH AAA . E 4 HOH 6 306 6 HOH HOH AAA . E 4 HOH 7 307 21 HOH HOH AAA . E 4 HOH 8 308 33 HOH HOH AAA . E 4 HOH 9 309 22 HOH HOH AAA . E 4 HOH 10 310 39 HOH HOH AAA . F 4 HOH 1 301 32 HOH HOH BBB . F 4 HOH 2 302 24 HOH HOH BBB . F 4 HOH 3 303 28 HOH HOH BBB . F 4 HOH 4 304 16 HOH HOH BBB . F 4 HOH 5 305 27 HOH HOH BBB . F 4 HOH 6 306 3 HOH HOH BBB . F 4 HOH 7 307 25 HOH HOH BBB . F 4 HOH 8 308 35 HOH HOH BBB . F 4 HOH 9 309 11 HOH HOH BBB . F 4 HOH 10 310 36 HOH HOH BBB . F 4 HOH 11 311 20 HOH HOH BBB . F 4 HOH 12 312 15 HOH HOH BBB . F 4 HOH 13 313 18 HOH HOH BBB . F 4 HOH 14 314 14 HOH HOH BBB . F 4 HOH 15 315 19 HOH HOH BBB . F 4 HOH 16 316 17 HOH HOH BBB . F 4 HOH 17 317 29 HOH HOH BBB . F 4 HOH 18 318 8 HOH HOH BBB . F 4 HOH 19 319 37 HOH HOH BBB . F 4 HOH 20 320 1 HOH HOH BBB . F 4 HOH 21 321 31 HOH HOH BBB . F 4 HOH 22 322 7 HOH HOH BBB . F 4 HOH 23 323 5 HOH HOH BBB . F 4 HOH 24 324 30 HOH HOH BBB . F 4 HOH 25 325 10 HOH HOH BBB . F 4 HOH 26 326 4 HOH HOH BBB . F 4 HOH 27 327 38 HOH HOH BBB . F 4 HOH 28 328 34 HOH HOH BBB . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AAA ASP 64 ? CG ? A ASP 21 CG 2 1 Y 1 AAA ASP 64 ? OD1 ? A ASP 21 OD1 3 1 Y 1 AAA ASP 64 ? OD2 ? A ASP 21 OD2 4 1 Y 1 BBB LYS 142 ? CG ? B LYS 179 CG 5 1 Y 1 BBB LYS 142 ? CD ? B LYS 179 CD 6 1 Y 1 BBB LYS 142 ? CE ? B LYS 179 CE 7 1 Y 1 BBB LYS 142 ? NZ ? B LYS 179 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 ? 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9RM4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.420 _cell.length_a_esd ? _cell.length_b 42.420 _cell.length_b_esd ? _cell.length_c 215.960 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9RM4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 95 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9RM4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-11-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92124 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92124 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9RM4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 42.456 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15473 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.124 _reflns.pdbx_Rpim_I_all 0.040 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.118 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 8.94 42.42 ? ? ? ? ? ? 230 ? ? ? ? ? ? ? ? ? ? ? 9.2 ? ? ? 0.035 0.013 ? 1 1 1.000 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? ? 1.95 2.00 ? ? ? ? ? ? 1050 ? ? ? ? ? ? ? ? ? ? ? 18.2 ? ? ? 3.158 1.000 ? 2 1 0.654 ? ? ? ? 2.994 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 1.264 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] 1.264 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -2.529 _refine.B_iso_max ? _refine.B_iso_mean 48.782 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.933 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9RM4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.950 _refine.ls_d_res_low 42.456 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15393 _refine.ls_number_reflns_R_free 786 _refine.ls_number_reflns_R_work 14607 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.968 _refine.ls_percent_reflns_R_free 5.106 _refine.ls_R_factor_all 0.218 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2782 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2152 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.181 _refine.pdbx_overall_ESU_R_Free 0.179 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.329 _refine.overall_SU_ML 0.175 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.950 _refine_hist.d_res_low 42.456 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1504 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1438 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 1525 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1420 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.586 1.640 2080 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 1.267 1.585 3279 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.956 5.000 197 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 31.588 21.667 72 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.830 15.000 240 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 23.082 15.000 10 ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.066 0.200 193 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1737 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 327 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.186 0.200 240 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.185 0.200 1265 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.159 0.200 693 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.077 0.200 697 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.167 0.200 48 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.006 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.117 0.200 5 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.203 0.200 28 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.138 0.200 4 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 1.443 2.860 773 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.436 2.857 772 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 2.294 4.278 966 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 2.293 4.283 967 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 1.741 3.126 751 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.740 3.128 752 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 2.756 4.579 1111 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 2.754 4.581 1112 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 5.273 32.452 1606 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 5.272 32.466 1607 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.950 2.001 . . 69 1049 100.0000 . . . . 0.352 . . . . . . . . . . . . . . . 0.421 'X-RAY DIFFRACTION' 2.001 2.055 . . 45 1008 100.0000 . . . . 0.338 . . . . . . . . . . . . . . . 0.367 'X-RAY DIFFRACTION' 2.055 2.115 . . 58 999 100.0000 . . . . 0.316 . . . . . . . . . . . . . . . 0.274 'X-RAY DIFFRACTION' 2.115 2.180 . . 55 947 100.0000 . . . . 0.282 . . . . . . . . . . . . . . . 0.261 'X-RAY DIFFRACTION' 2.180 2.252 . . 46 958 99.9005 . . . . 0.263 . . . . . . . . . . . . . . . 0.319 'X-RAY DIFFRACTION' 2.252 2.331 . . 35 921 100.0000 . . . . 0.240 . . . . . . . . . . . . . . . 0.270 'X-RAY DIFFRACTION' 2.331 2.419 . . 39 886 100.0000 . . . . 0.222 . . . . . . . . . . . . . . . 0.298 'X-RAY DIFFRACTION' 2.419 2.517 . . 46 864 99.8902 . . . . 0.245 . . . . . . . . . . . . . . . 0.342 'X-RAY DIFFRACTION' 2.517 2.629 . . 43 825 100.0000 . . . . 0.230 . . . . . . . . . . . . . . . 0.311 'X-RAY DIFFRACTION' 2.629 2.758 . . 32 787 100.0000 . . . . 0.228 . . . . . . . . . . . . . . . 0.199 'X-RAY DIFFRACTION' 2.758 2.907 . . 51 738 100.0000 . . . . 0.234 . . . . . . . . . . . . . . . 0.246 'X-RAY DIFFRACTION' 2.907 3.083 . . 41 719 100.0000 . . . . 0.235 . . . . . . . . . . . . . . . 0.366 'X-RAY DIFFRACTION' 3.083 3.296 . . 49 669 100.0000 . . . . 0.214 . . . . . . . . . . . . . . . 0.243 'X-RAY DIFFRACTION' 3.296 3.560 . . 29 646 100.0000 . . . . 0.211 . . . . . . . . . . . . . . . 0.257 'X-RAY DIFFRACTION' 3.560 3.900 . . 28 587 99.8377 . . . . 0.183 . . . . . . . . . . . . . . . 0.320 'X-RAY DIFFRACTION' 3.900 4.360 . . 34 537 100.0000 . . . . 0.158 . . . . . . . . . . . . . . . 0.231 'X-RAY DIFFRACTION' 4.360 5.034 . . 29 486 100.0000 . . . . 0.150 . . . . . . . . . . . . . . . 0.218 'X-RAY DIFFRACTION' 5.034 6.164 . . 23 427 100.0000 . . . . 0.198 . . . . . . . . . . . . . . . 0.266 'X-RAY DIFFRACTION' 6.164 8.714 . . 24 336 100.0000 . . . . 0.219 . . . . . . . . . . . . . . . 0.372 'X-RAY DIFFRACTION' 8.714 42.4 . . 10 218 99.1304 . . . . 0.251 . . . . . . . . . . . . . . . 0.200 # _struct.entry_id 9RM4 _struct.title 'Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015373' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9RM4 _struct_keywords.text 'NS2B-NS3 protease, inhibitor, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP POLG_ZIKV Q32ZE1 ? 1 GKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE 1414 2 UNP POLG_ZIKV Q32ZE1 ? 1 ;KEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWD GLSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR EEETPVE ; 1509 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9RM4 AAA 3 ? 46 ? Q32ZE1 1414 ? 1457 ? 46 89 2 2 9RM4 AAA 48 ? 214 ? Q32ZE1 1509 ? 1675 ? 91 257 3 1 9RM4 BBB 3 ? 46 ? Q32ZE1 1414 ? 1457 ? -34 9 4 2 9RM4 BBB 48 ? 214 ? Q32ZE1 1509 ? 1675 ? 11 177 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9RM4 SER AAA 1 ? UNP Q32ZE1 ? ? 'expression tag' 44 1 1 9RM4 MET AAA 2 ? UNP Q32ZE1 ? ? 'expression tag' 45 2 1 9RM4 MET AAA 47 ? UNP Q32ZE1 ? ? linker 90 3 2 9RM4 LYS AAA 144 ? UNP Q32ZE1 ARG 1605 conflict 187 4 3 9RM4 SER BBB 1 ? UNP Q32ZE1 ? ? 'expression tag' -36 5 3 9RM4 MET BBB 2 ? UNP Q32ZE1 ? ? 'expression tag' -35 6 3 9RM4 MET BBB 47 ? UNP Q32ZE1 ? ? linker 10 7 4 9RM4 LYS BBB 144 ? UNP Q32ZE1 ARG 1605 conflict 107 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4240 ? 1 MORE -33 ? 1 'SSA (A^2)' 9430 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TRP B 87 ? LYS B 91 ? TRP BBB 50 LYS BBB 54 1 ? 5 HELX_P HELX_P2 AA2 PRO B 168 ? SER B 172 ? PRO BBB 131 SER BBB 135 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 180 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 180 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id BBB _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 143 _struct_conn.ptnr2_auth_asym_id BBB _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 143 _struct_conn.ptnr2_symmetry 8_444 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.031 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 180 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 180 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id BBB _pdbx_modification_feature.auth_seq_id 143 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id BBB _pdbx_modification_feature.modified_residue_auth_seq_id 143 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 8_444 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 5 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY B 100 ? LEU B 102 ? GLY BBB 63 LEU BBB 65 AA1 2 LEU B 95 ? SER B 97 ? LEU BBB 58 SER BBB 60 AA1 3 MET A 8 ? GLY A 14 ? MET AAA 51 GLY AAA 57 AA1 4 GLY B 58 ? THR B 64 ? GLY BBB 21 THR BBB 27 AA1 5 THR B 71 ? GLN B 79 ? THR BBB 34 GLN BBB 42 AA1 6 VAL B 82 ? MET B 86 ? VAL BBB 45 MET BBB 49 AA1 7 LEU B 113 ? TYR B 116 ? LEU BBB 76 TYR BBB 79 AA1 8 PRO B 104 ? ASP B 108 ? PRO BBB 67 ASP BBB 71 AA2 1 GLU A 23 ? VAL A 24 ? GLU AAA 66 VAL AAA 67 AA2 2 LYS B 144 ? THR B 148 ? LYS BBB 107 THR BBB 111 AA2 3 VAL B 132 ? ALA B 136 ? VAL BBB 95 ALA BBB 99 AA2 4 SER B 174 ? LEU B 177 ? SER BBB 137 LEU BBB 140 AA2 5 VAL B 183 ? TYR B 187 ? VAL BBB 146 TYR BBB 150 AA3 1 ARG A 30 ? ASP A 32 ? ARG AAA 73 ASP AAA 75 AA3 2 GLY B 151 ? THR B 155 ? GLY BBB 114 THR BBB 118 AA3 3 GLY B 158 ? VAL B 163 ? GLY BBB 121 VAL BBB 126 AA3 4 TYR B 198 ? ALA B 201 ? TYR BBB 161 ALA BBB 164 AA3 5 GLY B 190 ? VAL B 192 ? GLY BBB 153 VAL BBB 155 AA4 1 ALA A 34 ? LEU A 35 ? ALA AAA 77 LEU AAA 78 AA4 2 PHE A 41 ? SER A 42 ? PHE AAA 84 SER AAA 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU B 102 ? O LEU BBB 65 N LEU B 95 ? N LEU BBB 58 AA1 2 3 O ARG B 96 ? O ARG BBB 59 N MET A 8 ? N MET AAA 51 AA1 3 4 N GLU A 11 ? N GLU AAA 54 O ARG B 61 ? O ARG BBB 24 AA1 4 5 N VAL B 62 ? N VAL BBB 25 O GLY B 74 ? O GLY BBB 37 AA1 5 6 N VAL B 77 ? N VAL BBB 40 O HIS B 84 ? O HIS BBB 47 AA1 6 7 N PHE B 83 ? N PHE BBB 46 O TYR B 116 ? O TYR BBB 79 AA1 7 8 O SER B 115 ? O SER BBB 78 N TYR B 105 ? N TYR BBB 68 AA2 1 2 N GLU A 23 ? N GLU AAA 66 O GLN B 147 ? O GLN BBB 110 AA2 2 3 O ILE B 146 ? O ILE BBB 109 N LEU B 134 ? N LEU BBB 97 AA2 3 4 N LEU B 135 ? N LEU BBB 98 O PRO B 175 ? O PRO BBB 138 AA2 4 5 N SER B 174 ? N SER BBB 137 O TYR B 187 ? O TYR BBB 150 AA3 1 2 N LEU A 31 ? N LEU AAA 74 O LYS B 154 ? O LYS BBB 117 AA3 2 3 N GLY B 151 ? N GLY BBB 114 O ALA B 162 ? O ALA BBB 125 AA3 3 4 N VAL B 163 ? N VAL BBB 126 O SER B 200 ? O SER BBB 163 AA3 4 5 O VAL B 199 ? O VAL BBB 162 N VAL B 191 ? N VAL BBB 154 AA4 1 2 N ALA A 34 ? N ALA AAA 77 O SER A 42 ? O SER AAA 85 # _pdbx_entry_details.entry_id 9RM4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HE2 _pdbx_validate_close_contact.auth_asym_id_1 BBB _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 47 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 BBB _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 84 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.27 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 BBB _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 104 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 BBB _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 104 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.321 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.069 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id BBB _pdbx_validate_torsion.auth_seq_id 92 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -123.34 _pdbx_validate_torsion.psi -51.42 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id BBB _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 325 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -14.4044 -1.7222 -19.0874 0.1965 ? 0.1275 ? 0.0404 ? 0.2018 ? 0.0294 ? 0.0971 ? 3.7503 ? -1.1382 ? 0.4456 ? 2.2819 ? -1.0938 ? 2.1358 ? 0.1953 ? 0.3110 ? 0.0030 ? -0.2973 ? -0.1173 ? -0.0675 ? -0.0098 ? 0.2578 ? -0.0780 ? 2 'X-RAY DIFFRACTION' ? refined -17.6395 0.0255 -15.9030 0.1752 ? 0.1454 ? 0.0405 ? 0.1820 ? 0.0312 ? 0.0141 ? 3.1978 ? -0.6624 ? 0.3691 ? 2.8283 ? 0.1126 ? 3.5990 ? 0.3652 ? 0.1755 ? 0.1411 ? -0.1946 ? -0.2801 ? -0.0664 ? 0.0193 ? 0.1891 ? -0.0851 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? AAA 49 ? ? ? AAA 86 ? ALL ? 2 'X-RAY DIFFRACTION' 2 ? ? BBB 18 ? ? ? BBB 201 ? ALL ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA SER 44 ? A SER 1 2 1 Y 1 AAA MET 45 ? A MET 2 3 1 Y 1 AAA GLY 46 ? A GLY 3 4 1 Y 1 AAA LYS 47 ? A LYS 4 5 1 Y 1 AAA SER 48 ? A SER 5 6 1 Y 1 AAA VAL 87 ? A VAL 44 7 1 Y 1 AAA GLU 88 ? A GLU 45 8 1 Y 1 AAA GLU 89 ? A GLU 46 9 1 Y 1 AAA MET 90 ? A MET 47 10 1 Y 1 AAA LYS 91 ? A LYS 48 11 1 Y 1 AAA GLU 92 ? A GLU 49 12 1 Y 1 AAA VAL 93 ? A VAL 50 13 1 Y 1 AAA LYS 94 ? A LYS 51 14 1 Y 1 AAA LYS 95 ? A LYS 52 15 1 Y 1 AAA GLY 96 ? A GLY 53 16 1 Y 1 AAA GLU 97 ? A GLU 54 17 1 Y 1 AAA THR 98 ? A THR 55 18 1 Y 1 AAA THR 99 ? A THR 56 19 1 Y 1 AAA ASP 100 ? A ASP 57 20 1 Y 1 AAA GLY 101 ? A GLY 58 21 1 Y 1 AAA VAL 102 ? A VAL 59 22 1 Y 1 AAA TYR 103 ? A TYR 60 23 1 Y 1 AAA ARG 104 ? A ARG 61 24 1 Y 1 AAA VAL 105 ? A VAL 62 25 1 Y 1 AAA MET 106 ? A MET 63 26 1 Y 1 AAA THR 107 ? A THR 64 27 1 Y 1 AAA ARG 108 ? A ARG 65 28 1 Y 1 AAA ARG 109 ? A ARG 66 29 1 Y 1 AAA LEU 110 ? A LEU 67 30 1 Y 1 AAA LEU 111 ? A LEU 68 31 1 Y 1 AAA GLY 112 ? A GLY 69 32 1 Y 1 AAA SER 113 ? A SER 70 33 1 Y 1 AAA THR 114 ? A THR 71 34 1 Y 1 AAA GLN 115 ? A GLN 72 35 1 Y 1 AAA VAL 116 ? A VAL 73 36 1 Y 1 AAA GLY 117 ? A GLY 74 37 1 Y 1 AAA VAL 118 ? A VAL 75 38 1 Y 1 AAA GLY 119 ? A GLY 76 39 1 Y 1 AAA VAL 120 ? A VAL 77 40 1 Y 1 AAA MET 121 ? A MET 78 41 1 Y 1 AAA GLN 122 ? A GLN 79 42 1 Y 1 AAA GLU 123 ? A GLU 80 43 1 Y 1 AAA GLY 124 ? A GLY 81 44 1 Y 1 AAA VAL 125 ? A VAL 82 45 1 Y 1 AAA PHE 126 ? A PHE 83 46 1 Y 1 AAA HIS 127 ? A HIS 84 47 1 Y 1 AAA THR 128 ? A THR 85 48 1 Y 1 AAA MET 129 ? A MET 86 49 1 Y 1 AAA TRP 130 ? A TRP 87 50 1 Y 1 AAA HIS 131 ? A HIS 88 51 1 Y 1 AAA VAL 132 ? A VAL 89 52 1 Y 1 AAA THR 133 ? A THR 90 53 1 Y 1 AAA LYS 134 ? A LYS 91 54 1 Y 1 AAA GLY 135 ? A GLY 92 55 1 Y 1 AAA ALA 136 ? A ALA 93 56 1 Y 1 AAA ALA 137 ? A ALA 94 57 1 Y 1 AAA LEU 138 ? A LEU 95 58 1 Y 1 AAA ARG 139 ? A ARG 96 59 1 Y 1 AAA SER 140 ? A SER 97 60 1 Y 1 AAA GLY 141 ? A GLY 98 61 1 Y 1 AAA GLU 142 ? A GLU 99 62 1 Y 1 AAA GLY 143 ? A GLY 100 63 1 Y 1 AAA ARG 144 ? A ARG 101 64 1 Y 1 AAA LEU 145 ? A LEU 102 65 1 Y 1 AAA ASP 146 ? A ASP 103 66 1 Y 1 AAA PRO 147 ? A PRO 104 67 1 Y 1 AAA TYR 148 ? A TYR 105 68 1 Y 1 AAA TRP 149 ? A TRP 106 69 1 Y 1 AAA GLY 150 ? A GLY 107 70 1 Y 1 AAA ASP 151 ? A ASP 108 71 1 Y 1 AAA VAL 152 ? A VAL 109 72 1 Y 1 AAA LYS 153 ? A LYS 110 73 1 Y 1 AAA GLN 154 ? A GLN 111 74 1 Y 1 AAA ASP 155 ? A ASP 112 75 1 Y 1 AAA LEU 156 ? A LEU 113 76 1 Y 1 AAA VAL 157 ? A VAL 114 77 1 Y 1 AAA SER 158 ? A SER 115 78 1 Y 1 AAA TYR 159 ? A TYR 116 79 1 Y 1 AAA CYS 160 ? A CYS 117 80 1 Y 1 AAA GLY 161 ? A GLY 118 81 1 Y 1 AAA PRO 162 ? A PRO 119 82 1 Y 1 AAA TRP 163 ? A TRP 120 83 1 Y 1 AAA LYS 164 ? A LYS 121 84 1 Y 1 AAA LEU 165 ? A LEU 122 85 1 Y 1 AAA ASP 166 ? A ASP 123 86 1 Y 1 AAA ALA 167 ? A ALA 124 87 1 Y 1 AAA ALA 168 ? A ALA 125 88 1 Y 1 AAA TRP 169 ? A TRP 126 89 1 Y 1 AAA ASP 170 ? A ASP 127 90 1 Y 1 AAA GLY 171 ? A GLY 128 91 1 Y 1 AAA LEU 172 ? A LEU 129 92 1 Y 1 AAA SER 173 ? A SER 130 93 1 Y 1 AAA GLU 174 ? A GLU 131 94 1 Y 1 AAA VAL 175 ? A VAL 132 95 1 Y 1 AAA GLN 176 ? A GLN 133 96 1 Y 1 AAA LEU 177 ? A LEU 134 97 1 Y 1 AAA LEU 178 ? A LEU 135 98 1 Y 1 AAA ALA 179 ? A ALA 136 99 1 Y 1 AAA VAL 180 ? A VAL 137 100 1 Y 1 AAA PRO 181 ? A PRO 138 101 1 Y 1 AAA PRO 182 ? A PRO 139 102 1 Y 1 AAA GLY 183 ? A GLY 140 103 1 Y 1 AAA GLU 184 ? A GLU 141 104 1 Y 1 AAA ARG 185 ? A ARG 142 105 1 Y 1 AAA ALA 186 ? A ALA 143 106 1 Y 1 AAA LYS 187 ? A LYS 144 107 1 Y 1 AAA ASN 188 ? A ASN 145 108 1 Y 1 AAA ILE 189 ? A ILE 146 109 1 Y 1 AAA GLN 190 ? A GLN 147 110 1 Y 1 AAA THR 191 ? A THR 148 111 1 Y 1 AAA LEU 192 ? A LEU 149 112 1 Y 1 AAA PRO 193 ? A PRO 150 113 1 Y 1 AAA GLY 194 ? A GLY 151 114 1 Y 1 AAA ILE 195 ? A ILE 152 115 1 Y 1 AAA PHE 196 ? A PHE 153 116 1 Y 1 AAA LYS 197 ? A LYS 154 117 1 Y 1 AAA THR 198 ? A THR 155 118 1 Y 1 AAA LYS 199 ? A LYS 156 119 1 Y 1 AAA ASP 200 ? A ASP 157 120 1 Y 1 AAA GLY 201 ? A GLY 158 121 1 Y 1 AAA ASP 202 ? A ASP 159 122 1 Y 1 AAA ILE 203 ? A ILE 160 123 1 Y 1 AAA GLY 204 ? A GLY 161 124 1 Y 1 AAA ALA 205 ? A ALA 162 125 1 Y 1 AAA VAL 206 ? A VAL 163 126 1 Y 1 AAA ALA 207 ? A ALA 164 127 1 Y 1 AAA LEU 208 ? A LEU 165 128 1 Y 1 AAA ASP 209 ? A ASP 166 129 1 Y 1 AAA TYR 210 ? A TYR 167 130 1 Y 1 AAA PRO 211 ? A PRO 168 131 1 Y 1 AAA ALA 212 ? A ALA 169 132 1 Y 1 AAA GLY 213 ? A GLY 170 133 1 Y 1 AAA THR 214 ? A THR 171 134 1 Y 1 AAA SER 215 ? A SER 172 135 1 Y 1 AAA GLY 216 ? A GLY 173 136 1 Y 1 AAA SER 217 ? A SER 174 137 1 Y 1 AAA PRO 218 ? A PRO 175 138 1 Y 1 AAA ILE 219 ? A ILE 176 139 1 Y 1 AAA LEU 220 ? A LEU 177 140 1 Y 1 AAA ASP 221 ? A ASP 178 141 1 Y 1 AAA LYS 222 ? A LYS 179 142 1 Y 1 AAA CYS 223 ? A CYS 180 143 1 Y 1 AAA GLY 224 ? A GLY 181 144 1 Y 1 AAA ARG 225 ? A ARG 182 145 1 Y 1 AAA VAL 226 ? A VAL 183 146 1 Y 1 AAA ILE 227 ? A ILE 184 147 1 Y 1 AAA GLY 228 ? A GLY 185 148 1 Y 1 AAA LEU 229 ? A LEU 186 149 1 Y 1 AAA TYR 230 ? A TYR 187 150 1 Y 1 AAA GLY 231 ? A GLY 188 151 1 Y 1 AAA ASN 232 ? A ASN 189 152 1 Y 1 AAA GLY 233 ? A GLY 190 153 1 Y 1 AAA VAL 234 ? A VAL 191 154 1 Y 1 AAA VAL 235 ? A VAL 192 155 1 Y 1 AAA ILE 236 ? A ILE 193 156 1 Y 1 AAA LYS 237 ? A LYS 194 157 1 Y 1 AAA ASN 238 ? A ASN 195 158 1 Y 1 AAA GLY 239 ? A GLY 196 159 1 Y 1 AAA SER 240 ? A SER 197 160 1 Y 1 AAA TYR 241 ? A TYR 198 161 1 Y 1 AAA VAL 242 ? A VAL 199 162 1 Y 1 AAA SER 243 ? A SER 200 163 1 Y 1 AAA ALA 244 ? A ALA 201 164 1 Y 1 AAA ILE 245 ? A ILE 202 165 1 Y 1 AAA THR 246 ? A THR 203 166 1 Y 1 AAA GLN 247 ? A GLN 204 167 1 Y 1 AAA GLY 248 ? A GLY 205 168 1 Y 1 AAA LYS 249 ? A LYS 206 169 1 Y 1 AAA ARG 250 ? A ARG 207 170 1 Y 1 AAA GLU 251 ? A GLU 208 171 1 Y 1 AAA GLU 252 ? A GLU 209 172 1 Y 1 AAA GLU 253 ? A GLU 210 173 1 Y 1 AAA THR 254 ? A THR 211 174 1 Y 1 AAA PRO 255 ? A PRO 212 175 1 Y 1 AAA VAL 256 ? A VAL 213 176 1 Y 1 AAA GLU 257 ? A GLU 214 177 1 Y 1 BBB SER -36 ? B SER 1 178 1 Y 1 BBB MET -35 ? B MET 2 179 1 Y 1 BBB GLY -34 ? B GLY 3 180 1 Y 1 BBB LYS -33 ? B LYS 4 181 1 Y 1 BBB SER -32 ? B SER 5 182 1 Y 1 BBB VAL -31 ? B VAL 6 183 1 Y 1 BBB ASP -30 ? B ASP 7 184 1 Y 1 BBB MET -29 ? B MET 8 185 1 Y 1 BBB TYR -28 ? B TYR 9 186 1 Y 1 BBB ILE -27 ? B ILE 10 187 1 Y 1 BBB GLU -26 ? B GLU 11 188 1 Y 1 BBB ARG -25 ? B ARG 12 189 1 Y 1 BBB ALA -24 ? B ALA 13 190 1 Y 1 BBB GLY -23 ? B GLY 14 191 1 Y 1 BBB ASP -22 ? B ASP 15 192 1 Y 1 BBB ILE -21 ? B ILE 16 193 1 Y 1 BBB THR -20 ? B THR 17 194 1 Y 1 BBB TRP -19 ? B TRP 18 195 1 Y 1 BBB GLU -18 ? B GLU 19 196 1 Y 1 BBB LYS -17 ? B LYS 20 197 1 Y 1 BBB ASP -16 ? B ASP 21 198 1 Y 1 BBB ALA -15 ? B ALA 22 199 1 Y 1 BBB GLU -14 ? B GLU 23 200 1 Y 1 BBB VAL -13 ? B VAL 24 201 1 Y 1 BBB THR -12 ? B THR 25 202 1 Y 1 BBB GLY -11 ? B GLY 26 203 1 Y 1 BBB ASN -10 ? B ASN 27 204 1 Y 1 BBB SER -9 ? B SER 28 205 1 Y 1 BBB PRO -8 ? B PRO 29 206 1 Y 1 BBB ARG -7 ? B ARG 30 207 1 Y 1 BBB LEU -6 ? B LEU 31 208 1 Y 1 BBB ASP -5 ? B ASP 32 209 1 Y 1 BBB VAL -4 ? B VAL 33 210 1 Y 1 BBB ALA -3 ? B ALA 34 211 1 Y 1 BBB LEU -2 ? B LEU 35 212 1 Y 1 BBB ASP -1 ? B ASP 36 213 1 Y 1 BBB GLU 0 ? B GLU 37 214 1 Y 1 BBB SER 1 ? B SER 38 215 1 Y 1 BBB GLY 2 ? B GLY 39 216 1 Y 1 BBB ASP 3 ? B ASP 40 217 1 Y 1 BBB PHE 4 ? B PHE 41 218 1 Y 1 BBB SER 5 ? B SER 42 219 1 Y 1 BBB LEU 6 ? B LEU 43 220 1 Y 1 BBB VAL 7 ? B VAL 44 221 1 Y 1 BBB GLU 8 ? B GLU 45 222 1 Y 1 BBB GLU 9 ? B GLU 46 223 1 Y 1 BBB MET 10 ? B MET 47 224 1 Y 1 BBB LYS 11 ? B LYS 48 225 1 Y 1 BBB GLU 12 ? B GLU 49 226 1 Y 1 BBB VAL 13 ? B VAL 50 227 1 Y 1 BBB LYS 14 ? B LYS 51 228 1 Y 1 BBB LYS 15 ? B LYS 52 229 1 Y 1 BBB GLY 16 ? B GLY 53 230 1 Y 1 BBB GLU 17 ? B GLU 54 231 1 Y 1 BBB GLU 171 ? B GLU 208 232 1 Y 1 BBB GLU 172 ? B GLU 209 233 1 Y 1 BBB GLU 173 ? B GLU 210 234 1 Y 1 BBB THR 174 ? B THR 211 235 1 Y 1 BBB PRO 175 ? B PRO 212 236 1 Y 1 BBB VAL 176 ? B VAL 213 237 1 Y 1 BBB GLU 177 ? B GLU 214 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1JHM C1 C N N 1 A1JHM C2 C N N 2 A1JHM C3 C N N 3 A1JHM C4 C Y N 4 A1JHM C5 C Y N 5 A1JHM C6 C Y N 6 A1JHM C12 C Y N 7 A1JHM C13 C Y N 8 A1JHM C14 C N N 9 A1JHM C16 C N N 10 A1JHM C18 C N N 11 A1JHM C19 C Y N 12 A1JHM O1 O N N 13 A1JHM N1 N N N 14 A1JHM C7 C Y N 15 A1JHM C8 C N N 16 A1JHM N2 N N N 17 A1JHM C9 C Y N 18 A1JHM C10 C Y N 19 A1JHM C11 C Y N 20 A1JHM CL1 CL N N 21 A1JHM O2 O N N 22 A1JHM N3 N N N 23 A1JHM C15 C N N 24 A1JHM C17 C N N 25 A1JHM O3 O N N 26 A1JHM N4 N Y N 27 A1JHM H2 H N N 28 A1JHM H3 H N N 29 A1JHM H1 H N N 30 A1JHM H5 H N N 31 A1JHM H6 H N N 32 A1JHM H4 H N N 33 A1JHM H7 H N N 34 A1JHM H8 H N N 35 A1JHM H9 H N N 36 A1JHM H10 H N N 37 A1JHM H13 H N N 38 A1JHM H15 H N N 39 A1JHM H16 H N N 40 A1JHM H17 H N N 41 A1JHM H21 H N N 42 A1JHM H22 H N N 43 A1JHM H24 H N N 44 A1JHM H11 H N N 45 A1JHM H12 H N N 46 A1JHM H14 H N N 47 A1JHM H20 H N N 48 A1JHM H18 H N N 49 A1JHM H19 H N N 50 A1JHM H23 H N N 51 A1JHM H25 H N N 52 ALA N N N N 53 ALA CA C N S 54 ALA C C N N 55 ALA O O N N 56 ALA CB C N N 57 ALA OXT O N N 58 ALA H H N N 59 ALA H2 H N N 60 ALA HA H N N 61 ALA HB1 H N N 62 ALA HB2 H N N 63 ALA HB3 H N N 64 ALA HXT H N N 65 ARG N N N N 66 ARG CA C N S 67 ARG C C N N 68 ARG O O N N 69 ARG CB C N N 70 ARG CG C N N 71 ARG CD C N N 72 ARG NE N N N 73 ARG CZ C N N 74 ARG NH1 N N N 75 ARG NH2 N N N 76 ARG OXT O N N 77 ARG H H N N 78 ARG H2 H N N 79 ARG HA H N N 80 ARG HB2 H N N 81 ARG HB3 H N N 82 ARG HG2 H N N 83 ARG HG3 H N N 84 ARG HD2 H N N 85 ARG HD3 H N N 86 ARG HE H N N 87 ARG HH11 H N N 88 ARG HH12 H N N 89 ARG HH21 H N N 90 ARG HH22 H N N 91 ARG HXT H N N 92 ASN N N N N 93 ASN CA C N S 94 ASN C C N N 95 ASN O O N N 96 ASN CB C N N 97 ASN CG C N N 98 ASN OD1 O N N 99 ASN ND2 N N N 100 ASN OXT O N N 101 ASN H H N N 102 ASN H2 H N N 103 ASN HA H N N 104 ASN HB2 H N N 105 ASN HB3 H N N 106 ASN HD21 H N N 107 ASN HD22 H N N 108 ASN HXT H N N 109 ASP N N N N 110 ASP CA C N S 111 ASP C C N N 112 ASP O O N N 113 ASP CB C N N 114 ASP CG C N N 115 ASP OD1 O N N 116 ASP OD2 O N N 117 ASP OXT O N N 118 ASP H H N N 119 ASP H2 H N N 120 ASP HA H N N 121 ASP HB2 H N N 122 ASP HB3 H N N 123 ASP HD2 H N N 124 ASP HXT H N N 125 CYS N N N N 126 CYS CA C N R 127 CYS C C N N 128 CYS O O N N 129 CYS CB C N N 130 CYS SG S N N 131 CYS OXT O N N 132 CYS H H N N 133 CYS H2 H N N 134 CYS HA H N N 135 CYS HB2 H N N 136 CYS HB3 H N N 137 CYS HG H N N 138 CYS HXT H N N 139 GLN N N N N 140 GLN CA C N S 141 GLN C C N N 142 GLN O O N N 143 GLN CB C N N 144 GLN CG C N N 145 GLN CD C N N 146 GLN OE1 O N N 147 GLN NE2 N N N 148 GLN OXT O N N 149 GLN H H N N 150 GLN H2 H N N 151 GLN HA H N N 152 GLN HB2 H N N 153 GLN HB3 H N N 154 GLN HG2 H N N 155 GLN HG3 H N N 156 GLN HE21 H N N 157 GLN HE22 H N N 158 GLN HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 HOH O O N N 210 HOH H1 H N N 211 HOH H2 H N N 212 ILE N N N N 213 ILE CA C N S 214 ILE C C N N 215 ILE O O N N 216 ILE CB C N S 217 ILE CG1 C N N 218 ILE CG2 C N N 219 ILE CD1 C N N 220 ILE OXT O N N 221 ILE H H N N 222 ILE H2 H N N 223 ILE HA H N N 224 ILE HB H N N 225 ILE HG12 H N N 226 ILE HG13 H N N 227 ILE HG21 H N N 228 ILE HG22 H N N 229 ILE HG23 H N N 230 ILE HD11 H N N 231 ILE HD12 H N N 232 ILE HD13 H N N 233 ILE HXT H N N 234 LEU N N N N 235 LEU CA C N S 236 LEU C C N N 237 LEU O O N N 238 LEU CB C N N 239 LEU CG C N N 240 LEU CD1 C N N 241 LEU CD2 C N N 242 LEU OXT O N N 243 LEU H H N N 244 LEU H2 H N N 245 LEU HA H N N 246 LEU HB2 H N N 247 LEU HB3 H N N 248 LEU HG H N N 249 LEU HD11 H N N 250 LEU HD12 H N N 251 LEU HD13 H N N 252 LEU HD21 H N N 253 LEU HD22 H N N 254 LEU HD23 H N N 255 LEU HXT H N N 256 LYS N N N N 257 LYS CA C N S 258 LYS C C N N 259 LYS O O N N 260 LYS CB C N N 261 LYS CG C N N 262 LYS CD C N N 263 LYS CE C N N 264 LYS NZ N N N 265 LYS OXT O N N 266 LYS H H N N 267 LYS H2 H N N 268 LYS HA H N N 269 LYS HB2 H N N 270 LYS HB3 H N N 271 LYS HG2 H N N 272 LYS HG3 H N N 273 LYS HD2 H N N 274 LYS HD3 H N N 275 LYS HE2 H N N 276 LYS HE3 H N N 277 LYS HZ1 H N N 278 LYS HZ2 H N N 279 LYS HZ3 H N N 280 LYS HXT H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 NA NA NA N N 302 PHE N N N N 303 PHE CA C N S 304 PHE C C N N 305 PHE O O N N 306 PHE CB C N N 307 PHE CG C Y N 308 PHE CD1 C Y N 309 PHE CD2 C Y N 310 PHE CE1 C Y N 311 PHE CE2 C Y N 312 PHE CZ C Y N 313 PHE OXT O N N 314 PHE H H N N 315 PHE H2 H N N 316 PHE HA H N N 317 PHE HB2 H N N 318 PHE HB3 H N N 319 PHE HD1 H N N 320 PHE HD2 H N N 321 PHE HE1 H N N 322 PHE HE2 H N N 323 PHE HZ H N N 324 PHE HXT H N N 325 PRO N N N N 326 PRO CA C N S 327 PRO C C N N 328 PRO O O N N 329 PRO CB C N N 330 PRO CG C N N 331 PRO CD C N N 332 PRO OXT O N N 333 PRO H H N N 334 PRO HA H N N 335 PRO HB2 H N N 336 PRO HB3 H N N 337 PRO HG2 H N N 338 PRO HG3 H N N 339 PRO HD2 H N N 340 PRO HD3 H N N 341 PRO HXT H N N 342 SER N N N N 343 SER CA C N S 344 SER C C N N 345 SER O O N N 346 SER CB C N N 347 SER OG O N N 348 SER OXT O N N 349 SER H H N N 350 SER H2 H N N 351 SER HA H N N 352 SER HB2 H N N 353 SER HB3 H N N 354 SER HG H N N 355 SER HXT H N N 356 THR N N N N 357 THR CA C N S 358 THR C C N N 359 THR O O N N 360 THR CB C N R 361 THR OG1 O N N 362 THR CG2 C N N 363 THR OXT O N N 364 THR H H N N 365 THR H2 H N N 366 THR HA H N N 367 THR HB H N N 368 THR HG1 H N N 369 THR HG21 H N N 370 THR HG22 H N N 371 THR HG23 H N N 372 THR HXT H N N 373 TRP N N N N 374 TRP CA C N S 375 TRP C C N N 376 TRP O O N N 377 TRP CB C N N 378 TRP CG C Y N 379 TRP CD1 C Y N 380 TRP CD2 C Y N 381 TRP NE1 N Y N 382 TRP CE2 C Y N 383 TRP CE3 C Y N 384 TRP CZ2 C Y N 385 TRP CZ3 C Y N 386 TRP CH2 C Y N 387 TRP OXT O N N 388 TRP H H N N 389 TRP H2 H N N 390 TRP HA H N N 391 TRP HB2 H N N 392 TRP HB3 H N N 393 TRP HD1 H N N 394 TRP HE1 H N N 395 TRP HE3 H N N 396 TRP HZ2 H N N 397 TRP HZ3 H N N 398 TRP HH2 H N N 399 TRP HXT H N N 400 TYR N N N N 401 TYR CA C N S 402 TYR C C N N 403 TYR O O N N 404 TYR CB C N N 405 TYR CG C Y N 406 TYR CD1 C Y N 407 TYR CD2 C Y N 408 TYR CE1 C Y N 409 TYR CE2 C Y N 410 TYR CZ C Y N 411 TYR OH O N N 412 TYR OXT O N N 413 TYR H H N N 414 TYR H2 H N N 415 TYR HA H N N 416 TYR HB2 H N N 417 TYR HB3 H N N 418 TYR HD1 H N N 419 TYR HD2 H N N 420 TYR HE1 H N N 421 TYR HE2 H N N 422 TYR HH H N N 423 TYR HXT H N N 424 VAL N N N N 425 VAL CA C N S 426 VAL C C N N 427 VAL O O N N 428 VAL CB C N N 429 VAL CG1 C N N 430 VAL CG2 C N N 431 VAL OXT O N N 432 VAL H H N N 433 VAL H2 H N N 434 VAL HA H N N 435 VAL HB H N N 436 VAL HG11 H N N 437 VAL HG12 H N N 438 VAL HG13 H N N 439 VAL HG21 H N N 440 VAL HG22 H N N 441 VAL HG23 H N N 442 VAL HXT H N N 443 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1JHM C1 N1 sing N N 1 A1JHM N1 C2 sing N N 2 A1JHM N1 C3 sing N N 3 A1JHM C3 C4 sing N N 4 A1JHM C4 C5 doub Y N 5 A1JHM C5 C6 sing Y N 6 A1JHM C6 C7 doub Y N 7 A1JHM C7 C8 sing N N 8 A1JHM C8 O1 doub N N 9 A1JHM C8 N2 sing N N 10 A1JHM N2 C9 sing N N 11 A1JHM C9 C10 doub Y N 12 A1JHM C10 C11 sing Y N 13 A1JHM C11 CL1 sing N N 14 A1JHM C11 C12 doub Y N 15 A1JHM C12 C13 sing Y N 16 A1JHM C13 C14 sing N N 17 A1JHM C14 O2 doub N N 18 A1JHM C14 N3 sing N N 19 A1JHM N3 C15 sing N N 20 A1JHM C15 C16 sing N N 21 A1JHM C15 C17 sing N N 22 A1JHM C15 C18 sing N N 23 A1JHM C18 O3 sing N N 24 A1JHM C13 C19 doub Y N 25 A1JHM C7 N4 sing Y N 26 A1JHM C4 N4 sing Y N 27 A1JHM C9 C19 sing Y N 28 A1JHM C1 H2 sing N N 29 A1JHM C1 H3 sing N N 30 A1JHM C1 H1 sing N N 31 A1JHM C2 H5 sing N N 32 A1JHM C2 H6 sing N N 33 A1JHM C2 H4 sing N N 34 A1JHM C3 H7 sing N N 35 A1JHM C3 H8 sing N N 36 A1JHM C5 H9 sing N N 37 A1JHM C6 H10 sing N N 38 A1JHM C12 H13 sing N N 39 A1JHM C16 H15 sing N N 40 A1JHM C16 H16 sing N N 41 A1JHM C16 H17 sing N N 42 A1JHM C18 H21 sing N N 43 A1JHM C18 H22 sing N N 44 A1JHM C19 H24 sing N N 45 A1JHM N2 H11 sing N N 46 A1JHM C10 H12 sing N N 47 A1JHM N3 H14 sing N N 48 A1JHM C17 H20 sing N N 49 A1JHM C17 H18 sing N N 50 A1JHM C17 H19 sing N N 51 A1JHM O3 H23 sing N N 52 A1JHM N4 H25 sing N N 53 ALA N CA sing N N 54 ALA N H sing N N 55 ALA N H2 sing N N 56 ALA CA C sing N N 57 ALA CA CB sing N N 58 ALA CA HA sing N N 59 ALA C O doub N N 60 ALA C OXT sing N N 61 ALA CB HB1 sing N N 62 ALA CB HB2 sing N N 63 ALA CB HB3 sing N N 64 ALA OXT HXT sing N N 65 ARG N CA sing N N 66 ARG N H sing N N 67 ARG N H2 sing N N 68 ARG CA C sing N N 69 ARG CA CB sing N N 70 ARG CA HA sing N N 71 ARG C O doub N N 72 ARG C OXT sing N N 73 ARG CB CG sing N N 74 ARG CB HB2 sing N N 75 ARG CB HB3 sing N N 76 ARG CG CD sing N N 77 ARG CG HG2 sing N N 78 ARG CG HG3 sing N N 79 ARG CD NE sing N N 80 ARG CD HD2 sing N N 81 ARG CD HD3 sing N N 82 ARG NE CZ sing N N 83 ARG NE HE sing N N 84 ARG CZ NH1 sing N N 85 ARG CZ NH2 doub N N 86 ARG NH1 HH11 sing N N 87 ARG NH1 HH12 sing N N 88 ARG NH2 HH21 sing N N 89 ARG NH2 HH22 sing N N 90 ARG OXT HXT sing N N 91 ASN N CA sing N N 92 ASN N H sing N N 93 ASN N H2 sing N N 94 ASN CA C sing N N 95 ASN CA CB sing N N 96 ASN CA HA sing N N 97 ASN C O doub N N 98 ASN C OXT sing N N 99 ASN CB CG sing N N 100 ASN CB HB2 sing N N 101 ASN CB HB3 sing N N 102 ASN CG OD1 doub N N 103 ASN CG ND2 sing N N 104 ASN ND2 HD21 sing N N 105 ASN ND2 HD22 sing N N 106 ASN OXT HXT sing N N 107 ASP N CA sing N N 108 ASP N H sing N N 109 ASP N H2 sing N N 110 ASP CA C sing N N 111 ASP CA CB sing N N 112 ASP CA HA sing N N 113 ASP C O doub N N 114 ASP C OXT sing N N 115 ASP CB CG sing N N 116 ASP CB HB2 sing N N 117 ASP CB HB3 sing N N 118 ASP CG OD1 doub N N 119 ASP CG OD2 sing N N 120 ASP OD2 HD2 sing N N 121 ASP OXT HXT sing N N 122 CYS N CA sing N N 123 CYS N H sing N N 124 CYS N H2 sing N N 125 CYS CA C sing N N 126 CYS CA CB sing N N 127 CYS CA HA sing N N 128 CYS C O doub N N 129 CYS C OXT sing N N 130 CYS CB SG sing N N 131 CYS CB HB2 sing N N 132 CYS CB HB3 sing N N 133 CYS SG HG sing N N 134 CYS OXT HXT sing N N 135 GLN N CA sing N N 136 GLN N H sing N N 137 GLN N H2 sing N N 138 GLN CA C sing N N 139 GLN CA CB sing N N 140 GLN CA HA sing N N 141 GLN C O doub N N 142 GLN C OXT sing N N 143 GLN CB CG sing N N 144 GLN CB HB2 sing N N 145 GLN CB HB3 sing N N 146 GLN CG CD sing N N 147 GLN CG HG2 sing N N 148 GLN CG HG3 sing N N 149 GLN CD OE1 doub N N 150 GLN CD NE2 sing N N 151 GLN NE2 HE21 sing N N 152 GLN NE2 HE22 sing N N 153 GLN OXT HXT sing N N 154 GLU N CA sing N N 155 GLU N H sing N N 156 GLU N H2 sing N N 157 GLU CA C sing N N 158 GLU CA CB sing N N 159 GLU CA HA sing N N 160 GLU C O doub N N 161 GLU C OXT sing N N 162 GLU CB CG sing N N 163 GLU CB HB2 sing N N 164 GLU CB HB3 sing N N 165 GLU CG CD sing N N 166 GLU CG HG2 sing N N 167 GLU CG HG3 sing N N 168 GLU CD OE1 doub N N 169 GLU CD OE2 sing N N 170 GLU OE2 HE2 sing N N 171 GLU OXT HXT sing N N 172 GLY N CA sing N N 173 GLY N H sing N N 174 GLY N H2 sing N N 175 GLY CA C sing N N 176 GLY CA HA2 sing N N 177 GLY CA HA3 sing N N 178 GLY C O doub N N 179 GLY C OXT sing N N 180 GLY OXT HXT sing N N 181 HIS N CA sing N N 182 HIS N H sing N N 183 HIS N H2 sing N N 184 HIS CA C sing N N 185 HIS CA CB sing N N 186 HIS CA HA sing N N 187 HIS C O doub N N 188 HIS C OXT sing N N 189 HIS CB CG sing N N 190 HIS CB HB2 sing N N 191 HIS CB HB3 sing N N 192 HIS CG ND1 sing Y N 193 HIS CG CD2 doub Y N 194 HIS ND1 CE1 doub Y N 195 HIS ND1 HD1 sing N N 196 HIS CD2 NE2 sing Y N 197 HIS CD2 HD2 sing N N 198 HIS CE1 NE2 sing Y N 199 HIS CE1 HE1 sing N N 200 HIS NE2 HE2 sing N N 201 HIS OXT HXT sing N N 202 HOH O H1 sing N N 203 HOH O H2 sing N N 204 ILE N CA sing N N 205 ILE N H sing N N 206 ILE N H2 sing N N 207 ILE CA C sing N N 208 ILE CA CB sing N N 209 ILE CA HA sing N N 210 ILE C O doub N N 211 ILE C OXT sing N N 212 ILE CB CG1 sing N N 213 ILE CB CG2 sing N N 214 ILE CB HB sing N N 215 ILE CG1 CD1 sing N N 216 ILE CG1 HG12 sing N N 217 ILE CG1 HG13 sing N N 218 ILE CG2 HG21 sing N N 219 ILE CG2 HG22 sing N N 220 ILE CG2 HG23 sing N N 221 ILE CD1 HD11 sing N N 222 ILE CD1 HD12 sing N N 223 ILE CD1 HD13 sing N N 224 ILE OXT HXT sing N N 225 LEU N CA sing N N 226 LEU N H sing N N 227 LEU N H2 sing N N 228 LEU CA C sing N N 229 LEU CA CB sing N N 230 LEU CA HA sing N N 231 LEU C O doub N N 232 LEU C OXT sing N N 233 LEU CB CG sing N N 234 LEU CB HB2 sing N N 235 LEU CB HB3 sing N N 236 LEU CG CD1 sing N N 237 LEU CG CD2 sing N N 238 LEU CG HG sing N N 239 LEU CD1 HD11 sing N N 240 LEU CD1 HD12 sing N N 241 LEU CD1 HD13 sing N N 242 LEU CD2 HD21 sing N N 243 LEU CD2 HD22 sing N N 244 LEU CD2 HD23 sing N N 245 LEU OXT HXT sing N N 246 LYS N CA sing N N 247 LYS N H sing N N 248 LYS N H2 sing N N 249 LYS CA C sing N N 250 LYS CA CB sing N N 251 LYS CA HA sing N N 252 LYS C O doub N N 253 LYS C OXT sing N N 254 LYS CB CG sing N N 255 LYS CB HB2 sing N N 256 LYS CB HB3 sing N N 257 LYS CG CD sing N N 258 LYS CG HG2 sing N N 259 LYS CG HG3 sing N N 260 LYS CD CE sing N N 261 LYS CD HD2 sing N N 262 LYS CD HD3 sing N N 263 LYS CE NZ sing N N 264 LYS CE HE2 sing N N 265 LYS CE HE3 sing N N 266 LYS NZ HZ1 sing N N 267 LYS NZ HZ2 sing N N 268 LYS NZ HZ3 sing N N 269 LYS OXT HXT sing N N 270 MET N CA sing N N 271 MET N H sing N N 272 MET N H2 sing N N 273 MET CA C sing N N 274 MET CA CB sing N N 275 MET CA HA sing N N 276 MET C O doub N N 277 MET C OXT sing N N 278 MET CB CG sing N N 279 MET CB HB2 sing N N 280 MET CB HB3 sing N N 281 MET CG SD sing N N 282 MET CG HG2 sing N N 283 MET CG HG3 sing N N 284 MET SD CE sing N N 285 MET CE HE1 sing N N 286 MET CE HE2 sing N N 287 MET CE HE3 sing N N 288 MET OXT HXT sing N N 289 PHE N CA sing N N 290 PHE N H sing N N 291 PHE N H2 sing N N 292 PHE CA C sing N N 293 PHE CA CB sing N N 294 PHE CA HA sing N N 295 PHE C O doub N N 296 PHE C OXT sing N N 297 PHE CB CG sing N N 298 PHE CB HB2 sing N N 299 PHE CB HB3 sing N N 300 PHE CG CD1 doub Y N 301 PHE CG CD2 sing Y N 302 PHE CD1 CE1 sing Y N 303 PHE CD1 HD1 sing N N 304 PHE CD2 CE2 doub Y N 305 PHE CD2 HD2 sing N N 306 PHE CE1 CZ doub Y N 307 PHE CE1 HE1 sing N N 308 PHE CE2 CZ sing Y N 309 PHE CE2 HE2 sing N N 310 PHE CZ HZ sing N N 311 PHE OXT HXT sing N N 312 PRO N CA sing N N 313 PRO N CD sing N N 314 PRO N H sing N N 315 PRO CA C sing N N 316 PRO CA CB sing N N 317 PRO CA HA sing N N 318 PRO C O doub N N 319 PRO C OXT sing N N 320 PRO CB CG sing N N 321 PRO CB HB2 sing N N 322 PRO CB HB3 sing N N 323 PRO CG CD sing N N 324 PRO CG HG2 sing N N 325 PRO CG HG3 sing N N 326 PRO CD HD2 sing N N 327 PRO CD HD3 sing N N 328 PRO OXT HXT sing N N 329 SER N CA sing N N 330 SER N H sing N N 331 SER N H2 sing N N 332 SER CA C sing N N 333 SER CA CB sing N N 334 SER CA HA sing N N 335 SER C O doub N N 336 SER C OXT sing N N 337 SER CB OG sing N N 338 SER CB HB2 sing N N 339 SER CB HB3 sing N N 340 SER OG HG sing N N 341 SER OXT HXT sing N N 342 THR N CA sing N N 343 THR N H sing N N 344 THR N H2 sing N N 345 THR CA C sing N N 346 THR CA CB sing N N 347 THR CA HA sing N N 348 THR C O doub N N 349 THR C OXT sing N N 350 THR CB OG1 sing N N 351 THR CB CG2 sing N N 352 THR CB HB sing N N 353 THR OG1 HG1 sing N N 354 THR CG2 HG21 sing N N 355 THR CG2 HG22 sing N N 356 THR CG2 HG23 sing N N 357 THR OXT HXT sing N N 358 TRP N CA sing N N 359 TRP N H sing N N 360 TRP N H2 sing N N 361 TRP CA C sing N N 362 TRP CA CB sing N N 363 TRP CA HA sing N N 364 TRP C O doub N N 365 TRP C OXT sing N N 366 TRP CB CG sing N N 367 TRP CB HB2 sing N N 368 TRP CB HB3 sing N N 369 TRP CG CD1 doub Y N 370 TRP CG CD2 sing Y N 371 TRP CD1 NE1 sing Y N 372 TRP CD1 HD1 sing N N 373 TRP CD2 CE2 doub Y N 374 TRP CD2 CE3 sing Y N 375 TRP NE1 CE2 sing Y N 376 TRP NE1 HE1 sing N N 377 TRP CE2 CZ2 sing Y N 378 TRP CE3 CZ3 doub Y N 379 TRP CE3 HE3 sing N N 380 TRP CZ2 CH2 doub Y N 381 TRP CZ2 HZ2 sing N N 382 TRP CZ3 CH2 sing Y N 383 TRP CZ3 HZ3 sing N N 384 TRP CH2 HH2 sing N N 385 TRP OXT HXT sing N N 386 TYR N CA sing N N 387 TYR N H sing N N 388 TYR N H2 sing N N 389 TYR CA C sing N N 390 TYR CA CB sing N N 391 TYR CA HA sing N N 392 TYR C O doub N N 393 TYR C OXT sing N N 394 TYR CB CG sing N N 395 TYR CB HB2 sing N N 396 TYR CB HB3 sing N N 397 TYR CG CD1 doub Y N 398 TYR CG CD2 sing Y N 399 TYR CD1 CE1 sing Y N 400 TYR CD1 HD1 sing N N 401 TYR CD2 CE2 doub Y N 402 TYR CD2 HD2 sing N N 403 TYR CE1 CZ doub Y N 404 TYR CE1 HE1 sing N N 405 TYR CE2 CZ sing Y N 406 TYR CE2 HE2 sing N N 407 TYR CZ OH sing N N 408 TYR OH HH sing N N 409 TYR OXT HXT sing N N 410 VAL N CA sing N N 411 VAL N H sing N N 412 VAL N H2 sing N N 413 VAL CA C sing N N 414 VAL CA CB sing N N 415 VAL CA HA sing N N 416 VAL C O doub N N 417 VAL C OXT sing N N 418 VAL CB CG1 sing N N 419 VAL CB CG2 sing N N 420 VAL CB HB sing N N 421 VAL CG1 HG11 sing N N 422 VAL CG1 HG12 sing N N 423 VAL CG1 HG13 sing N N 424 VAL CG2 HG21 sing N N 425 VAL CG2 HG22 sing N N 426 VAL CG2 HG23 sing N N 427 VAL OXT HXT sing N N 428 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8pn6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9RM4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.023574 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023574 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004630 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CL 17 17 11.460 0.010 7.196 1.166 6.255 18.519 1.645 47.778 -9.363 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 NA 11 11 4.766 3.285 3.176 8.842 1.268 0.314 1.114 129.424 0.726 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.032 # loop_ # loop_ #