data_9RPM # _entry.id 9RPM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9RPM pdb_00009rpm 10.2210/pdb9rpm/pdb WWPDB D_1292148608 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-11-05 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9RPM _pdbx_database_status.recvd_initial_deposition_date 2025-06-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9rpk _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email l.sorci@staff.univpm.it _pdbx_contact_author.name_first Leonardo _pdbx_contact_author.name_last Sorci _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4356-8873 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sorci, L.' 1 0000-0002-4356-8873 'Cianci, M.' 2 0000-0001-5607-6061 'Fortunato, C.' 3 0009-0006-9591-7920 'Gasparrini, M.' 4 0000-0001-9738-2663 'Raffaelli, N.' 5 0000-0002-4458-1789 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 331 _citation.language ? _citation.page_first 148370 _citation.page_last 148370 _citation.title ;Arabidopsis thaliana nicotinate mononucleotide adenylyltransferase: unveiling the molecular determinants and evolutionary origin of nicotinic acid mononucleotide recognition. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2025.148370 _citation.pdbx_database_id_PubMed 41109367 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sorci, L.' 1 ? primary 'Cianci, M.' 2 ? primary 'Fortunato, C.' 3 ? primary 'Gasparrini, M.' 4 ? primary 'Raffaelli, N.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nicotinamide/nicotinic acid mononucleotide adenylyltransferase' 29768.111 1 2.7.7.1,2.7.7.18 ? ? ? 2 non-polymer syn 'NICOTINATE MONONUCLEOTIDE' 335.204 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;NMN/NaMN adenylyltransferase,Nicotinamide mononucleotide adenylyltransferase,NMN adenylyltransferase,Nicotinate-nucleotide adenylyltransferase,NaMN adenylyltransferase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSTHHHHHHSSGLVPRGSHMARIRMDVPLPVEKLSYGSNTEDKTCVVLVATGSFNPPTFMHLRMFELARDELRSKGFHV LGGYMSPVNDAYKKKGLLSAEHRLEMCNVSCQSSDFVMVDPWEASQSNYQRTLTVLSRVKTFLTTNRHVPEESLKVMLLC GSDLLLSFCTPGVWIPEQLRTICKDYGIVCIRREGQDVENMISGDEILNENCANVKIVDNTVPNQISSSRLRQCISRGLS VKYLTEDGVIDYIRQHQLYTELT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSTHHHHHHSSGLVPRGSHMARIRMDVPLPVEKLSYGSNTEDKTCVVLVATGSFNPPTFMHLRMFELARDELRSKGFHV LGGYMSPVNDAYKKKGLLSAEHRLEMCNVSCQSSDFVMVDPWEASQSNYQRTLTVLSRVKTFLTTNRHVPEESLKVMLLC GSDLLLSFCTPGVWIPEQLRTICKDYGIVCIRREGQDVENMISGDEILNENCANVKIVDNTVPNQISSSRLRQCISRGLS VKYLTEDGVIDYIRQHQLYTELT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NICOTINATE MONONUCLEOTIDE' NCN 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 THR n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 ARG n 1 24 ILE n 1 25 ARG n 1 26 MET n 1 27 ASP n 1 28 VAL n 1 29 PRO n 1 30 LEU n 1 31 PRO n 1 32 VAL n 1 33 GLU n 1 34 LYS n 1 35 LEU n 1 36 SER n 1 37 TYR n 1 38 GLY n 1 39 SER n 1 40 ASN n 1 41 THR n 1 42 GLU n 1 43 ASP n 1 44 LYS n 1 45 THR n 1 46 CYS n 1 47 VAL n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 ALA n 1 52 THR n 1 53 GLY n 1 54 SER n 1 55 PHE n 1 56 ASN n 1 57 PRO n 1 58 PRO n 1 59 THR n 1 60 PHE n 1 61 MET n 1 62 HIS n 1 63 LEU n 1 64 ARG n 1 65 MET n 1 66 PHE n 1 67 GLU n 1 68 LEU n 1 69 ALA n 1 70 ARG n 1 71 ASP n 1 72 GLU n 1 73 LEU n 1 74 ARG n 1 75 SER n 1 76 LYS n 1 77 GLY n 1 78 PHE n 1 79 HIS n 1 80 VAL n 1 81 LEU n 1 82 GLY n 1 83 GLY n 1 84 TYR n 1 85 MET n 1 86 SER n 1 87 PRO n 1 88 VAL n 1 89 ASN n 1 90 ASP n 1 91 ALA n 1 92 TYR n 1 93 LYS n 1 94 LYS n 1 95 LYS n 1 96 GLY n 1 97 LEU n 1 98 LEU n 1 99 SER n 1 100 ALA n 1 101 GLU n 1 102 HIS n 1 103 ARG n 1 104 LEU n 1 105 GLU n 1 106 MET n 1 107 CYS n 1 108 ASN n 1 109 VAL n 1 110 SER n 1 111 CYS n 1 112 GLN n 1 113 SER n 1 114 SER n 1 115 ASP n 1 116 PHE n 1 117 VAL n 1 118 MET n 1 119 VAL n 1 120 ASP n 1 121 PRO n 1 122 TRP n 1 123 GLU n 1 124 ALA n 1 125 SER n 1 126 GLN n 1 127 SER n 1 128 ASN n 1 129 TYR n 1 130 GLN n 1 131 ARG n 1 132 THR n 1 133 LEU n 1 134 THR n 1 135 VAL n 1 136 LEU n 1 137 SER n 1 138 ARG n 1 139 VAL n 1 140 LYS n 1 141 THR n 1 142 PHE n 1 143 LEU n 1 144 THR n 1 145 THR n 1 146 ASN n 1 147 ARG n 1 148 HIS n 1 149 VAL n 1 150 PRO n 1 151 GLU n 1 152 GLU n 1 153 SER n 1 154 LEU n 1 155 LYS n 1 156 VAL n 1 157 MET n 1 158 LEU n 1 159 LEU n 1 160 CYS n 1 161 GLY n 1 162 SER n 1 163 ASP n 1 164 LEU n 1 165 LEU n 1 166 LEU n 1 167 SER n 1 168 PHE n 1 169 CYS n 1 170 THR n 1 171 PRO n 1 172 GLY n 1 173 VAL n 1 174 TRP n 1 175 ILE n 1 176 PRO n 1 177 GLU n 1 178 GLN n 1 179 LEU n 1 180 ARG n 1 181 THR n 1 182 ILE n 1 183 CYS n 1 184 LYS n 1 185 ASP n 1 186 TYR n 1 187 GLY n 1 188 ILE n 1 189 VAL n 1 190 CYS n 1 191 ILE n 1 192 ARG n 1 193 ARG n 1 194 GLU n 1 195 GLY n 1 196 GLN n 1 197 ASP n 1 198 VAL n 1 199 GLU n 1 200 ASN n 1 201 MET n 1 202 ILE n 1 203 SER n 1 204 GLY n 1 205 ASP n 1 206 GLU n 1 207 ILE n 1 208 LEU n 1 209 ASN n 1 210 GLU n 1 211 ASN n 1 212 CYS n 1 213 ALA n 1 214 ASN n 1 215 VAL n 1 216 LYS n 1 217 ILE n 1 218 VAL n 1 219 ASP n 1 220 ASN n 1 221 THR n 1 222 VAL n 1 223 PRO n 1 224 ASN n 1 225 GLN n 1 226 ILE n 1 227 SER n 1 228 SER n 1 229 SER n 1 230 ARG n 1 231 LEU n 1 232 ARG n 1 233 GLN n 1 234 CYS n 1 235 ILE n 1 236 SER n 1 237 ARG n 1 238 GLY n 1 239 LEU n 1 240 SER n 1 241 VAL n 1 242 LYS n 1 243 TYR n 1 244 LEU n 1 245 THR n 1 246 GLU n 1 247 ASP n 1 248 GLY n 1 249 VAL n 1 250 ILE n 1 251 ASP n 1 252 TYR n 1 253 ILE n 1 254 ARG n 1 255 GLN n 1 256 HIS n 1 257 GLN n 1 258 LEU n 1 259 TYR n 1 260 THR n 1 261 GLU n 1 262 LEU n 1 263 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NMNAT, At5g55810, MDF20.25' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NCN non-polymer . 'NICOTINATE MONONUCLEOTIDE' NAMN 'C11 H14 N O9 P' 335.204 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -24 ? ? ? A . n A 1 2 GLY 2 -23 ? ? ? A . n A 1 3 SER 3 -22 ? ? ? A . n A 1 4 THR 4 -21 ? ? ? A . n A 1 5 HIS 5 -20 ? ? ? A . n A 1 6 HIS 6 -19 ? ? ? A . n A 1 7 HIS 7 -18 ? ? ? A . n A 1 8 HIS 8 -17 ? ? ? A . n A 1 9 HIS 9 -16 ? ? ? A . n A 1 10 HIS 10 -15 ? ? ? A . n A 1 11 SER 11 -14 ? ? ? A . n A 1 12 SER 12 -13 ? ? ? A . n A 1 13 GLY 13 -12 ? ? ? A . n A 1 14 LEU 14 -11 ? ? ? A . n A 1 15 VAL 15 -10 ? ? ? A . n A 1 16 PRO 16 -9 ? ? ? A . n A 1 17 ARG 17 -8 ? ? ? A . n A 1 18 GLY 18 -7 ? ? ? A . n A 1 19 SER 19 -6 ? ? ? A . n A 1 20 HIS 20 -5 ? ? ? A . n A 1 21 MET 21 -4 ? ? ? A . n A 1 22 ALA 22 -3 ? ? ? A . n A 1 23 ARG 23 -2 ? ? ? A . n A 1 24 ILE 24 -1 ? ? ? A . n A 1 25 ARG 25 0 ? ? ? A . n A 1 26 MET 26 1 ? ? ? A . n A 1 27 ASP 27 2 2 ASP ASP A . n A 1 28 VAL 28 3 3 VAL VAL A . n A 1 29 PRO 29 4 4 PRO PRO A . n A 1 30 LEU 30 5 5 LEU LEU A . n A 1 31 PRO 31 6 6 PRO PRO A . n A 1 32 VAL 32 7 7 VAL VAL A . n A 1 33 GLU 33 8 8 GLU GLU A . n A 1 34 LYS 34 9 9 LYS LYS A . n A 1 35 LEU 35 10 10 LEU LEU A . n A 1 36 SER 36 11 11 SER SER A . n A 1 37 TYR 37 12 12 TYR TYR A . n A 1 38 GLY 38 13 ? ? ? A . n A 1 39 SER 39 14 ? ? ? A . n A 1 40 ASN 40 15 ? ? ? A . n A 1 41 THR 41 16 ? ? ? A . n A 1 42 GLU 42 17 ? ? ? A . n A 1 43 ASP 43 18 18 ASP ASP A . n A 1 44 LYS 44 19 19 LYS LYS A . n A 1 45 THR 45 20 20 THR THR A . n A 1 46 CYS 46 21 21 CYS CYS A . n A 1 47 VAL 47 22 22 VAL VAL A . n A 1 48 VAL 48 23 23 VAL VAL A . n A 1 49 LEU 49 24 24 LEU LEU A . n A 1 50 VAL 50 25 25 VAL VAL A . n A 1 51 ALA 51 26 26 ALA ALA A . n A 1 52 THR 52 27 27 THR THR A . n A 1 53 GLY 53 28 28 GLY GLY A . n A 1 54 SER 54 29 29 SER SER A . n A 1 55 PHE 55 30 30 PHE PHE A . n A 1 56 ASN 56 31 31 ASN ASN A . n A 1 57 PRO 57 32 32 PRO PRO A . n A 1 58 PRO 58 33 33 PRO PRO A . n A 1 59 THR 59 34 34 THR THR A . n A 1 60 PHE 60 35 35 PHE PHE A . n A 1 61 MET 61 36 36 MET MET A . n A 1 62 HIS 62 37 37 HIS HIS A . n A 1 63 LEU 63 38 38 LEU LEU A . n A 1 64 ARG 64 39 39 ARG ARG A . n A 1 65 MET 65 40 40 MET MET A . n A 1 66 PHE 66 41 41 PHE PHE A . n A 1 67 GLU 67 42 42 GLU GLU A . n A 1 68 LEU 68 43 43 LEU LEU A . n A 1 69 ALA 69 44 44 ALA ALA A . n A 1 70 ARG 70 45 45 ARG ARG A . n A 1 71 ASP 71 46 46 ASP ASP A . n A 1 72 GLU 72 47 47 GLU GLU A . n A 1 73 LEU 73 48 48 LEU LEU A . n A 1 74 ARG 74 49 49 ARG ARG A . n A 1 75 SER 75 50 50 SER SER A . n A 1 76 LYS 76 51 51 LYS LYS A . n A 1 77 GLY 77 52 52 GLY GLY A . n A 1 78 PHE 78 53 53 PHE PHE A . n A 1 79 HIS 79 54 54 HIS HIS A . n A 1 80 VAL 80 55 55 VAL VAL A . n A 1 81 LEU 81 56 56 LEU LEU A . n A 1 82 GLY 82 57 57 GLY GLY A . n A 1 83 GLY 83 58 58 GLY GLY A . n A 1 84 TYR 84 59 59 TYR TYR A . n A 1 85 MET 85 60 60 MET MET A . n A 1 86 SER 86 61 61 SER SER A . n A 1 87 PRO 87 62 62 PRO PRO A . n A 1 88 VAL 88 63 63 VAL VAL A . n A 1 89 ASN 89 64 64 ASN ASN A . n A 1 90 ASP 90 65 65 ASP ASP A . n A 1 91 ALA 91 66 66 ALA ALA A . n A 1 92 TYR 92 67 67 TYR TYR A . n A 1 93 LYS 93 68 68 LYS LYS A . n A 1 94 LYS 94 69 69 LYS LYS A . n A 1 95 LYS 95 70 70 LYS LYS A . n A 1 96 GLY 96 71 71 GLY GLY A . n A 1 97 LEU 97 72 72 LEU LEU A . n A 1 98 LEU 98 73 73 LEU LEU A . n A 1 99 SER 99 74 74 SER SER A . n A 1 100 ALA 100 75 75 ALA ALA A . n A 1 101 GLU 101 76 76 GLU GLU A . n A 1 102 HIS 102 77 77 HIS HIS A . n A 1 103 ARG 103 78 78 ARG ARG A . n A 1 104 LEU 104 79 79 LEU LEU A . n A 1 105 GLU 105 80 80 GLU GLU A . n A 1 106 MET 106 81 81 MET MET A . n A 1 107 CYS 107 82 82 CYS CYS A . n A 1 108 ASN 108 83 83 ASN ASN A . n A 1 109 VAL 109 84 84 VAL VAL A . n A 1 110 SER 110 85 85 SER SER A . n A 1 111 CYS 111 86 86 CYS CYS A . n A 1 112 GLN 112 87 87 GLN GLN A . n A 1 113 SER 113 88 88 SER SER A . n A 1 114 SER 114 89 89 SER SER A . n A 1 115 ASP 115 90 90 ASP ASP A . n A 1 116 PHE 116 91 91 PHE PHE A . n A 1 117 VAL 117 92 92 VAL VAL A . n A 1 118 MET 118 93 93 MET MET A . n A 1 119 VAL 119 94 94 VAL VAL A . n A 1 120 ASP 120 95 95 ASP ASP A . n A 1 121 PRO 121 96 96 PRO PRO A . n A 1 122 TRP 122 97 97 TRP TRP A . n A 1 123 GLU 123 98 98 GLU GLU A . n A 1 124 ALA 124 99 99 ALA ALA A . n A 1 125 SER 125 100 100 SER SER A . n A 1 126 GLN 126 101 101 GLN GLN A . n A 1 127 SER 127 102 102 SER SER A . n A 1 128 ASN 128 103 103 ASN ASN A . n A 1 129 TYR 129 104 104 TYR TYR A . n A 1 130 GLN 130 105 105 GLN GLN A . n A 1 131 ARG 131 106 106 ARG ARG A . n A 1 132 THR 132 107 107 THR THR A . n A 1 133 LEU 133 108 108 LEU LEU A . n A 1 134 THR 134 109 109 THR THR A . n A 1 135 VAL 135 110 110 VAL VAL A . n A 1 136 LEU 136 111 111 LEU LEU A . n A 1 137 SER 137 112 112 SER SER A . n A 1 138 ARG 138 113 113 ARG ARG A . n A 1 139 VAL 139 114 114 VAL VAL A . n A 1 140 LYS 140 115 115 LYS LYS A . n A 1 141 THR 141 116 116 THR THR A . n A 1 142 PHE 142 117 117 PHE PHE A . n A 1 143 LEU 143 118 118 LEU LEU A . n A 1 144 THR 144 119 119 THR THR A . n A 1 145 THR 145 120 120 THR THR A . n A 1 146 ASN 146 121 121 ASN ASN A . n A 1 147 ARG 147 122 122 ARG ARG A . n A 1 148 HIS 148 123 123 HIS HIS A . n A 1 149 VAL 149 124 124 VAL VAL A . n A 1 150 PRO 150 125 125 PRO PRO A . n A 1 151 GLU 151 126 126 GLU GLU A . n A 1 152 GLU 152 127 127 GLU GLU A . n A 1 153 SER 153 128 128 SER SER A . n A 1 154 LEU 154 129 129 LEU LEU A . n A 1 155 LYS 155 130 130 LYS LYS A . n A 1 156 VAL 156 131 131 VAL VAL A . n A 1 157 MET 157 132 132 MET MET A . n A 1 158 LEU 158 133 133 LEU LEU A . n A 1 159 LEU 159 134 134 LEU LEU A . n A 1 160 CYS 160 135 135 CYS CYS A . n A 1 161 GLY 161 136 136 GLY GLY A . n A 1 162 SER 162 137 137 SER SER A . n A 1 163 ASP 163 138 138 ASP ASP A . n A 1 164 LEU 164 139 139 LEU LEU A . n A 1 165 LEU 165 140 140 LEU LEU A . n A 1 166 LEU 166 141 141 LEU LEU A . n A 1 167 SER 167 142 142 SER SER A . n A 1 168 PHE 168 143 143 PHE PHE A . n A 1 169 CYS 169 144 144 CYS CYS A . n A 1 170 THR 170 145 145 THR THR A . n A 1 171 PRO 171 146 146 PRO PRO A . n A 1 172 GLY 172 147 147 GLY GLY A . n A 1 173 VAL 173 148 148 VAL VAL A . n A 1 174 TRP 174 149 149 TRP TRP A . n A 1 175 ILE 175 150 150 ILE ILE A . n A 1 176 PRO 176 151 151 PRO PRO A . n A 1 177 GLU 177 152 152 GLU GLU A . n A 1 178 GLN 178 153 153 GLN GLN A . n A 1 179 LEU 179 154 154 LEU LEU A . n A 1 180 ARG 180 155 155 ARG ARG A . n A 1 181 THR 181 156 156 THR THR A . n A 1 182 ILE 182 157 157 ILE ILE A . n A 1 183 CYS 183 158 158 CYS CYS A . n A 1 184 LYS 184 159 159 LYS LYS A . n A 1 185 ASP 185 160 160 ASP ASP A . n A 1 186 TYR 186 161 161 TYR TYR A . n A 1 187 GLY 187 162 162 GLY GLY A . n A 1 188 ILE 188 163 163 ILE ILE A . n A 1 189 VAL 189 164 164 VAL VAL A . n A 1 190 CYS 190 165 165 CYS CYS A . n A 1 191 ILE 191 166 166 ILE ILE A . n A 1 192 ARG 192 167 167 ARG ARG A . n A 1 193 ARG 193 168 168 ARG ARG A . n A 1 194 GLU 194 169 169 GLU GLU A . n A 1 195 GLY 195 170 ? ? ? A . n A 1 196 GLN 196 171 ? ? ? A . n A 1 197 ASP 197 172 ? ? ? A . n A 1 198 VAL 198 173 173 VAL VAL A . n A 1 199 GLU 199 174 174 GLU GLU A . n A 1 200 ASN 200 175 175 ASN ASN A . n A 1 201 MET 201 176 176 MET MET A . n A 1 202 ILE 202 177 177 ILE ILE A . n A 1 203 SER 203 178 178 SER SER A . n A 1 204 GLY 204 179 ? ? ? A . n A 1 205 ASP 205 180 ? ? ? A . n A 1 206 GLU 206 181 ? ? ? A . n A 1 207 ILE 207 182 ? ? ? A . n A 1 208 LEU 208 183 ? ? ? A . n A 1 209 ASN 209 184 ? ? ? A . n A 1 210 GLU 210 185 185 GLU GLU A . n A 1 211 ASN 211 186 186 ASN ASN A . n A 1 212 CYS 212 187 187 CYS CYS A . n A 1 213 ALA 213 188 188 ALA ALA A . n A 1 214 ASN 214 189 189 ASN ASN A . n A 1 215 VAL 215 190 190 VAL VAL A . n A 1 216 LYS 216 191 191 LYS LYS A . n A 1 217 ILE 217 192 192 ILE ILE A . n A 1 218 VAL 218 193 193 VAL VAL A . n A 1 219 ASP 219 194 194 ASP ASP A . n A 1 220 ASN 220 195 195 ASN ASN A . n A 1 221 THR 221 196 196 THR THR A . n A 1 222 VAL 222 197 197 VAL VAL A . n A 1 223 PRO 223 198 198 PRO PRO A . n A 1 224 ASN 224 199 199 ASN ASN A . n A 1 225 GLN 225 200 200 GLN GLN A . n A 1 226 ILE 226 201 201 ILE ILE A . n A 1 227 SER 227 202 202 SER SER A . n A 1 228 SER 228 203 203 SER SER A . n A 1 229 SER 229 204 204 SER SER A . n A 1 230 ARG 230 205 205 ARG ARG A . n A 1 231 LEU 231 206 206 LEU LEU A . n A 1 232 ARG 232 207 207 ARG ARG A . n A 1 233 GLN 233 208 208 GLN GLN A . n A 1 234 CYS 234 209 209 CYS CYS A . n A 1 235 ILE 235 210 210 ILE ILE A . n A 1 236 SER 236 211 211 SER SER A . n A 1 237 ARG 237 212 212 ARG ARG A . n A 1 238 GLY 238 213 213 GLY GLY A . n A 1 239 LEU 239 214 214 LEU LEU A . n A 1 240 SER 240 215 215 SER SER A . n A 1 241 VAL 241 216 216 VAL VAL A . n A 1 242 LYS 242 217 217 LYS LYS A . n A 1 243 TYR 243 218 218 TYR TYR A . n A 1 244 LEU 244 219 219 LEU LEU A . n A 1 245 THR 245 220 220 THR THR A . n A 1 246 GLU 246 221 221 GLU GLU A . n A 1 247 ASP 247 222 222 ASP ASP A . n A 1 248 GLY 248 223 223 GLY GLY A . n A 1 249 VAL 249 224 224 VAL VAL A . n A 1 250 ILE 250 225 225 ILE ILE A . n A 1 251 ASP 251 226 226 ASP ASP A . n A 1 252 TYR 252 227 227 TYR TYR A . n A 1 253 ILE 253 228 228 ILE ILE A . n A 1 254 ARG 254 229 229 ARG ARG A . n A 1 255 GLN 255 230 230 GLN GLN A . n A 1 256 HIS 256 231 231 HIS HIS A . n A 1 257 GLN 257 232 232 GLN GLN A . n A 1 258 LEU 258 233 233 LEU LEU A . n A 1 259 TYR 259 234 234 TYR TYR A . n A 1 260 THR 260 235 235 THR THR A . n A 1 261 GLU 261 236 236 GLU GLU A . n A 1 262 LEU 262 237 237 LEU LEU A . n A 1 263 THR 263 238 238 THR THR A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NCN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NCN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NCN 1 301 301 NCN NCN A . C 3 MG 1 302 1 MG MG A . D 4 HOH 1 401 20 HOH HOH A . D 4 HOH 2 402 4 HOH HOH A . D 4 HOH 3 403 23 HOH HOH A . D 4 HOH 4 404 1 HOH HOH A . D 4 HOH 5 405 21 HOH HOH A . D 4 HOH 6 406 12 HOH HOH A . D 4 HOH 7 407 13 HOH HOH A . D 4 HOH 8 408 15 HOH HOH A . D 4 HOH 9 409 5 HOH HOH A . D 4 HOH 10 410 24 HOH HOH A . D 4 HOH 11 411 7 HOH HOH A . D 4 HOH 12 412 8 HOH HOH A . D 4 HOH 13 413 2 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? BUILT=20210323 ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 ? 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9RPM _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.347 _cell.length_a_esd ? _cell.length_b 43.347 _cell.length_b_esd ? _cell.length_c 433.508 _cell.length_c_esd ? _cell.volume 705416.867 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9RPM _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall 'P 65 2 (x,y,z+1/12)' _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9RPM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM TRIS pH 8-9, 100-200 mM MgCl2, and 20-40% (w/v) poly ethylene glycol.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 66.77 _reflns.entry_id 9RPM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.66 _reflns.d_resolution_low 37.54 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7846 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 2 _reflns.percent_possible_obs 98.45 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star 1.00 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.139 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.66 _reflns_shell.d_res_low 2.76 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 678 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.535 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.950 _reflns_shell.pdbx_CC_star 0.987 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 87.93 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.922 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 76.74 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9RPM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.66 _refine.ls_d_res_low 37.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7816 _refine.ls_number_reflns_R_free 383 _refine.ls_number_reflns_R_work 7433 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.46 _refine.ls_percent_reflns_R_free 4.90 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2636 _refine.ls_R_factor_R_free 0.3048 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2614 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.5855 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1611 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.66 _refine_hist.d_res_low 37.54 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1809 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1773 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0015 ? 1826 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.4077 ? 2472 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0390 ? 288 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0039 ? 311 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 19.9741 ? 707 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.66 3.04 . . 119 2289 95.94 . . . . 0.3163 . . . . . . . . . . . . . . . 0.3103 'X-RAY DIFFRACTION' 3.05 3.84 . . 118 2458 99.50 . . . . 0.2992 . . . . . . . . . . . . . . . 0.3270 'X-RAY DIFFRACTION' 3.84 37.54 . . 146 2686 99.75 . . . . 0.2370 . . . . . . . . . . . . . . . 0.2969 # _struct.entry_id 9RPM _struct.title 'Structure of Arabidopsis thaliana nicotinate mononucleotide adenylyltransferase in complex with nicotinate mononucleotide (NaMN)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9RPM _struct_keywords.text 'NAD metabolism, NaMN, Arabidopsis thaliana, NaMNAT, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NMNAT_ARATH _struct_ref.pdbx_db_accession F4K687 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDVPLPVEKLSYGSNTEDKTCVVLVATGSFNPPTFMHLRMFELARDELRSKGFHVLGGYMSPVNDAYKKKGLLSAEHRLE MCNVSCQSSDFVMVDPWEASQSNYQRTLTVLSRVKTFLTTNRHVPEESLKVMLLCGSDLLLSFCTPGVWIPEQLRTICKD YGIVCIRREGQDVENMISGDEILNENCANVKIVDNTVPNQISSSRLRQCISRGLSVKYLTEDGVIDYIRQHQLYTELT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9RPM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 26 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F4K687 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9RPM MET A 1 ? UNP F4K687 ? ? 'initiating methionine' -24 1 1 9RPM GLY A 2 ? UNP F4K687 ? ? 'expression tag' -23 2 1 9RPM SER A 3 ? UNP F4K687 ? ? 'expression tag' -22 3 1 9RPM THR A 4 ? UNP F4K687 ? ? 'expression tag' -21 4 1 9RPM HIS A 5 ? UNP F4K687 ? ? 'expression tag' -20 5 1 9RPM HIS A 6 ? UNP F4K687 ? ? 'expression tag' -19 6 1 9RPM HIS A 7 ? UNP F4K687 ? ? 'expression tag' -18 7 1 9RPM HIS A 8 ? UNP F4K687 ? ? 'expression tag' -17 8 1 9RPM HIS A 9 ? UNP F4K687 ? ? 'expression tag' -16 9 1 9RPM HIS A 10 ? UNP F4K687 ? ? 'expression tag' -15 10 1 9RPM SER A 11 ? UNP F4K687 ? ? 'expression tag' -14 11 1 9RPM SER A 12 ? UNP F4K687 ? ? 'expression tag' -13 12 1 9RPM GLY A 13 ? UNP F4K687 ? ? 'expression tag' -12 13 1 9RPM LEU A 14 ? UNP F4K687 ? ? 'expression tag' -11 14 1 9RPM VAL A 15 ? UNP F4K687 ? ? 'expression tag' -10 15 1 9RPM PRO A 16 ? UNP F4K687 ? ? 'expression tag' -9 16 1 9RPM ARG A 17 ? UNP F4K687 ? ? 'expression tag' -8 17 1 9RPM GLY A 18 ? UNP F4K687 ? ? 'expression tag' -7 18 1 9RPM SER A 19 ? UNP F4K687 ? ? 'expression tag' -6 19 1 9RPM HIS A 20 ? UNP F4K687 ? ? 'expression tag' -5 20 1 9RPM MET A 21 ? UNP F4K687 ? ? 'expression tag' -4 21 1 9RPM ALA A 22 ? UNP F4K687 ? ? 'expression tag' -3 22 1 9RPM ARG A 23 ? UNP F4K687 ? ? 'expression tag' -2 23 1 9RPM ILE A 24 ? UNP F4K687 ? ? 'expression tag' -1 24 1 9RPM ARG A 25 ? UNP F4K687 ? ? 'expression tag' 0 25 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3770 ? 1 MORE -25 ? 1 'SSA (A^2)' 20900 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 59 ? SER A 75 ? THR A 34 SER A 50 1 ? 17 HELX_P HELX_P2 AA2 ASN A 89 ? LYS A 93 ? ASN A 64 LYS A 68 5 ? 5 HELX_P HELX_P3 AA3 SER A 99 ? CYS A 111 ? SER A 74 CYS A 86 1 ? 13 HELX_P HELX_P4 AA4 PRO A 121 ? GLN A 126 ? PRO A 96 GLN A 101 1 ? 6 HELX_P HELX_P5 AA5 ARG A 131 ? ASN A 146 ? ARG A 106 ASN A 121 1 ? 16 HELX_P HELX_P6 AA6 PRO A 150 ? GLU A 152 ? PRO A 125 GLU A 127 5 ? 3 HELX_P HELX_P7 AA7 SER A 162 ? SER A 167 ? SER A 137 SER A 142 1 ? 6 HELX_P HELX_P8 AA8 ILE A 175 ? TYR A 186 ? ILE A 150 TYR A 161 1 ? 12 HELX_P HELX_P9 AA9 GLU A 199 ? SER A 203 ? GLU A 174 SER A 178 1 ? 5 HELX_P HELX_P10 AB1 SER A 227 ? ARG A 237 ? SER A 202 ARG A 212 1 ? 11 HELX_P HELX_P11 AB2 GLU A 246 ? HIS A 256 ? GLU A 221 HIS A 231 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 56 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 31 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 57 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 32 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.84 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 117 ? VAL A 119 ? VAL A 92 VAL A 94 AA1 2 HIS A 79 ? PRO A 87 ? HIS A 54 PRO A 62 AA1 3 CYS A 46 ? GLY A 53 ? CYS A 21 GLY A 28 AA1 4 LEU A 154 ? GLY A 161 ? LEU A 129 GLY A 136 AA1 5 ILE A 188 ? ARG A 192 ? ILE A 163 ARG A 167 AA1 6 VAL A 215 ? ASP A 219 ? VAL A 190 ASP A 194 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O MET A 118 ? O MET A 93 N GLY A 83 ? N GLY A 58 AA1 2 3 O LEU A 81 ? O LEU A 56 N VAL A 47 ? N VAL A 22 AA1 3 4 N VAL A 50 ? N VAL A 25 O LEU A 159 ? O LEU A 134 AA1 4 5 N LEU A 158 ? N LEU A 133 O VAL A 189 ? O VAL A 164 AA1 5 6 N ARG A 192 ? N ARG A 167 O VAL A 218 ? O VAL A 193 # _pdbx_entry_details.entry_id 9RPM _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 91 ? ? -156.31 -11.68 2 1 TYR A 161 ? ? -134.01 -61.30 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -24 ? A MET 1 2 1 Y 1 A GLY -23 ? A GLY 2 3 1 Y 1 A SER -22 ? A SER 3 4 1 Y 1 A THR -21 ? A THR 4 5 1 Y 1 A HIS -20 ? A HIS 5 6 1 Y 1 A HIS -19 ? A HIS 6 7 1 Y 1 A HIS -18 ? A HIS 7 8 1 Y 1 A HIS -17 ? A HIS 8 9 1 Y 1 A HIS -16 ? A HIS 9 10 1 Y 1 A HIS -15 ? A HIS 10 11 1 Y 1 A SER -14 ? A SER 11 12 1 Y 1 A SER -13 ? A SER 12 13 1 Y 1 A GLY -12 ? A GLY 13 14 1 Y 1 A LEU -11 ? A LEU 14 15 1 Y 1 A VAL -10 ? A VAL 15 16 1 Y 1 A PRO -9 ? A PRO 16 17 1 Y 1 A ARG -8 ? A ARG 17 18 1 Y 1 A GLY -7 ? A GLY 18 19 1 Y 1 A SER -6 ? A SER 19 20 1 Y 1 A HIS -5 ? A HIS 20 21 1 Y 1 A MET -4 ? A MET 21 22 1 Y 1 A ALA -3 ? A ALA 22 23 1 Y 1 A ARG -2 ? A ARG 23 24 1 Y 1 A ILE -1 ? A ILE 24 25 1 Y 1 A ARG 0 ? A ARG 25 26 1 Y 1 A MET 1 ? A MET 26 27 1 Y 1 A GLY 13 ? A GLY 38 28 1 Y 1 A SER 14 ? A SER 39 29 1 Y 1 A ASN 15 ? A ASN 40 30 1 Y 1 A THR 16 ? A THR 41 31 1 Y 1 A GLU 17 ? A GLU 42 32 1 Y 1 A GLY 170 ? A GLY 195 33 1 Y 1 A GLN 171 ? A GLN 196 34 1 Y 1 A ASP 172 ? A ASP 197 35 1 Y 1 A GLY 179 ? A GLY 204 36 1 Y 1 A ASP 180 ? A ASP 205 37 1 Y 1 A GLU 181 ? A GLU 206 38 1 Y 1 A ILE 182 ? A ILE 207 39 1 Y 1 A LEU 183 ? A LEU 208 40 1 Y 1 A ASN 184 ? A ASN 209 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 NCN P P N N 251 NCN O1P O N N 252 NCN O2P O N N 253 NCN O3P O N N 254 NCN "O5'" O N N 255 NCN "C5'" C N N 256 NCN "C4'" C N R 257 NCN "O4'" O N N 258 NCN "C3'" C N S 259 NCN "O3'" O N N 260 NCN "C2'" C N R 261 NCN "O2'" O N N 262 NCN "C1'" C N R 263 NCN N1 N Y N 264 NCN C6 C Y N 265 NCN C5 C Y N 266 NCN C4 C Y N 267 NCN C3 C Y N 268 NCN C2 C Y N 269 NCN C7 C N N 270 NCN O7 O N N 271 NCN O8 O N N 272 NCN HOP1 H N N 273 NCN "H5'1" H N N 274 NCN "H5'2" H N N 275 NCN "H4'" H N N 276 NCN "H3'" H N N 277 NCN "HO'3" H N N 278 NCN "H2'" H N N 279 NCN "HO'2" H N N 280 NCN "H1'" H N N 281 NCN H6 H N N 282 NCN H5 H N N 283 NCN H4 H N N 284 NCN H2 H N N 285 NCN HO7 H N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 THR N N N N 341 THR CA C N S 342 THR C C N N 343 THR O O N N 344 THR CB C N R 345 THR OG1 O N N 346 THR CG2 C N N 347 THR OXT O N N 348 THR H H N N 349 THR H2 H N N 350 THR HA H N N 351 THR HB H N N 352 THR HG1 H N N 353 THR HG21 H N N 354 THR HG22 H N N 355 THR HG23 H N N 356 THR HXT H N N 357 TRP N N N N 358 TRP CA C N S 359 TRP C C N N 360 TRP O O N N 361 TRP CB C N N 362 TRP CG C Y N 363 TRP CD1 C Y N 364 TRP CD2 C Y N 365 TRP NE1 N Y N 366 TRP CE2 C Y N 367 TRP CE3 C Y N 368 TRP CZ2 C Y N 369 TRP CZ3 C Y N 370 TRP CH2 C Y N 371 TRP OXT O N N 372 TRP H H N N 373 TRP H2 H N N 374 TRP HA H N N 375 TRP HB2 H N N 376 TRP HB3 H N N 377 TRP HD1 H N N 378 TRP HE1 H N N 379 TRP HE3 H N N 380 TRP HZ2 H N N 381 TRP HZ3 H N N 382 TRP HH2 H N N 383 TRP HXT H N N 384 TYR N N N N 385 TYR CA C N S 386 TYR C C N N 387 TYR O O N N 388 TYR CB C N N 389 TYR CG C Y N 390 TYR CD1 C Y N 391 TYR CD2 C Y N 392 TYR CE1 C Y N 393 TYR CE2 C Y N 394 TYR CZ C Y N 395 TYR OH O N N 396 TYR OXT O N N 397 TYR H H N N 398 TYR H2 H N N 399 TYR HA H N N 400 TYR HB2 H N N 401 TYR HB3 H N N 402 TYR HD1 H N N 403 TYR HD2 H N N 404 TYR HE1 H N N 405 TYR HE2 H N N 406 TYR HH H N N 407 TYR HXT H N N 408 VAL N N N N 409 VAL CA C N S 410 VAL C C N N 411 VAL O O N N 412 VAL CB C N N 413 VAL CG1 C N N 414 VAL CG2 C N N 415 VAL OXT O N N 416 VAL H H N N 417 VAL H2 H N N 418 VAL HA H N N 419 VAL HB H N N 420 VAL HG11 H N N 421 VAL HG12 H N N 422 VAL HG13 H N N 423 VAL HG21 H N N 424 VAL HG22 H N N 425 VAL HG23 H N N 426 VAL HXT H N N 427 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NCN P O1P sing N N 237 NCN P O2P doub N N 238 NCN P O3P sing N N 239 NCN P "O5'" sing N N 240 NCN O1P HOP1 sing N N 241 NCN "O5'" "C5'" sing N N 242 NCN "C5'" "C4'" sing N N 243 NCN "C5'" "H5'1" sing N N 244 NCN "C5'" "H5'2" sing N N 245 NCN "C4'" "O4'" sing N N 246 NCN "C4'" "C3'" sing N N 247 NCN "C4'" "H4'" sing N N 248 NCN "O4'" "C1'" sing N N 249 NCN "C3'" "O3'" sing N N 250 NCN "C3'" "C2'" sing N N 251 NCN "C3'" "H3'" sing N N 252 NCN "O3'" "HO'3" sing N N 253 NCN "C2'" "O2'" sing N N 254 NCN "C2'" "C1'" sing N N 255 NCN "C2'" "H2'" sing N N 256 NCN "O2'" "HO'2" sing N N 257 NCN "C1'" N1 sing N N 258 NCN "C1'" "H1'" sing N N 259 NCN N1 C6 sing Y N 260 NCN N1 C2 doub Y N 261 NCN C6 C5 doub Y N 262 NCN C6 H6 sing N N 263 NCN C5 C4 sing Y N 264 NCN C5 H5 sing N N 265 NCN C4 C3 doub Y N 266 NCN C4 H4 sing N N 267 NCN C3 C2 sing Y N 268 NCN C3 C7 sing N N 269 NCN C2 H2 sing N N 270 NCN C7 O7 sing N N 271 NCN C7 O8 doub N N 272 NCN O7 HO7 sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details D_1292148607 # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9RPM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.023070 _atom_sites.fract_transf_matrix[1][2] 0.013319 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026639 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002307 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #