data_9S44 # _entry.id 9S44 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9S44 pdb_00009s44 10.2210/pdb9s44/pdb WWPDB D_1292149729 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-08-20 ? 2 'Structure model' 1 1 2025-08-27 ? 3 'Structure model' 1 2 2025-09-24 ? 4 'Structure model' 1 3 2025-11-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' citation 6 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 2 'Structure model' '_citation_author.name' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_citation_author.name' 14 4 'Structure model' '_citation.journal_volume' 15 4 'Structure model' '_citation.page_first' 16 4 'Structure model' '_citation.page_last' 17 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9S44 _pdbx_database_status.recvd_initial_deposition_date 2025-07-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 michael.groll@tum.de Michael Groll ? 'principal investigator/group leader' 0000-0002-1660-340X 3 eva.huber@tum.de Eva Huber M. 'principal investigator/group leader' 0000-0001-8018-7204 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wirawan, R.' 1 ? 'Frei, M.' 2 ? 'Heider, A.' 3 ? 'Papenkordt, N.' 4 ? 'Friedrich, F.' 5 ? 'Wein, T.' 6 ? 'Jung, M.' 7 ? 'Groll, M.' 8 ? 'Huber, E.M.' 9 ? 'Bracher, F.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Rsc Med Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2632-8682 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 5419 _citation.page_last 5440 _citation.title 'Tailored SirReal-type inhibitors enhance SIRT2 inhibition through ligand stabilization and disruption of NAD + co-factor binding.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d5md00144g _citation.pdbx_database_id_PubMed 40919320 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wirawan, R.' 1 ? primary 'Frei, M.' 2 ? primary 'Heider, A.' 3 ? primary 'Papenkordt, N.' 4 ? primary 'Friedrich, F.' 5 ? primary 'Wein, T.' 6 ? primary 'Jung, M.' 7 ? primary 'Groll, M.' 8 ? primary 'Huber, E.M.' 9 ? primary 'Bracher, F.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NAD-dependent protein deacetylase sirtuin-2' 34177.410 1 2.3.1.286,2.3.1.- ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NAD-dependent protein defatty-acylase sirtuin-2,Regulatory protein SIR2 homolog 2,SIR2-like protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFAL AKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIF SEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSD PFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS ; _entity_poly.pdbx_seq_one_letter_code_can ;SERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFAL AKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIF SEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSD PFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 ARG n 1 4 LEU n 1 5 LEU n 1 6 ASP n 1 7 GLU n 1 8 LEU n 1 9 THR n 1 10 LEU n 1 11 GLU n 1 12 GLY n 1 13 VAL n 1 14 ALA n 1 15 ARG n 1 16 TYR n 1 17 MET n 1 18 GLN n 1 19 SER n 1 20 GLU n 1 21 ARG n 1 22 CYS n 1 23 ARG n 1 24 ARG n 1 25 VAL n 1 26 ILE n 1 27 CYS n 1 28 LEU n 1 29 VAL n 1 30 GLY n 1 31 ALA n 1 32 GLY n 1 33 ILE n 1 34 SER n 1 35 THR n 1 36 SER n 1 37 ALA n 1 38 GLY n 1 39 ILE n 1 40 PRO n 1 41 ASP n 1 42 PHE n 1 43 ARG n 1 44 SER n 1 45 PRO n 1 46 SER n 1 47 THR n 1 48 GLY n 1 49 LEU n 1 50 TYR n 1 51 ASP n 1 52 ASN n 1 53 LEU n 1 54 GLU n 1 55 LYS n 1 56 TYR n 1 57 HIS n 1 58 LEU n 1 59 PRO n 1 60 TYR n 1 61 PRO n 1 62 GLU n 1 63 ALA n 1 64 ILE n 1 65 PHE n 1 66 GLU n 1 67 ILE n 1 68 SER n 1 69 TYR n 1 70 PHE n 1 71 LYS n 1 72 LYS n 1 73 HIS n 1 74 PRO n 1 75 GLU n 1 76 PRO n 1 77 PHE n 1 78 PHE n 1 79 ALA n 1 80 LEU n 1 81 ALA n 1 82 LYS n 1 83 GLU n 1 84 LEU n 1 85 TYR n 1 86 PRO n 1 87 GLY n 1 88 GLN n 1 89 PHE n 1 90 LYS n 1 91 PRO n 1 92 THR n 1 93 ILE n 1 94 CYS n 1 95 HIS n 1 96 TYR n 1 97 PHE n 1 98 MET n 1 99 ARG n 1 100 LEU n 1 101 LEU n 1 102 LYS n 1 103 ASP n 1 104 LYS n 1 105 GLY n 1 106 LEU n 1 107 LEU n 1 108 LEU n 1 109 ARG n 1 110 CYS n 1 111 TYR n 1 112 THR n 1 113 GLN n 1 114 ASN n 1 115 ILE n 1 116 ASP n 1 117 THR n 1 118 LEU n 1 119 GLU n 1 120 ARG n 1 121 ILE n 1 122 ALA n 1 123 GLY n 1 124 LEU n 1 125 GLU n 1 126 GLN n 1 127 GLU n 1 128 ASP n 1 129 LEU n 1 130 VAL n 1 131 GLU n 1 132 ALA n 1 133 HIS n 1 134 GLY n 1 135 THR n 1 136 PHE n 1 137 TYR n 1 138 THR n 1 139 SER n 1 140 HIS n 1 141 CYS n 1 142 VAL n 1 143 SER n 1 144 ALA n 1 145 SER n 1 146 CYS n 1 147 ARG n 1 148 HIS n 1 149 GLU n 1 150 TYR n 1 151 PRO n 1 152 LEU n 1 153 SER n 1 154 TRP n 1 155 MET n 1 156 LYS n 1 157 GLU n 1 158 LYS n 1 159 ILE n 1 160 PHE n 1 161 SER n 1 162 GLU n 1 163 VAL n 1 164 THR n 1 165 PRO n 1 166 LYS n 1 167 CYS n 1 168 GLU n 1 169 ASP n 1 170 CYS n 1 171 GLN n 1 172 SER n 1 173 LEU n 1 174 VAL n 1 175 LYS n 1 176 PRO n 1 177 ASP n 1 178 ILE n 1 179 VAL n 1 180 PHE n 1 181 PHE n 1 182 GLY n 1 183 GLU n 1 184 SER n 1 185 LEU n 1 186 PRO n 1 187 ALA n 1 188 ARG n 1 189 PHE n 1 190 PHE n 1 191 SER n 1 192 CYS n 1 193 MET n 1 194 GLN n 1 195 SER n 1 196 ASP n 1 197 PHE n 1 198 LEU n 1 199 LYS n 1 200 VAL n 1 201 ASP n 1 202 LEU n 1 203 LEU n 1 204 LEU n 1 205 VAL n 1 206 MET n 1 207 GLY n 1 208 THR n 1 209 SER n 1 210 LEU n 1 211 GLN n 1 212 VAL n 1 213 GLN n 1 214 PRO n 1 215 PHE n 1 216 ALA n 1 217 SER n 1 218 LEU n 1 219 ILE n 1 220 SER n 1 221 LYS n 1 222 ALA n 1 223 PRO n 1 224 LEU n 1 225 SER n 1 226 THR n 1 227 PRO n 1 228 ARG n 1 229 LEU n 1 230 LEU n 1 231 ILE n 1 232 ASN n 1 233 LYS n 1 234 GLU n 1 235 LYS n 1 236 ALA n 1 237 GLY n 1 238 GLN n 1 239 SER n 1 240 ASP n 1 241 PRO n 1 242 PHE n 1 243 LEU n 1 244 GLY n 1 245 MET n 1 246 ILE n 1 247 MET n 1 248 GLY n 1 249 LEU n 1 250 GLY n 1 251 GLY n 1 252 GLY n 1 253 MET n 1 254 ASP n 1 255 PHE n 1 256 ASP n 1 257 SER n 1 258 LYS n 1 259 LYS n 1 260 ALA n 1 261 TYR n 1 262 ARG n 1 263 ASP n 1 264 VAL n 1 265 ALA n 1 266 TRP n 1 267 LEU n 1 268 GLY n 1 269 GLU n 1 270 CYS n 1 271 ASP n 1 272 GLN n 1 273 GLY n 1 274 CYS n 1 275 LEU n 1 276 ALA n 1 277 LEU n 1 278 ALA n 1 279 GLU n 1 280 LEU n 1 281 LEU n 1 282 GLY n 1 283 TRP n 1 284 LYS n 1 285 LYS n 1 286 GLU n 1 287 LEU n 1 288 GLU n 1 289 ASP n 1 290 LEU n 1 291 VAL n 1 292 ARG n 1 293 ARG n 1 294 GLU n 1 295 HIS n 1 296 ALA n 1 297 SER n 1 298 ILE n 1 299 ASP n 1 300 ALA n 1 301 GLN n 1 302 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 302 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SIRT2, SIR2L, SIR2L2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Rosetta _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETDuet _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 55 55 SER SER A . n A 1 2 GLU 2 56 56 GLU GLU A . n A 1 3 ARG 3 57 57 ARG ARG A . n A 1 4 LEU 4 58 58 LEU LEU A . n A 1 5 LEU 5 59 59 LEU LEU A . n A 1 6 ASP 6 60 60 ASP ASP A . n A 1 7 GLU 7 61 61 GLU GLU A . n A 1 8 LEU 8 62 62 LEU LEU A . n A 1 9 THR 9 63 63 THR THR A . n A 1 10 LEU 10 64 64 LEU LEU A . n A 1 11 GLU 11 65 65 GLU GLU A . n A 1 12 GLY 12 66 66 GLY GLY A . n A 1 13 VAL 13 67 67 VAL VAL A . n A 1 14 ALA 14 68 68 ALA ALA A . n A 1 15 ARG 15 69 69 ARG ARG A . n A 1 16 TYR 16 70 70 TYR TYR A . n A 1 17 MET 17 71 71 MET MET A . n A 1 18 GLN 18 72 72 GLN GLN A . n A 1 19 SER 19 73 73 SER SER A . n A 1 20 GLU 20 74 74 GLU GLU A . n A 1 21 ARG 21 75 75 ARG ARG A . n A 1 22 CYS 22 76 76 CYS CYS A . n A 1 23 ARG 23 77 77 ARG ARG A . n A 1 24 ARG 24 78 78 ARG ARG A . n A 1 25 VAL 25 79 79 VAL VAL A . n A 1 26 ILE 26 80 80 ILE ILE A . n A 1 27 CYS 27 81 81 CYS CYS A . n A 1 28 LEU 28 82 82 LEU LEU A . n A 1 29 VAL 29 83 83 VAL VAL A . n A 1 30 GLY 30 84 84 GLY GLY A . n A 1 31 ALA 31 85 85 ALA ALA A . n A 1 32 GLY 32 86 86 GLY GLY A . n A 1 33 ILE 33 87 87 ILE ILE A . n A 1 34 SER 34 88 88 SER SER A . n A 1 35 THR 35 89 89 THR THR A . n A 1 36 SER 36 90 90 SER SER A . n A 1 37 ALA 37 91 91 ALA ALA A . n A 1 38 GLY 38 92 92 GLY GLY A . n A 1 39 ILE 39 93 93 ILE ILE A . n A 1 40 PRO 40 94 94 PRO PRO A . n A 1 41 ASP 41 95 95 ASP ASP A . n A 1 42 PHE 42 96 96 PHE PHE A . n A 1 43 ARG 43 97 97 ARG ARG A . n A 1 44 SER 44 98 98 SER SER A . n A 1 45 PRO 45 99 99 PRO PRO A . n A 1 46 SER 46 100 100 SER SER A . n A 1 47 THR 47 101 ? ? ? A . n A 1 48 GLY 48 102 ? ? ? A . n A 1 49 LEU 49 103 ? ? ? A . n A 1 50 TYR 50 104 ? ? ? A . n A 1 51 ASP 51 105 ? ? ? A . n A 1 52 ASN 52 106 ? ? ? A . n A 1 53 LEU 53 107 ? ? ? A . n A 1 54 GLU 54 108 ? ? ? A . n A 1 55 LYS 55 109 ? ? ? A . n A 1 56 TYR 56 110 ? ? ? A . n A 1 57 HIS 57 111 ? ? ? A . n A 1 58 LEU 58 112 ? ? ? A . n A 1 59 PRO 59 113 ? ? ? A . n A 1 60 TYR 60 114 ? ? ? A . n A 1 61 PRO 61 115 ? ? ? A . n A 1 62 GLU 62 116 ? ? ? A . n A 1 63 ALA 63 117 117 ALA ALA A . n A 1 64 ILE 64 118 118 ILE ILE A . n A 1 65 PHE 65 119 119 PHE PHE A . n A 1 66 GLU 66 120 120 GLU GLU A . n A 1 67 ILE 67 121 121 ILE ILE A . n A 1 68 SER 68 122 122 SER SER A . n A 1 69 TYR 69 123 123 TYR TYR A . n A 1 70 PHE 70 124 124 PHE PHE A . n A 1 71 LYS 71 125 125 LYS LYS A . n A 1 72 LYS 72 126 126 LYS LYS A . n A 1 73 HIS 73 127 127 HIS HIS A . n A 1 74 PRO 74 128 128 PRO PRO A . n A 1 75 GLU 75 129 129 GLU GLU A . n A 1 76 PRO 76 130 130 PRO PRO A . n A 1 77 PHE 77 131 131 PHE PHE A . n A 1 78 PHE 78 132 132 PHE PHE A . n A 1 79 ALA 79 133 133 ALA ALA A . n A 1 80 LEU 80 134 134 LEU LEU A . n A 1 81 ALA 81 135 135 ALA ALA A . n A 1 82 LYS 82 136 136 LYS LYS A . n A 1 83 GLU 83 137 137 GLU GLU A . n A 1 84 LEU 84 138 138 LEU LEU A . n A 1 85 TYR 85 139 139 TYR TYR A . n A 1 86 PRO 86 140 140 PRO PRO A . n A 1 87 GLY 87 141 141 GLY GLY A . n A 1 88 GLN 88 142 142 GLN GLN A . n A 1 89 PHE 89 143 143 PHE PHE A . n A 1 90 LYS 90 144 144 LYS LYS A . n A 1 91 PRO 91 145 145 PRO PRO A . n A 1 92 THR 92 146 146 THR THR A . n A 1 93 ILE 93 147 147 ILE ILE A . n A 1 94 CYS 94 148 148 CYS CYS A . n A 1 95 HIS 95 149 149 HIS HIS A . n A 1 96 TYR 96 150 150 TYR TYR A . n A 1 97 PHE 97 151 151 PHE PHE A . n A 1 98 MET 98 152 152 MET MET A . n A 1 99 ARG 99 153 153 ARG ARG A . n A 1 100 LEU 100 154 154 LEU LEU A . n A 1 101 LEU 101 155 155 LEU LEU A . n A 1 102 LYS 102 156 156 LYS LYS A . n A 1 103 ASP 103 157 157 ASP ASP A . n A 1 104 LYS 104 158 158 LYS LYS A . n A 1 105 GLY 105 159 159 GLY GLY A . n A 1 106 LEU 106 160 160 LEU LEU A . n A 1 107 LEU 107 161 161 LEU LEU A . n A 1 108 LEU 108 162 162 LEU LEU A . n A 1 109 ARG 109 163 163 ARG ARG A . n A 1 110 CYS 110 164 164 CYS CYS A . n A 1 111 TYR 111 165 165 TYR TYR A . n A 1 112 THR 112 166 166 THR THR A . n A 1 113 GLN 113 167 167 GLN GLN A . n A 1 114 ASN 114 168 168 ASN ASN A . n A 1 115 ILE 115 169 169 ILE ILE A . n A 1 116 ASP 116 170 170 ASP ASP A . n A 1 117 THR 117 171 171 THR THR A . n A 1 118 LEU 118 172 172 LEU LEU A . n A 1 119 GLU 119 173 173 GLU GLU A . n A 1 120 ARG 120 174 174 ARG ARG A . n A 1 121 ILE 121 175 175 ILE ILE A . n A 1 122 ALA 122 176 176 ALA ALA A . n A 1 123 GLY 123 177 177 GLY GLY A . n A 1 124 LEU 124 178 178 LEU LEU A . n A 1 125 GLU 125 179 179 GLU GLU A . n A 1 126 GLN 126 180 180 GLN GLN A . n A 1 127 GLU 127 181 181 GLU GLU A . n A 1 128 ASP 128 182 182 ASP ASP A . n A 1 129 LEU 129 183 183 LEU LEU A . n A 1 130 VAL 130 184 184 VAL VAL A . n A 1 131 GLU 131 185 185 GLU GLU A . n A 1 132 ALA 132 186 186 ALA ALA A . n A 1 133 HIS 133 187 187 HIS HIS A . n A 1 134 GLY 134 188 188 GLY GLY A . n A 1 135 THR 135 189 189 THR THR A . n A 1 136 PHE 136 190 190 PHE PHE A . n A 1 137 TYR 137 191 191 TYR TYR A . n A 1 138 THR 138 192 192 THR THR A . n A 1 139 SER 139 193 193 SER SER A . n A 1 140 HIS 140 194 194 HIS HIS A . n A 1 141 CYS 141 195 195 CYS CYS A . n A 1 142 VAL 142 196 196 VAL VAL A . n A 1 143 SER 143 197 197 SER SER A . n A 1 144 ALA 144 198 198 ALA ALA A . n A 1 145 SER 145 199 199 SER SER A . n A 1 146 CYS 146 200 200 CYS CYS A . n A 1 147 ARG 147 201 201 ARG ARG A . n A 1 148 HIS 148 202 202 HIS HIS A . n A 1 149 GLU 149 203 203 GLU GLU A . n A 1 150 TYR 150 204 204 TYR TYR A . n A 1 151 PRO 151 205 205 PRO PRO A . n A 1 152 LEU 152 206 206 LEU LEU A . n A 1 153 SER 153 207 207 SER SER A . n A 1 154 TRP 154 208 208 TRP TRP A . n A 1 155 MET 155 209 209 MET MET A . n A 1 156 LYS 156 210 210 LYS LYS A . n A 1 157 GLU 157 211 211 GLU GLU A . n A 1 158 LYS 158 212 212 LYS LYS A . n A 1 159 ILE 159 213 213 ILE ILE A . n A 1 160 PHE 160 214 214 PHE PHE A . n A 1 161 SER 161 215 215 SER SER A . n A 1 162 GLU 162 216 216 GLU GLU A . n A 1 163 VAL 163 217 217 VAL VAL A . n A 1 164 THR 164 218 218 THR THR A . n A 1 165 PRO 165 219 219 PRO PRO A . n A 1 166 LYS 166 220 220 LYS LYS A . n A 1 167 CYS 167 221 221 CYS CYS A . n A 1 168 GLU 168 222 222 GLU GLU A . n A 1 169 ASP 169 223 223 ASP ASP A . n A 1 170 CYS 170 224 224 CYS CYS A . n A 1 171 GLN 171 225 225 GLN GLN A . n A 1 172 SER 172 226 226 SER SER A . n A 1 173 LEU 173 227 227 LEU LEU A . n A 1 174 VAL 174 228 228 VAL VAL A . n A 1 175 LYS 175 229 229 LYS LYS A . n A 1 176 PRO 176 230 230 PRO PRO A . n A 1 177 ASP 177 231 231 ASP ASP A . n A 1 178 ILE 178 232 232 ILE ILE A . n A 1 179 VAL 179 233 233 VAL VAL A . n A 1 180 PHE 180 234 234 PHE PHE A . n A 1 181 PHE 181 235 235 PHE PHE A . n A 1 182 GLY 182 236 236 GLY GLY A . n A 1 183 GLU 183 237 237 GLU GLU A . n A 1 184 SER 184 238 238 SER SER A . n A 1 185 LEU 185 239 239 LEU LEU A . n A 1 186 PRO 186 240 240 PRO PRO A . n A 1 187 ALA 187 241 241 ALA ALA A . n A 1 188 ARG 188 242 242 ARG ARG A . n A 1 189 PHE 189 243 243 PHE PHE A . n A 1 190 PHE 190 244 244 PHE PHE A . n A 1 191 SER 191 245 245 SER SER A . n A 1 192 CYS 192 246 246 CYS CYS A . n A 1 193 MET 193 247 247 MET MET A . n A 1 194 GLN 194 248 248 GLN GLN A . n A 1 195 SER 195 249 249 SER SER A . n A 1 196 ASP 196 250 250 ASP ASP A . n A 1 197 PHE 197 251 251 PHE PHE A . n A 1 198 LEU 198 252 252 LEU LEU A . n A 1 199 LYS 199 253 253 LYS LYS A . n A 1 200 VAL 200 254 254 VAL VAL A . n A 1 201 ASP 201 255 255 ASP ASP A . n A 1 202 LEU 202 256 256 LEU LEU A . n A 1 203 LEU 203 257 257 LEU LEU A . n A 1 204 LEU 204 258 258 LEU LEU A . n A 1 205 VAL 205 259 259 VAL VAL A . n A 1 206 MET 206 260 260 MET MET A . n A 1 207 GLY 207 261 261 GLY GLY A . n A 1 208 THR 208 262 262 THR THR A . n A 1 209 SER 209 263 263 SER SER A . n A 1 210 LEU 210 264 264 LEU LEU A . n A 1 211 GLN 211 265 265 GLN GLN A . n A 1 212 VAL 212 266 266 VAL VAL A . n A 1 213 GLN 213 267 267 GLN GLN A . n A 1 214 PRO 214 268 268 PRO PRO A . n A 1 215 PHE 215 269 269 PHE PHE A . n A 1 216 ALA 216 270 270 ALA ALA A . n A 1 217 SER 217 271 271 SER SER A . n A 1 218 LEU 218 272 272 LEU LEU A . n A 1 219 ILE 219 273 273 ILE ILE A . n A 1 220 SER 220 274 274 SER SER A . n A 1 221 LYS 221 275 275 LYS LYS A . n A 1 222 ALA 222 276 276 ALA ALA A . n A 1 223 PRO 223 277 277 PRO PRO A . n A 1 224 LEU 224 278 278 LEU LEU A . n A 1 225 SER 225 279 279 SER SER A . n A 1 226 THR 226 280 280 THR THR A . n A 1 227 PRO 227 281 281 PRO PRO A . n A 1 228 ARG 228 282 282 ARG ARG A . n A 1 229 LEU 229 283 283 LEU LEU A . n A 1 230 LEU 230 284 284 LEU LEU A . n A 1 231 ILE 231 285 285 ILE ILE A . n A 1 232 ASN 232 286 286 ASN ASN A . n A 1 233 LYS 233 287 287 LYS LYS A . n A 1 234 GLU 234 288 288 GLU GLU A . n A 1 235 LYS 235 289 289 LYS LYS A . n A 1 236 ALA 236 290 290 ALA ALA A . n A 1 237 GLY 237 291 291 GLY GLY A . n A 1 238 GLN 238 292 292 GLN GLN A . n A 1 239 SER 239 293 293 SER SER A . n A 1 240 ASP 240 294 294 ASP ASP A . n A 1 241 PRO 241 295 295 PRO PRO A . n A 1 242 PHE 242 296 296 PHE PHE A . n A 1 243 LEU 243 297 ? ? ? A . n A 1 244 GLY 244 298 ? ? ? A . n A 1 245 MET 245 299 ? ? ? A . n A 1 246 ILE 246 300 ? ? ? A . n A 1 247 MET 247 301 ? ? ? A . n A 1 248 GLY 248 302 ? ? ? A . n A 1 249 LEU 249 303 ? ? ? A . n A 1 250 GLY 250 304 304 GLY GLY A . n A 1 251 GLY 251 305 305 GLY GLY A . n A 1 252 GLY 252 306 306 GLY GLY A . n A 1 253 MET 253 307 307 MET MET A . n A 1 254 ASP 254 308 308 ASP ASP A . n A 1 255 PHE 255 309 309 PHE PHE A . n A 1 256 ASP 256 310 310 ASP ASP A . n A 1 257 SER 257 311 311 SER SER A . n A 1 258 LYS 258 312 312 LYS LYS A . n A 1 259 LYS 259 313 313 LYS LYS A . n A 1 260 ALA 260 314 314 ALA ALA A . n A 1 261 TYR 261 315 315 TYR TYR A . n A 1 262 ARG 262 316 316 ARG ARG A . n A 1 263 ASP 263 317 317 ASP ASP A . n A 1 264 VAL 264 318 318 VAL VAL A . n A 1 265 ALA 265 319 319 ALA ALA A . n A 1 266 TRP 266 320 320 TRP TRP A . n A 1 267 LEU 267 321 321 LEU LEU A . n A 1 268 GLY 268 322 322 GLY GLY A . n A 1 269 GLU 269 323 323 GLU GLU A . n A 1 270 CYS 270 324 324 CYS CYS A . n A 1 271 ASP 271 325 325 ASP ASP A . n A 1 272 GLN 272 326 326 GLN GLN A . n A 1 273 GLY 273 327 327 GLY GLY A . n A 1 274 CYS 274 328 328 CYS CYS A . n A 1 275 LEU 275 329 329 LEU LEU A . n A 1 276 ALA 276 330 330 ALA ALA A . n A 1 277 LEU 277 331 331 LEU LEU A . n A 1 278 ALA 278 332 332 ALA ALA A . n A 1 279 GLU 279 333 333 GLU GLU A . n A 1 280 LEU 280 334 334 LEU LEU A . n A 1 281 LEU 281 335 335 LEU LEU A . n A 1 282 GLY 282 336 336 GLY GLY A . n A 1 283 TRP 283 337 337 TRP TRP A . n A 1 284 LYS 284 338 338 LYS LYS A . n A 1 285 LYS 285 339 339 LYS LYS A . n A 1 286 GLU 286 340 340 GLU GLU A . n A 1 287 LEU 287 341 341 LEU LEU A . n A 1 288 GLU 288 342 342 GLU GLU A . n A 1 289 ASP 289 343 343 ASP ASP A . n A 1 290 LEU 290 344 344 LEU LEU A . n A 1 291 VAL 291 345 345 VAL VAL A . n A 1 292 ARG 292 346 346 ARG ARG A . n A 1 293 ARG 293 347 347 ARG ARG A . n A 1 294 GLU 294 348 348 GLU GLU A . n A 1 295 HIS 295 349 349 HIS HIS A . n A 1 296 ALA 296 350 350 ALA ALA A . n A 1 297 SER 297 351 351 SER SER A . n A 1 298 ILE 298 352 352 ILE ILE A . n A 1 299 ASP 299 353 353 ASP ASP A . n A 1 300 ALA 300 354 354 ALA ALA A . n A 1 301 GLN 301 355 355 GLN GLN A . n A 1 302 SER 302 356 356 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 500 500 ZN ZN A . C 3 HOH 1 601 22 HOH HOH A . C 3 HOH 2 602 21 HOH HOH A . C 3 HOH 3 603 24 HOH HOH A . C 3 HOH 4 604 20 HOH HOH A . C 3 HOH 5 605 23 HOH HOH A . C 3 HOH 6 606 4 HOH HOH A . C 3 HOH 7 607 5 HOH HOH A . C 3 HOH 8 608 3 HOH HOH A . C 3 HOH 9 609 6 HOH HOH A . C 3 HOH 10 610 10 HOH HOH A . C 3 HOH 11 611 11 HOH HOH A . C 3 HOH 12 612 2 HOH HOH A . C 3 HOH 13 613 16 HOH HOH A . C 3 HOH 14 614 18 HOH HOH A . C 3 HOH 15 615 27 HOH HOH A . C 3 HOH 16 616 31 HOH HOH A . C 3 HOH 17 617 38 HOH HOH A . C 3 HOH 18 618 1 HOH HOH A . C 3 HOH 19 619 9 HOH HOH A . C 3 HOH 20 620 8 HOH HOH A . C 3 HOH 21 621 13 HOH HOH A . C 3 HOH 22 622 26 HOH HOH A . C 3 HOH 23 623 19 HOH HOH A . C 3 HOH 24 624 17 HOH HOH A . C 3 HOH 25 625 39 HOH HOH A . C 3 HOH 26 626 15 HOH HOH A . C 3 HOH 27 627 29 HOH HOH A . C 3 HOH 28 628 7 HOH HOH A . C 3 HOH 29 629 32 HOH HOH A . C 3 HOH 30 630 14 HOH HOH A . C 3 HOH 31 631 12 HOH HOH A . C 3 HOH 32 632 35 HOH HOH A . C 3 HOH 33 633 36 HOH HOH A . C 3 HOH 34 634 25 HOH HOH A . C 3 HOH 35 635 33 HOH HOH A . C 3 HOH 36 636 34 HOH HOH A . C 3 HOH 37 637 30 HOH HOH A . C 3 HOH 38 638 40 HOH HOH A . C 3 HOH 39 639 28 HOH HOH A . C 3 HOH 40 640 37 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 95.26 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9S44 _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.760 _cell.length_a_esd ? _cell.length_b 73.510 _cell.length_b_esd ? _cell.length_c 54.980 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9S44 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9S44 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M ammonium formate 20 % (w/v) PEG3350 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-03-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0597 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0597 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9S44 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.15 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15167 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.087 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.25 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1942 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.6 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.688 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.26 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.83 _refine.aniso_B[2][2] 0.29 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 2.09 _refine.B_iso_max ? _refine.B_iso_mean 47.445 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9S44 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.15 _refine.ls_d_res_low 30.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14404 _refine.ls_number_reflns_R_free 758 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.83 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23064 _refine.ls_R_factor_R_free 0.27373 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22844 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.238 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 19.267 _refine.overall_SU_ML 0.211 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.15 _refine_hist.d_res_low 30.00 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 2251 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2210 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.013 2262 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 2146 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.223 1.644 3047 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 1.030 1.579 4969 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.983 5.000 276 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 28.282 21.826 115 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.083 15.000 405 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 20.546 15.000 15 ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.036 0.200 285 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2508 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 510 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? 1.104 4.397 1113 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.104 4.394 1112 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 1.628 6.581 1386 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 1.627 6.583 1387 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 0.906 4.650 1149 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 0.903 4.648 1148 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 1.311 6.914 1661 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 2.458 50.878 2372 ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? 2.430 50.891 2370 ? r_long_range_B_other ? ? ? 'X-RAY DIFFRACTION' ? 0.247 3.000 4408 ? r_rigid_bond_restr ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.150 _refine_ls_shell.d_res_low 2.206 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 57 _refine_ls_shell.number_reflns_R_work 1081 _refine_ls_shell.percent_reflns_obs 98.61 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.325 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.326 # _struct.entry_id 9S44 _struct.title 'Human Histone Deacetylase SIRT2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9S44 _struct_keywords.text 'Lysine deacetylase, NAD+-dependant enzyme, Histone modification, Epigenetics, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIR2_HUMAN _struct_ref.pdbx_db_accession Q8IXJ6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALA KELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFS EVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDP FLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS ; _struct_ref.pdbx_align_begin 56 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9S44 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 302 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IXJ6 _struct_ref_seq.db_align_beg 56 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 356 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 56 _struct_ref_seq.pdbx_auth_seq_align_end 356 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9S44 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8IXJ6 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 55 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 14140 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 9 ? SER A 19 ? THR A 63 SER A 73 1 ? 11 HELX_P HELX_P2 AA2 ALA A 31 ? GLY A 38 ? ALA A 85 GLY A 92 5 ? 8 HELX_P HELX_P3 AA3 GLU A 66 ? HIS A 73 ? GLU A 120 HIS A 127 1 ? 8 HELX_P HELX_P4 AA4 PRO A 74 ? LEU A 84 ? PRO A 128 LEU A 138 1 ? 11 HELX_P HELX_P5 AA5 THR A 92 ? LYS A 104 ? THR A 146 LYS A 158 1 ? 13 HELX_P HELX_P6 AA6 THR A 117 ? ALA A 122 ? THR A 171 ALA A 176 1 ? 6 HELX_P HELX_P7 AA7 GLU A 125 ? GLU A 127 ? GLU A 179 GLU A 181 5 ? 3 HELX_P HELX_P8 AA8 LEU A 152 ? SER A 161 ? LEU A 206 SER A 215 1 ? 10 HELX_P HELX_P9 AA9 PRO A 186 ? PHE A 197 ? PRO A 240 PHE A 251 1 ? 12 HELX_P HELX_P10 AB1 PRO A 214 ? ALA A 222 ? PRO A 268 ALA A 276 5 ? 9 HELX_P HELX_P11 AB2 GLU A 269 ? GLY A 282 ? GLU A 323 GLY A 336 1 ? 14 HELX_P HELX_P12 AB3 TRP A 283 ? GLN A 301 ? TRP A 337 GLN A 355 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 141 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 195 A ZN 500 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc2 metalc ? ? A CYS 146 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 200 A ZN 500 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc3 metalc ? ? A CYS 167 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 221 A ZN 500 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc4 metalc ? ? A CYS 170 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 224 A ZN 500 1_555 ? ? ? ? ? ? ? 2.340 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 141 ? A CYS 195 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 146 ? A CYS 200 ? 1_555 110.2 ? 2 SG ? A CYS 141 ? A CYS 195 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 167 ? A CYS 221 ? 1_555 109.8 ? 3 SG ? A CYS 146 ? A CYS 200 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 167 ? A CYS 221 ? 1_555 115.0 ? 4 SG ? A CYS 141 ? A CYS 195 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 170 ? A CYS 224 ? 1_555 90.1 ? 5 SG ? A CYS 146 ? A CYS 200 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 170 ? A CYS 224 ? 1_555 117.8 ? 6 SG ? A CYS 167 ? A CYS 221 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 170 ? A CYS 224 ? 1_555 111.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 213 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 267 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 214 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 268 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.54 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 129 ? GLU A 131 ? LEU A 183 GLU A 185 AA1 2 LEU A 107 ? THR A 112 ? LEU A 161 THR A 166 AA1 3 VAL A 25 ? VAL A 29 ? VAL A 79 VAL A 83 AA1 4 LEU A 202 ? MET A 206 ? LEU A 256 MET A 260 AA1 5 ARG A 228 ? ASN A 232 ? ARG A 282 ASN A 286 AA1 6 ASP A 263 ? LEU A 267 ? ASP A 317 LEU A 321 AA2 1 GLU A 149 ? PRO A 151 ? GLU A 203 PRO A 205 AA2 2 GLY A 134 ? CYS A 141 ? GLY A 188 CYS A 195 AA2 3 VAL A 174 ? ILE A 178 ? VAL A 228 ILE A 232 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 130 ? O VAL A 184 N CYS A 110 ? N CYS A 164 AA1 2 3 O TYR A 111 ? O TYR A 165 N CYS A 27 ? N CYS A 81 AA1 3 4 N ILE A 26 ? N ILE A 80 O LEU A 204 ? O LEU A 258 AA1 4 5 N VAL A 205 ? N VAL A 259 O LEU A 229 ? O LEU A 283 AA1 5 6 N LEU A 230 ? N LEU A 284 O TRP A 266 ? O TRP A 320 AA2 1 2 O TYR A 150 ? O TYR A 204 N SER A 139 ? N SER A 193 AA2 2 3 N THR A 138 ? N THR A 192 O ASP A 177 ? O ASP A 231 # _pdbx_entry_details.entry_id 9S44 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 200 ? ? -117.52 -72.67 2 1 ASP A 231 ? ? -79.08 49.48 3 1 ARG A 316 ? ? -142.46 -15.49 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -7.4508 _pdbx_refine_tls.origin_y -11.5440 _pdbx_refine_tls.origin_z -7.4917 _pdbx_refine_tls.T[1][1] 0.0112 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0198 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0104 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1308 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0125 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0202 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.1034 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.1116 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.0466 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.2705 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.2406 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.6226 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0166 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0549 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0091 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0094 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0566 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0172 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0378 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.2720 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0400 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 55 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 500 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 101 ? A THR 47 2 1 Y 1 A GLY 102 ? A GLY 48 3 1 Y 1 A LEU 103 ? A LEU 49 4 1 Y 1 A TYR 104 ? A TYR 50 5 1 Y 1 A ASP 105 ? A ASP 51 6 1 Y 1 A ASN 106 ? A ASN 52 7 1 Y 1 A LEU 107 ? A LEU 53 8 1 Y 1 A GLU 108 ? A GLU 54 9 1 Y 1 A LYS 109 ? A LYS 55 10 1 Y 1 A TYR 110 ? A TYR 56 11 1 Y 1 A HIS 111 ? A HIS 57 12 1 Y 1 A LEU 112 ? A LEU 58 13 1 Y 1 A PRO 113 ? A PRO 59 14 1 Y 1 A TYR 114 ? A TYR 60 15 1 Y 1 A PRO 115 ? A PRO 61 16 1 Y 1 A GLU 116 ? A GLU 62 17 1 Y 1 A LEU 297 ? A LEU 243 18 1 Y 1 A GLY 298 ? A GLY 244 19 1 Y 1 A MET 299 ? A MET 245 20 1 Y 1 A ILE 300 ? A ILE 246 21 1 Y 1 A MET 301 ? A MET 247 22 1 Y 1 A GLY 302 ? A GLY 248 23 1 Y 1 A LEU 303 ? A LEU 249 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Research Foundation (DFG)' Germany 503267011 1 'German Research Foundation (DFG)' Germany '325871075 (SFB1309)' 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4RMG _pdbx_initial_refinement_model.details 'Human Sirt2 in complex with SirReal2 and NAD+' # _atom_sites.entry_id 9S44 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.027964 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002576 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013604 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018265 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ # loop_ #