data_9S4H # _entry.id 9S4H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9S4H pdb_00009s4h 10.2210/pdb9s4h/pdb WWPDB D_1292149681 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-08-13 ? 2 'Structure model' 1 1 2026-03-04 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9S4H _pdbx_database_status.recvd_initial_deposition_date 2025-07-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email frank.vondelft@cmd.ox.ac.uk _pdbx_contact_author.name_first Frank _pdbx_contact_author.name_last 'von Delft' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0378-0017 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kot, E.' 1 0009-0003-7867-3109 'Ni, X.' 2 0000-0002-7769-8297 'Mulholland, N.P.' 3 0000-0001-8836-7429 'Montgomery, M.G.' 4 0000-0001-9174-8281 'von Delft, F.' 5 0000-0003-0378-0017 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Pest Manag Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1526-4998 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 82 _citation.language ? _citation.page_first 151 _citation.page_last 168 _citation.title 'Crystal structure of fatty acid thioesterase A bound by 129 fragments provides diverse development opportunities.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/ps.70199 _citation.pdbx_database_id_PubMed 40936424 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kot, E.' 1 0009-0003-7867-3109 primary 'Ferla, M.P.' 2 ? primary 'Hollinshead, P.H.' 3 ? primary 'Tomlinson, C.W.E.' 4 0000-0002-1845-6028 primary 'Fearon, D.' 5 ? primary 'Aschenbrenner, J.C.' 6 0000-0002-4318-0481 primary 'Koekemoer, L.' 7 ? primary 'Winokan, M.' 8 ? primary 'Fairhead, M.' 9 ? primary 'Ni, X.' 10 ? primary 'Chalk, R.' 11 ? primary 'England, K.S.' 12 ? primary 'Varga, L.O.' 13 ? primary 'Montgomery, M.G.' 14 ? primary 'Mulholland, N.P.' 15 ? primary 'von Delft, F.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Oleoyl-acyl carrier protein thioesterase 1, chloroplastic' 33615.598 1 3.1.2.14 ? ? 'The N-terminal chloroplast transit peptide (residues 1-74) has been removed. A C-terminal His6 tag was added.' 2 non-polymer syn '1-(3,5-dihydro-2~{H}-1,4-benzothiazepin-4-yl)ethanone' 207.292 1 ? ? ? ? 3 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '18:0-acyl-carrier protein thioesterase,18:0-ACP thioesterase,Acyl-[acyl-carrier-protein] hydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSLTEDGLSYKEKFVVRSYEVGSNKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKY PAWGDVVEIETWCQSEGRIGTRRDWILKDSVTGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQEPRLAFPEEN NRSLKKIPKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVITLDYRRECQQDDVVDSLTTT TSEIGGTNGSATSGTQGHNDSQFLHLLRLSGDGQEINRGTTLWRKKPSSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSLTEDGLSYKEKFVVRSYEVGSNKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKY PAWGDVVEIETWCQSEGRIGTRRDWILKDSVTGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQEPRLAFPEEN NRSLKKIPKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVITLDYRRECQQDDVVDSLTTT TSEIGGTNGSATSGTQGHNDSQFLHLLRLSGDGQEINRGTTLWRKKPSSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(3,5-dihydro-2~{H}-1,4-benzothiazepin-4-yl)ethanone' A1JLP 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 ASP n 1 8 GLY n 1 9 LEU n 1 10 SER n 1 11 TYR n 1 12 LYS n 1 13 GLU n 1 14 LYS n 1 15 PHE n 1 16 VAL n 1 17 VAL n 1 18 ARG n 1 19 SER n 1 20 TYR n 1 21 GLU n 1 22 VAL n 1 23 GLY n 1 24 SER n 1 25 ASN n 1 26 LYS n 1 27 THR n 1 28 ALA n 1 29 THR n 1 30 VAL n 1 31 GLU n 1 32 THR n 1 33 ILE n 1 34 ALA n 1 35 ASN n 1 36 LEU n 1 37 LEU n 1 38 GLN n 1 39 GLU n 1 40 VAL n 1 41 GLY n 1 42 CYS n 1 43 ASN n 1 44 HIS n 1 45 ALA n 1 46 GLN n 1 47 SER n 1 48 VAL n 1 49 GLY n 1 50 PHE n 1 51 SER n 1 52 THR n 1 53 ASP n 1 54 GLY n 1 55 PHE n 1 56 ALA n 1 57 THR n 1 58 THR n 1 59 THR n 1 60 THR n 1 61 MET n 1 62 ARG n 1 63 LYS n 1 64 LEU n 1 65 HIS n 1 66 LEU n 1 67 ILE n 1 68 TRP n 1 69 VAL n 1 70 THR n 1 71 ALA n 1 72 ARG n 1 73 MET n 1 74 HIS n 1 75 ILE n 1 76 GLU n 1 77 ILE n 1 78 TYR n 1 79 LYS n 1 80 TYR n 1 81 PRO n 1 82 ALA n 1 83 TRP n 1 84 GLY n 1 85 ASP n 1 86 VAL n 1 87 VAL n 1 88 GLU n 1 89 ILE n 1 90 GLU n 1 91 THR n 1 92 TRP n 1 93 CYS n 1 94 GLN n 1 95 SER n 1 96 GLU n 1 97 GLY n 1 98 ARG n 1 99 ILE n 1 100 GLY n 1 101 THR n 1 102 ARG n 1 103 ARG n 1 104 ASP n 1 105 TRP n 1 106 ILE n 1 107 LEU n 1 108 LYS n 1 109 ASP n 1 110 SER n 1 111 VAL n 1 112 THR n 1 113 GLY n 1 114 GLU n 1 115 VAL n 1 116 THR n 1 117 GLY n 1 118 ARG n 1 119 ALA n 1 120 THR n 1 121 SER n 1 122 LYS n 1 123 TRP n 1 124 VAL n 1 125 MET n 1 126 MET n 1 127 ASN n 1 128 GLN n 1 129 ASP n 1 130 THR n 1 131 ARG n 1 132 ARG n 1 133 LEU n 1 134 GLN n 1 135 LYS n 1 136 VAL n 1 137 SER n 1 138 ASP n 1 139 ASP n 1 140 VAL n 1 141 ARG n 1 142 ASP n 1 143 GLU n 1 144 TYR n 1 145 LEU n 1 146 VAL n 1 147 PHE n 1 148 CYS n 1 149 PRO n 1 150 GLN n 1 151 GLU n 1 152 PRO n 1 153 ARG n 1 154 LEU n 1 155 ALA n 1 156 PHE n 1 157 PRO n 1 158 GLU n 1 159 GLU n 1 160 ASN n 1 161 ASN n 1 162 ARG n 1 163 SER n 1 164 LEU n 1 165 LYS n 1 166 LYS n 1 167 ILE n 1 168 PRO n 1 169 LYS n 1 170 LEU n 1 171 GLU n 1 172 ASP n 1 173 PRO n 1 174 ALA n 1 175 GLN n 1 176 TYR n 1 177 SER n 1 178 MET n 1 179 ILE n 1 180 GLY n 1 181 LEU n 1 182 LYS n 1 183 PRO n 1 184 ARG n 1 185 ARG n 1 186 ALA n 1 187 ASP n 1 188 LEU n 1 189 ASP n 1 190 MET n 1 191 ASN n 1 192 GLN n 1 193 HIS n 1 194 VAL n 1 195 ASN n 1 196 ASN n 1 197 VAL n 1 198 THR n 1 199 TYR n 1 200 ILE n 1 201 GLY n 1 202 TRP n 1 203 VAL n 1 204 LEU n 1 205 GLU n 1 206 SER n 1 207 ILE n 1 208 PRO n 1 209 GLN n 1 210 GLU n 1 211 ILE n 1 212 VAL n 1 213 ASP n 1 214 THR n 1 215 HIS n 1 216 GLU n 1 217 LEU n 1 218 GLN n 1 219 VAL n 1 220 ILE n 1 221 THR n 1 222 LEU n 1 223 ASP n 1 224 TYR n 1 225 ARG n 1 226 ARG n 1 227 GLU n 1 228 CYS n 1 229 GLN n 1 230 GLN n 1 231 ASP n 1 232 ASP n 1 233 VAL n 1 234 VAL n 1 235 ASP n 1 236 SER n 1 237 LEU n 1 238 THR n 1 239 THR n 1 240 THR n 1 241 THR n 1 242 SER n 1 243 GLU n 1 244 ILE n 1 245 GLY n 1 246 GLY n 1 247 THR n 1 248 ASN n 1 249 GLY n 1 250 SER n 1 251 ALA n 1 252 THR n 1 253 SER n 1 254 GLY n 1 255 THR n 1 256 GLN n 1 257 GLY n 1 258 HIS n 1 259 ASN n 1 260 ASP n 1 261 SER n 1 262 GLN n 1 263 PHE n 1 264 LEU n 1 265 HIS n 1 266 LEU n 1 267 LEU n 1 268 ARG n 1 269 LEU n 1 270 SER n 1 271 GLY n 1 272 ASP n 1 273 GLY n 1 274 GLN n 1 275 GLU n 1 276 ILE n 1 277 ASN n 1 278 ARG n 1 279 GLY n 1 280 THR n 1 281 THR n 1 282 LEU n 1 283 TRP n 1 284 ARG n 1 285 LYS n 1 286 LYS n 1 287 PRO n 1 288 SER n 1 289 SER n 1 290 HIS n 1 291 HIS n 1 292 HIS n 1 293 HIS n 1 294 HIS n 1 295 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 295 _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FATA, FATA1, At3g25110, MJL12.5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1JLP non-polymer . '1-(3,5-dihydro-2~{H}-1,4-benzothiazepin-4-yl)ethanone' ? 'C11 H13 N O S' 207.292 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 74 ? ? ? A . n A 1 2 GLY 2 75 75 GLY GLY A . n A 1 3 SER 3 76 76 SER SER A . n A 1 4 LEU 4 77 77 LEU LEU A . n A 1 5 THR 5 78 78 THR THR A . n A 1 6 GLU 6 79 79 GLU GLU A . n A 1 7 ASP 7 80 80 ASP ASP A . n A 1 8 GLY 8 81 81 GLY GLY A . n A 1 9 LEU 9 82 82 LEU LEU A . n A 1 10 SER 10 83 83 SER SER A . n A 1 11 TYR 11 84 84 TYR TYR A . n A 1 12 LYS 12 85 85 LYS LYS A . n A 1 13 GLU 13 86 86 GLU GLU A . n A 1 14 LYS 14 87 87 LYS LYS A . n A 1 15 PHE 15 88 88 PHE PHE A . n A 1 16 VAL 16 89 89 VAL VAL A . n A 1 17 VAL 17 90 90 VAL VAL A . n A 1 18 ARG 18 91 91 ARG ARG A . n A 1 19 SER 19 92 92 SER SER A . n A 1 20 TYR 20 93 93 TYR TYR A . n A 1 21 GLU 21 94 94 GLU GLU A . n A 1 22 VAL 22 95 95 VAL VAL A . n A 1 23 GLY 23 96 96 GLY GLY A . n A 1 24 SER 24 97 97 SER SER A . n A 1 25 ASN 25 98 98 ASN ASN A . n A 1 26 LYS 26 99 99 LYS LYS A . n A 1 27 THR 27 100 100 THR THR A . n A 1 28 ALA 28 101 101 ALA ALA A . n A 1 29 THR 29 102 102 THR THR A . n A 1 30 VAL 30 103 103 VAL VAL A . n A 1 31 GLU 31 104 104 GLU GLU A . n A 1 32 THR 32 105 105 THR THR A . n A 1 33 ILE 33 106 106 ILE ILE A . n A 1 34 ALA 34 107 107 ALA ALA A . n A 1 35 ASN 35 108 108 ASN ASN A . n A 1 36 LEU 36 109 109 LEU LEU A . n A 1 37 LEU 37 110 110 LEU LEU A . n A 1 38 GLN 38 111 111 GLN GLN A . n A 1 39 GLU 39 112 112 GLU GLU A . n A 1 40 VAL 40 113 113 VAL VAL A . n A 1 41 GLY 41 114 114 GLY GLY A . n A 1 42 CYS 42 115 115 CYS CYS A . n A 1 43 ASN 43 116 116 ASN ASN A . n A 1 44 HIS 44 117 117 HIS HIS A . n A 1 45 ALA 45 118 118 ALA ALA A . n A 1 46 GLN 46 119 119 GLN GLN A . n A 1 47 SER 47 120 120 SER SER A . n A 1 48 VAL 48 121 121 VAL VAL A . n A 1 49 GLY 49 122 122 GLY GLY A . n A 1 50 PHE 50 123 123 PHE PHE A . n A 1 51 SER 51 124 124 SER SER A . n A 1 52 THR 52 125 ? ? ? A . n A 1 53 ASP 53 126 ? ? ? A . n A 1 54 GLY 54 127 127 GLY GLY A . n A 1 55 PHE 55 128 128 PHE PHE A . n A 1 56 ALA 56 129 129 ALA ALA A . n A 1 57 THR 57 130 130 THR THR A . n A 1 58 THR 58 131 131 THR THR A . n A 1 59 THR 59 132 132 THR THR A . n A 1 60 THR 60 133 133 THR THR A . n A 1 61 MET 61 134 134 MET MET A . n A 1 62 ARG 62 135 135 ARG ARG A . n A 1 63 LYS 63 136 136 LYS LYS A . n A 1 64 LEU 64 137 137 LEU LEU A . n A 1 65 HIS 65 138 138 HIS HIS A . n A 1 66 LEU 66 139 139 LEU LEU A . n A 1 67 ILE 67 140 140 ILE ILE A . n A 1 68 TRP 68 141 141 TRP TRP A . n A 1 69 VAL 69 142 142 VAL VAL A . n A 1 70 THR 70 143 143 THR THR A . n A 1 71 ALA 71 144 144 ALA ALA A . n A 1 72 ARG 72 145 145 ARG ARG A . n A 1 73 MET 73 146 146 MET MET A . n A 1 74 HIS 74 147 147 HIS HIS A . n A 1 75 ILE 75 148 148 ILE ILE A . n A 1 76 GLU 76 149 149 GLU GLU A . n A 1 77 ILE 77 150 150 ILE ILE A . n A 1 78 TYR 78 151 151 TYR TYR A . n A 1 79 LYS 79 152 152 LYS LYS A . n A 1 80 TYR 80 153 153 TYR TYR A . n A 1 81 PRO 81 154 154 PRO PRO A . n A 1 82 ALA 82 155 155 ALA ALA A . n A 1 83 TRP 83 156 156 TRP TRP A . n A 1 84 GLY 84 157 157 GLY GLY A . n A 1 85 ASP 85 158 158 ASP ASP A . n A 1 86 VAL 86 159 159 VAL VAL A . n A 1 87 VAL 87 160 160 VAL VAL A . n A 1 88 GLU 88 161 161 GLU GLU A . n A 1 89 ILE 89 162 162 ILE ILE A . n A 1 90 GLU 90 163 163 GLU GLU A . n A 1 91 THR 91 164 164 THR THR A . n A 1 92 TRP 92 165 165 TRP TRP A . n A 1 93 CYS 93 166 166 CYS CYS A . n A 1 94 GLN 94 167 167 GLN GLN A . n A 1 95 SER 95 168 168 SER SER A . n A 1 96 GLU 96 169 169 GLU GLU A . n A 1 97 GLY 97 170 170 GLY GLY A . n A 1 98 ARG 98 171 171 ARG ARG A . n A 1 99 ILE 99 172 172 ILE ILE A . n A 1 100 GLY 100 173 173 GLY GLY A . n A 1 101 THR 101 174 174 THR THR A . n A 1 102 ARG 102 175 175 ARG ARG A . n A 1 103 ARG 103 176 176 ARG ARG A . n A 1 104 ASP 104 177 177 ASP ASP A . n A 1 105 TRP 105 178 178 TRP TRP A . n A 1 106 ILE 106 179 179 ILE ILE A . n A 1 107 LEU 107 180 180 LEU LEU A . n A 1 108 LYS 108 181 181 LYS LYS A . n A 1 109 ASP 109 182 182 ASP ASP A . n A 1 110 SER 110 183 183 SER SER A . n A 1 111 VAL 111 184 184 VAL VAL A . n A 1 112 THR 112 185 185 THR THR A . n A 1 113 GLY 113 186 186 GLY GLY A . n A 1 114 GLU 114 187 187 GLU GLU A . n A 1 115 VAL 115 188 188 VAL VAL A . n A 1 116 THR 116 189 189 THR THR A . n A 1 117 GLY 117 190 190 GLY GLY A . n A 1 118 ARG 118 191 191 ARG ARG A . n A 1 119 ALA 119 192 192 ALA ALA A . n A 1 120 THR 120 193 193 THR THR A . n A 1 121 SER 121 194 194 SER SER A . n A 1 122 LYS 122 195 195 LYS LYS A . n A 1 123 TRP 123 196 196 TRP TRP A . n A 1 124 VAL 124 197 197 VAL VAL A . n A 1 125 MET 125 198 198 MET MET A . n A 1 126 MET 126 199 199 MET MET A . n A 1 127 ASN 127 200 200 ASN ASN A . n A 1 128 GLN 128 201 201 GLN GLN A . n A 1 129 ASP 129 202 202 ASP ASP A . n A 1 130 THR 130 203 203 THR THR A . n A 1 131 ARG 131 204 204 ARG ARG A . n A 1 132 ARG 132 205 205 ARG ARG A . n A 1 133 LEU 133 206 206 LEU LEU A . n A 1 134 GLN 134 207 207 GLN GLN A . n A 1 135 LYS 135 208 208 LYS LYS A . n A 1 136 VAL 136 209 209 VAL VAL A . n A 1 137 SER 137 210 210 SER SER A . n A 1 138 ASP 138 211 211 ASP ASP A . n A 1 139 ASP 139 212 212 ASP ASP A . n A 1 140 VAL 140 213 213 VAL VAL A . n A 1 141 ARG 141 214 214 ARG ARG A . n A 1 142 ASP 142 215 215 ASP ASP A . n A 1 143 GLU 143 216 216 GLU GLU A . n A 1 144 TYR 144 217 217 TYR TYR A . n A 1 145 LEU 145 218 218 LEU LEU A . n A 1 146 VAL 146 219 219 VAL VAL A . n A 1 147 PHE 147 220 220 PHE PHE A . n A 1 148 CYS 148 221 221 CYS CYS A . n A 1 149 PRO 149 222 222 PRO PRO A . n A 1 150 GLN 150 223 223 GLN GLN A . n A 1 151 GLU 151 224 224 GLU GLU A . n A 1 152 PRO 152 225 225 PRO PRO A . n A 1 153 ARG 153 226 226 ARG ARG A . n A 1 154 LEU 154 227 227 LEU LEU A . n A 1 155 ALA 155 228 228 ALA ALA A . n A 1 156 PHE 156 229 229 PHE PHE A . n A 1 157 PRO 157 230 230 PRO PRO A . n A 1 158 GLU 158 231 ? ? ? A . n A 1 159 GLU 159 232 ? ? ? A . n A 1 160 ASN 160 233 ? ? ? A . n A 1 161 ASN 161 234 234 ASN ASN A . n A 1 162 ARG 162 235 235 ARG ARG A . n A 1 163 SER 163 236 236 SER SER A . n A 1 164 LEU 164 237 237 LEU LEU A . n A 1 165 LYS 165 238 238 LYS LYS A . n A 1 166 LYS 166 239 239 LYS LYS A . n A 1 167 ILE 167 240 240 ILE ILE A . n A 1 168 PRO 168 241 241 PRO PRO A . n A 1 169 LYS 169 242 242 LYS LYS A . n A 1 170 LEU 170 243 243 LEU LEU A . n A 1 171 GLU 171 244 244 GLU GLU A . n A 1 172 ASP 172 245 245 ASP ASP A . n A 1 173 PRO 173 246 246 PRO PRO A . n A 1 174 ALA 174 247 247 ALA ALA A . n A 1 175 GLN 175 248 248 GLN GLN A . n A 1 176 TYR 176 249 249 TYR TYR A . n A 1 177 SER 177 250 250 SER SER A . n A 1 178 MET 178 251 251 MET MET A . n A 1 179 ILE 179 252 252 ILE ILE A . n A 1 180 GLY 180 253 253 GLY GLY A . n A 1 181 LEU 181 254 254 LEU LEU A . n A 1 182 LYS 182 255 255 LYS LYS A . n A 1 183 PRO 183 256 256 PRO PRO A . n A 1 184 ARG 184 257 257 ARG ARG A . n A 1 185 ARG 185 258 258 ARG ARG A . n A 1 186 ALA 186 259 259 ALA ALA A . n A 1 187 ASP 187 260 260 ASP ASP A . n A 1 188 LEU 188 261 261 LEU LEU A . n A 1 189 ASP 189 262 262 ASP ASP A . n A 1 190 MET 190 263 263 MET MET A . n A 1 191 ASN 191 264 264 ASN ASN A . n A 1 192 GLN 192 265 265 GLN GLN A . n A 1 193 HIS 193 266 266 HIS HIS A . n A 1 194 VAL 194 267 267 VAL VAL A . n A 1 195 ASN 195 268 268 ASN ASN A . n A 1 196 ASN 196 269 269 ASN ASN A . n A 1 197 VAL 197 270 270 VAL VAL A . n A 1 198 THR 198 271 271 THR THR A . n A 1 199 TYR 199 272 272 TYR TYR A . n A 1 200 ILE 200 273 273 ILE ILE A . n A 1 201 GLY 201 274 274 GLY GLY A . n A 1 202 TRP 202 275 275 TRP TRP A . n A 1 203 VAL 203 276 276 VAL VAL A . n A 1 204 LEU 204 277 277 LEU LEU A . n A 1 205 GLU 205 278 278 GLU GLU A . n A 1 206 SER 206 279 279 SER SER A . n A 1 207 ILE 207 280 280 ILE ILE A . n A 1 208 PRO 208 281 281 PRO PRO A . n A 1 209 GLN 209 282 282 GLN GLN A . n A 1 210 GLU 210 283 283 GLU GLU A . n A 1 211 ILE 211 284 284 ILE ILE A . n A 1 212 VAL 212 285 285 VAL VAL A . n A 1 213 ASP 213 286 286 ASP ASP A . n A 1 214 THR 214 287 287 THR THR A . n A 1 215 HIS 215 288 288 HIS HIS A . n A 1 216 GLU 216 289 289 GLU GLU A . n A 1 217 LEU 217 290 290 LEU LEU A . n A 1 218 GLN 218 291 291 GLN GLN A . n A 1 219 VAL 219 292 292 VAL VAL A . n A 1 220 ILE 220 293 293 ILE ILE A . n A 1 221 THR 221 294 294 THR THR A . n A 1 222 LEU 222 295 295 LEU LEU A . n A 1 223 ASP 223 296 296 ASP ASP A . n A 1 224 TYR 224 297 297 TYR TYR A . n A 1 225 ARG 225 298 298 ARG ARG A . n A 1 226 ARG 226 299 299 ARG ARG A . n A 1 227 GLU 227 300 300 GLU GLU A . n A 1 228 CYS 228 301 301 CYS CYS A . n A 1 229 GLN 229 302 302 GLN GLN A . n A 1 230 GLN 230 303 303 GLN GLN A . n A 1 231 ASP 231 304 304 ASP ASP A . n A 1 232 ASP 232 305 305 ASP ASP A . n A 1 233 VAL 233 306 306 VAL VAL A . n A 1 234 VAL 234 307 307 VAL VAL A . n A 1 235 ASP 235 308 308 ASP ASP A . n A 1 236 SER 236 309 309 SER SER A . n A 1 237 LEU 237 310 310 LEU LEU A . n A 1 238 THR 238 311 311 THR THR A . n A 1 239 THR 239 312 312 THR THR A . n A 1 240 THR 240 313 313 THR THR A . n A 1 241 THR 241 314 314 THR THR A . n A 1 242 SER 242 315 315 SER SER A . n A 1 243 GLU 243 316 ? ? ? A . n A 1 244 ILE 244 317 ? ? ? A . n A 1 245 GLY 245 318 ? ? ? A . n A 1 246 GLY 246 319 ? ? ? A . n A 1 247 THR 247 320 ? ? ? A . n A 1 248 ASN 248 321 ? ? ? A . n A 1 249 GLY 249 322 ? ? ? A . n A 1 250 SER 250 323 ? ? ? A . n A 1 251 ALA 251 324 ? ? ? A . n A 1 252 THR 252 325 ? ? ? A . n A 1 253 SER 253 326 ? ? ? A . n A 1 254 GLY 254 327 ? ? ? A . n A 1 255 THR 255 328 ? ? ? A . n A 1 256 GLN 256 329 ? ? ? A . n A 1 257 GLY 257 330 ? ? ? A . n A 1 258 HIS 258 331 ? ? ? A . n A 1 259 ASN 259 332 ? ? ? A . n A 1 260 ASP 260 333 333 ASP ASP A . n A 1 261 SER 261 334 334 SER SER A . n A 1 262 GLN 262 335 335 GLN GLN A . n A 1 263 PHE 263 336 336 PHE PHE A . n A 1 264 LEU 264 337 337 LEU LEU A . n A 1 265 HIS 265 338 338 HIS HIS A . n A 1 266 LEU 266 339 339 LEU LEU A . n A 1 267 LEU 267 340 340 LEU LEU A . n A 1 268 ARG 268 341 341 ARG ARG A . n A 1 269 LEU 269 342 342 LEU LEU A . n A 1 270 SER 270 343 343 SER SER A . n A 1 271 GLY 271 344 344 GLY GLY A . n A 1 272 ASP 272 345 345 ASP ASP A . n A 1 273 GLY 273 346 346 GLY GLY A . n A 1 274 GLN 274 347 347 GLN GLN A . n A 1 275 GLU 275 348 348 GLU GLU A . n A 1 276 ILE 276 349 349 ILE ILE A . n A 1 277 ASN 277 350 350 ASN ASN A . n A 1 278 ARG 278 351 351 ARG ARG A . n A 1 279 GLY 279 352 352 GLY GLY A . n A 1 280 THR 280 353 353 THR THR A . n A 1 281 THR 281 354 354 THR THR A . n A 1 282 LEU 282 355 355 LEU LEU A . n A 1 283 TRP 283 356 356 TRP TRP A . n A 1 284 ARG 284 357 357 ARG ARG A . n A 1 285 LYS 285 358 358 LYS LYS A . n A 1 286 LYS 286 359 359 LYS LYS A . n A 1 287 PRO 287 360 ? ? ? A . n A 1 288 SER 288 361 ? ? ? A . n A 1 289 SER 289 362 ? ? ? A . n A 1 290 HIS 290 363 ? ? ? A . n A 1 291 HIS 291 364 ? ? ? A . n A 1 292 HIS 292 365 ? ? ? A . n A 1 293 HIS 293 366 ? ? ? A . n A 1 294 HIS 294 367 ? ? ? A . n A 1 295 HIS 295 368 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1JLP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1JLP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1JLP 1 401 401 A1JLP DRG A . C 3 HOH 1 501 7 HOH HOH A . C 3 HOH 2 502 1 HOH HOH A . C 3 HOH 3 503 4 HOH HOH A . C 3 HOH 4 504 6 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 214 ? CG ? A ARG 141 CG 2 1 Y 1 A ARG 214 ? CD ? A ARG 141 CD 3 1 Y 1 A ARG 214 ? NE ? A ARG 141 NE 4 1 Y 1 A ARG 214 ? CZ ? A ARG 141 CZ 5 1 Y 1 A ARG 214 ? NH1 ? A ARG 141 NH1 6 1 Y 1 A ARG 214 ? NH2 ? A ARG 141 NH2 7 1 Y 1 A ARG 299 ? CG ? A ARG 226 CG 8 1 Y 1 A ARG 299 ? CD ? A ARG 226 CD 9 1 Y 1 A ARG 299 ? NE ? A ARG 226 NE 10 1 Y 1 A ARG 299 ? CZ ? A ARG 226 CZ 11 1 Y 1 A ARG 299 ? NH1 ? A ARG 226 NH1 12 1 Y 1 A ARG 299 ? NH2 ? A ARG 226 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9S4H _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.531 _cell.length_a_esd ? _cell.length_b 98.531 _cell.length_b_esd ? _cell.length_c 128.692 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9S4H _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9S4H _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.85 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MES pH 6.85, 1.6M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-07-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9S4H _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.237 _reflns.d_resolution_low 69.77 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7561 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 48.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 22.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.967 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.237 _reflns_shell.d_res_low 2.434 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 378 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 24.9 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.624 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 11.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.35 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.35 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.70 _refine.B_iso_max ? _refine.B_iso_mean 26.075 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.906 _refine.correlation_coeff_Fo_to_Fc_free 0.851 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9S4H _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.24 _refine.ls_d_res_low 69.77 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7194 _refine.ls_number_reflns_R_free 366 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 48.22 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23003 _refine.ls_R_factor_R_free 0.28043 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22739 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.443 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.159 _refine.overall_SU_ML 0.262 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.24 _refine_hist.d_res_low 69.77 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 2127 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2109 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.012 2166 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2040 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.359 1.835 2934 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.454 1.786 4693 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.786 5.000 261 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.144 5.000 19 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.794 10.000 385 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.058 0.200 331 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 2567 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 503 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? 1.659 2.503 1050 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.658 2.503 1050 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 2.864 4.482 1306 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 2.863 4.484 1307 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 1.732 2.724 1116 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.732 2.724 1117 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 2.968 4.899 1628 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 4.818 23.37 2350 ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? 4.818 23.37 2351 ? r_long_range_B_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.24 _refine_ls_shell.d_res_low 2.295 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 1 _refine_ls_shell.number_reflns_R_work 39 _refine_ls_shell.percent_reflns_obs 3.51 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.277 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.003 # _struct.entry_id 9S4H _struct.title 'Crystal structure of Arabidopsis thaliana Fatty Acid Thioesterase A with the x1816-FU1 ligand' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9S4H _struct_keywords.text ;Fatty Acid Thioesterase, Plant, Fatty Acid Biosynthesis, Fatty Acid, Chain termination, Dimer, Hydrolase, Acyl-ACP thioesterase, Acyl ACP thioesterase, 18:1 FA, FatA, ACP, Herbicide, Mode of Action ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FATA1_ARATH _struct_ref.pdbx_db_accession Q42561 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSLTEDGLSYKEKFVVRSYEVGSNKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYP AWGDVVEIETWCQSEGRIGTRRDWILKDSVTGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQEPRLAFPEENN RSLKKIPKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVITLDYRRECQQDDVVDSLTTTT SEIGGTNGSATSGTQGHNDSQFLHLLRLSGDGQEINRGTTLWRKKPSS ; _struct_ref.pdbx_align_begin 75 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9S4H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 289 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q42561 _struct_ref_seq.db_align_beg 75 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 362 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 75 _struct_ref_seq.pdbx_auth_seq_align_end 362 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9S4H MET A 1 ? UNP Q42561 ? ? 'initiating methionine' 74 1 1 9S4H HIS A 290 ? UNP Q42561 ? ? 'expression tag' 363 2 1 9S4H HIS A 291 ? UNP Q42561 ? ? 'expression tag' 364 3 1 9S4H HIS A 292 ? UNP Q42561 ? ? 'expression tag' 365 4 1 9S4H HIS A 293 ? UNP Q42561 ? ? 'expression tag' 366 5 1 9S4H HIS A 294 ? UNP Q42561 ? ? 'expression tag' 367 6 1 9S4H HIS A 295 ? UNP Q42561 ? ? 'expression tag' 368 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13570 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 18 ? VAL A 22 ? ARG A 91 VAL A 95 5 ? 5 HELX_P HELX_P2 AA2 THR A 29 ? SER A 47 ? THR A 102 SER A 120 1 ? 19 HELX_P HELX_P3 AA3 THR A 58 ? HIS A 65 ? THR A 131 HIS A 138 1 ? 8 HELX_P HELX_P4 AA4 TYR A 144 ? CYS A 148 ? TYR A 217 CYS A 221 5 ? 5 HELX_P HELX_P5 AA5 ASN A 161 ? LYS A 165 ? ASN A 234 LYS A 238 5 ? 5 HELX_P HELX_P6 AA6 ARG A 184 ? LEU A 188 ? ARG A 257 LEU A 261 5 ? 5 HELX_P HELX_P7 AA7 ASN A 195 ? LEU A 204 ? ASN A 268 LEU A 277 1 ? 10 HELX_P HELX_P8 AA8 PRO A 208 ? THR A 214 ? PRO A 281 THR A 287 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 172 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 245 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 173 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 246 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -9.09 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 11 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 3 ? LEU A 4 ? SER A 76 LEU A 77 AA1 2 TYR A 11 ? VAL A 16 ? TYR A 84 VAL A 89 AA1 3 VAL A 86 ? GLU A 96 ? VAL A 159 GLU A 169 AA1 4 GLY A 100 ? ASP A 109 ? GLY A 173 ASP A 182 AA1 5 VAL A 115 ? ASN A 127 ? VAL A 188 ASN A 200 AA1 6 LEU A 66 ? ILE A 77 ? LEU A 139 ILE A 150 AA1 7 HIS A 215 ? TYR A 224 ? HIS A 288 TYR A 297 AA1 8 GLU A 275 ? LYS A 285 ? GLU A 348 LYS A 358 AA1 9 SER A 261 ? LEU A 269 ? SER A 334 LEU A 342 AA1 10 VAL A 234 ? THR A 240 ? VAL A 307 THR A 313 AA1 11 TYR A 176 ? LEU A 181 ? TYR A 249 LEU A 254 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 3 ? N SER A 76 O LYS A 12 ? O LYS A 85 AA1 2 3 N GLU A 13 ? N GLU A 86 O ILE A 89 ? O ILE A 162 AA1 3 4 N GLU A 88 ? N GLU A 161 O LYS A 108 ? O LYS A 181 AA1 4 5 N LEU A 107 ? N LEU A 180 O GLY A 117 ? O GLY A 190 AA1 5 6 O LYS A 122 ? O LYS A 195 N ALA A 71 ? N ALA A 144 AA1 6 7 N ALA A 71 ? N ALA A 144 O TYR A 224 ? O TYR A 297 AA1 7 8 N GLN A 218 ? N GLN A 291 O LEU A 282 ? O LEU A 355 AA1 8 9 O TRP A 283 ? O TRP A 356 N SER A 261 ? N SER A 334 AA1 9 10 O ARG A 268 ? O ARG A 341 N ASP A 235 ? N ASP A 308 AA1 10 11 O SER A 236 ? O SER A 309 N MET A 178 ? N MET A 251 # _pdbx_entry_details.entry_id 9S4H _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 214 ? ? -67.37 5.86 2 1 PHE A 229 ? ? -118.77 76.41 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 74 ? A MET 1 2 1 Y 1 A THR 125 ? A THR 52 3 1 Y 1 A ASP 126 ? A ASP 53 4 1 Y 1 A GLU 231 ? A GLU 158 5 1 Y 1 A GLU 232 ? A GLU 159 6 1 Y 1 A ASN 233 ? A ASN 160 7 1 Y 1 A GLU 316 ? A GLU 243 8 1 Y 1 A ILE 317 ? A ILE 244 9 1 Y 1 A GLY 318 ? A GLY 245 10 1 Y 1 A GLY 319 ? A GLY 246 11 1 Y 1 A THR 320 ? A THR 247 12 1 Y 1 A ASN 321 ? A ASN 248 13 1 Y 1 A GLY 322 ? A GLY 249 14 1 Y 1 A SER 323 ? A SER 250 15 1 Y 1 A ALA 324 ? A ALA 251 16 1 Y 1 A THR 325 ? A THR 252 17 1 Y 1 A SER 326 ? A SER 253 18 1 Y 1 A GLY 327 ? A GLY 254 19 1 Y 1 A THR 328 ? A THR 255 20 1 Y 1 A GLN 329 ? A GLN 256 21 1 Y 1 A GLY 330 ? A GLY 257 22 1 Y 1 A HIS 331 ? A HIS 258 23 1 Y 1 A ASN 332 ? A ASN 259 24 1 Y 1 A PRO 360 ? A PRO 287 25 1 Y 1 A SER 361 ? A SER 288 26 1 Y 1 A SER 362 ? A SER 289 27 1 Y 1 A HIS 363 ? A HIS 290 28 1 Y 1 A HIS 364 ? A HIS 291 29 1 Y 1 A HIS 365 ? A HIS 292 30 1 Y 1 A HIS 366 ? A HIS 293 31 1 Y 1 A HIS 367 ? A HIS 294 32 1 Y 1 A HIS 368 ? A HIS 295 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1JLP C4 C N N 1 A1JLP C5 C Y N 2 A1JLP C6 C Y N 3 A1JLP C11 C N N 4 A1JLP C7 C Y N 5 A1JLP C8 C Y N 6 A1JLP C9 C Y N 7 A1JLP C10 C Y N 8 A1JLP N1 N N N 9 A1JLP C3 C N N 10 A1JLP C1 C N N 11 A1JLP C2 C N N 12 A1JLP O1 O N N 13 A1JLP S1 S N N 14 A1JLP H1 H N N 15 A1JLP H2 H N N 16 A1JLP H3 H N N 17 A1JLP H4 H N N 18 A1JLP H5 H N N 19 A1JLP H6 H N N 20 A1JLP H7 H N N 21 A1JLP H8 H N N 22 A1JLP H9 H N N 23 A1JLP H10 H N N 24 A1JLP H11 H N N 25 A1JLP H12 H N N 26 A1JLP H13 H N N 27 ALA N N N N 28 ALA CA C N S 29 ALA C C N N 30 ALA O O N N 31 ALA CB C N N 32 ALA OXT O N N 33 ALA H H N N 34 ALA H2 H N N 35 ALA HA H N N 36 ALA HB1 H N N 37 ALA HB2 H N N 38 ALA HB3 H N N 39 ALA HXT H N N 40 ARG N N N N 41 ARG CA C N S 42 ARG C C N N 43 ARG O O N N 44 ARG CB C N N 45 ARG CG C N N 46 ARG CD C N N 47 ARG NE N N N 48 ARG CZ C N N 49 ARG NH1 N N N 50 ARG NH2 N N N 51 ARG OXT O N N 52 ARG H H N N 53 ARG H2 H N N 54 ARG HA H N N 55 ARG HB2 H N N 56 ARG HB3 H N N 57 ARG HG2 H N N 58 ARG HG3 H N N 59 ARG HD2 H N N 60 ARG HD3 H N N 61 ARG HE H N N 62 ARG HH11 H N N 63 ARG HH12 H N N 64 ARG HH21 H N N 65 ARG HH22 H N N 66 ARG HXT H N N 67 ASN N N N N 68 ASN CA C N S 69 ASN C C N N 70 ASN O O N N 71 ASN CB C N N 72 ASN CG C N N 73 ASN OD1 O N N 74 ASN ND2 N N N 75 ASN OXT O N N 76 ASN H H N N 77 ASN H2 H N N 78 ASN HA H N N 79 ASN HB2 H N N 80 ASN HB3 H N N 81 ASN HD21 H N N 82 ASN HD22 H N N 83 ASN HXT H N N 84 ASP N N N N 85 ASP CA C N S 86 ASP C C N N 87 ASP O O N N 88 ASP CB C N N 89 ASP CG C N N 90 ASP OD1 O N N 91 ASP OD2 O N N 92 ASP OXT O N N 93 ASP H H N N 94 ASP H2 H N N 95 ASP HA H N N 96 ASP HB2 H N N 97 ASP HB3 H N N 98 ASP HD2 H N N 99 ASP HXT H N N 100 CYS N N N N 101 CYS CA C N R 102 CYS C C N N 103 CYS O O N N 104 CYS CB C N N 105 CYS SG S N N 106 CYS OXT O N N 107 CYS H H N N 108 CYS H2 H N N 109 CYS HA H N N 110 CYS HB2 H N N 111 CYS HB3 H N N 112 CYS HG H N N 113 CYS HXT H N N 114 GLN N N N N 115 GLN CA C N S 116 GLN C C N N 117 GLN O O N N 118 GLN CB C N N 119 GLN CG C N N 120 GLN CD C N N 121 GLN OE1 O N N 122 GLN NE2 N N N 123 GLN OXT O N N 124 GLN H H N N 125 GLN H2 H N N 126 GLN HA H N N 127 GLN HB2 H N N 128 GLN HB3 H N N 129 GLN HG2 H N N 130 GLN HG3 H N N 131 GLN HE21 H N N 132 GLN HE22 H N N 133 GLN HXT H N N 134 GLU N N N N 135 GLU CA C N S 136 GLU C C N N 137 GLU O O N N 138 GLU CB C N N 139 GLU CG C N N 140 GLU CD C N N 141 GLU OE1 O N N 142 GLU OE2 O N N 143 GLU OXT O N N 144 GLU H H N N 145 GLU H2 H N N 146 GLU HA H N N 147 GLU HB2 H N N 148 GLU HB3 H N N 149 GLU HG2 H N N 150 GLU HG3 H N N 151 GLU HE2 H N N 152 GLU HXT H N N 153 GLY N N N N 154 GLY CA C N N 155 GLY C C N N 156 GLY O O N N 157 GLY OXT O N N 158 GLY H H N N 159 GLY H2 H N N 160 GLY HA2 H N N 161 GLY HA3 H N N 162 GLY HXT H N N 163 HIS N N N N 164 HIS CA C N S 165 HIS C C N N 166 HIS O O N N 167 HIS CB C N N 168 HIS CG C Y N 169 HIS ND1 N Y N 170 HIS CD2 C Y N 171 HIS CE1 C Y N 172 HIS NE2 N Y N 173 HIS OXT O N N 174 HIS H H N N 175 HIS H2 H N N 176 HIS HA H N N 177 HIS HB2 H N N 178 HIS HB3 H N N 179 HIS HD1 H N N 180 HIS HD2 H N N 181 HIS HE1 H N N 182 HIS HE2 H N N 183 HIS HXT H N N 184 HOH O O N N 185 HOH H1 H N N 186 HOH H2 H N N 187 ILE N N N N 188 ILE CA C N S 189 ILE C C N N 190 ILE O O N N 191 ILE CB C N S 192 ILE CG1 C N N 193 ILE CG2 C N N 194 ILE CD1 C N N 195 ILE OXT O N N 196 ILE H H N N 197 ILE H2 H N N 198 ILE HA H N N 199 ILE HB H N N 200 ILE HG12 H N N 201 ILE HG13 H N N 202 ILE HG21 H N N 203 ILE HG22 H N N 204 ILE HG23 H N N 205 ILE HD11 H N N 206 ILE HD12 H N N 207 ILE HD13 H N N 208 ILE HXT H N N 209 LEU N N N N 210 LEU CA C N S 211 LEU C C N N 212 LEU O O N N 213 LEU CB C N N 214 LEU CG C N N 215 LEU CD1 C N N 216 LEU CD2 C N N 217 LEU OXT O N N 218 LEU H H N N 219 LEU H2 H N N 220 LEU HA H N N 221 LEU HB2 H N N 222 LEU HB3 H N N 223 LEU HG H N N 224 LEU HD11 H N N 225 LEU HD12 H N N 226 LEU HD13 H N N 227 LEU HD21 H N N 228 LEU HD22 H N N 229 LEU HD23 H N N 230 LEU HXT H N N 231 LYS N N N N 232 LYS CA C N S 233 LYS C C N N 234 LYS O O N N 235 LYS CB C N N 236 LYS CG C N N 237 LYS CD C N N 238 LYS CE C N N 239 LYS NZ N N N 240 LYS OXT O N N 241 LYS H H N N 242 LYS H2 H N N 243 LYS HA H N N 244 LYS HB2 H N N 245 LYS HB3 H N N 246 LYS HG2 H N N 247 LYS HG3 H N N 248 LYS HD2 H N N 249 LYS HD3 H N N 250 LYS HE2 H N N 251 LYS HE3 H N N 252 LYS HZ1 H N N 253 LYS HZ2 H N N 254 LYS HZ3 H N N 255 LYS HXT H N N 256 MET N N N N 257 MET CA C N S 258 MET C C N N 259 MET O O N N 260 MET CB C N N 261 MET CG C N N 262 MET SD S N N 263 MET CE C N N 264 MET OXT O N N 265 MET H H N N 266 MET H2 H N N 267 MET HA H N N 268 MET HB2 H N N 269 MET HB3 H N N 270 MET HG2 H N N 271 MET HG3 H N N 272 MET HE1 H N N 273 MET HE2 H N N 274 MET HE3 H N N 275 MET HXT H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 THR N N N N 331 THR CA C N S 332 THR C C N N 333 THR O O N N 334 THR CB C N R 335 THR OG1 O N N 336 THR CG2 C N N 337 THR OXT O N N 338 THR H H N N 339 THR H2 H N N 340 THR HA H N N 341 THR HB H N N 342 THR HG1 H N N 343 THR HG21 H N N 344 THR HG22 H N N 345 THR HG23 H N N 346 THR HXT H N N 347 TRP N N N N 348 TRP CA C N S 349 TRP C C N N 350 TRP O O N N 351 TRP CB C N N 352 TRP CG C Y N 353 TRP CD1 C Y N 354 TRP CD2 C Y N 355 TRP NE1 N Y N 356 TRP CE2 C Y N 357 TRP CE3 C Y N 358 TRP CZ2 C Y N 359 TRP CZ3 C Y N 360 TRP CH2 C Y N 361 TRP OXT O N N 362 TRP H H N N 363 TRP H2 H N N 364 TRP HA H N N 365 TRP HB2 H N N 366 TRP HB3 H N N 367 TRP HD1 H N N 368 TRP HE1 H N N 369 TRP HE3 H N N 370 TRP HZ2 H N N 371 TRP HZ3 H N N 372 TRP HH2 H N N 373 TRP HXT H N N 374 TYR N N N N 375 TYR CA C N S 376 TYR C C N N 377 TYR O O N N 378 TYR CB C N N 379 TYR CG C Y N 380 TYR CD1 C Y N 381 TYR CD2 C Y N 382 TYR CE1 C Y N 383 TYR CE2 C Y N 384 TYR CZ C Y N 385 TYR OH O N N 386 TYR OXT O N N 387 TYR H H N N 388 TYR H2 H N N 389 TYR HA H N N 390 TYR HB2 H N N 391 TYR HB3 H N N 392 TYR HD1 H N N 393 TYR HD2 H N N 394 TYR HE1 H N N 395 TYR HE2 H N N 396 TYR HH H N N 397 TYR HXT H N N 398 VAL N N N N 399 VAL CA C N S 400 VAL C C N N 401 VAL O O N N 402 VAL CB C N N 403 VAL CG1 C N N 404 VAL CG2 C N N 405 VAL OXT O N N 406 VAL H H N N 407 VAL H2 H N N 408 VAL HA H N N 409 VAL HB H N N 410 VAL HG11 H N N 411 VAL HG12 H N N 412 VAL HG13 H N N 413 VAL HG21 H N N 414 VAL HG22 H N N 415 VAL HG23 H N N 416 VAL HXT H N N 417 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1JLP C4 S1 sing N N 1 A1JLP C4 C3 sing N N 2 A1JLP S1 C5 sing N N 3 A1JLP C3 N1 sing N N 4 A1JLP C6 C5 doub Y N 5 A1JLP C6 C7 sing Y N 6 A1JLP C1 C2 sing N N 7 A1JLP C5 C10 sing Y N 8 A1JLP N1 C2 sing N N 9 A1JLP N1 C11 sing N N 10 A1JLP C2 O1 doub N N 11 A1JLP C7 C8 doub Y N 12 A1JLP C10 C11 sing N N 13 A1JLP C10 C9 doub Y N 14 A1JLP C8 C9 sing Y N 15 A1JLP C4 H1 sing N N 16 A1JLP C4 H2 sing N N 17 A1JLP C6 H3 sing N N 18 A1JLP C11 H4 sing N N 19 A1JLP C11 H5 sing N N 20 A1JLP C7 H6 sing N N 21 A1JLP C8 H7 sing N N 22 A1JLP C9 H8 sing N N 23 A1JLP C3 H9 sing N N 24 A1JLP C3 H10 sing N N 25 A1JLP C1 H11 sing N N 26 A1JLP C1 H12 sing N N 27 A1JLP C1 H13 sing N N 28 ALA N CA sing N N 29 ALA N H sing N N 30 ALA N H2 sing N N 31 ALA CA C sing N N 32 ALA CA CB sing N N 33 ALA CA HA sing N N 34 ALA C O doub N N 35 ALA C OXT sing N N 36 ALA CB HB1 sing N N 37 ALA CB HB2 sing N N 38 ALA CB HB3 sing N N 39 ALA OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 HIS N CA sing N N 157 HIS N H sing N N 158 HIS N H2 sing N N 159 HIS CA C sing N N 160 HIS CA CB sing N N 161 HIS CA HA sing N N 162 HIS C O doub N N 163 HIS C OXT sing N N 164 HIS CB CG sing N N 165 HIS CB HB2 sing N N 166 HIS CB HB3 sing N N 167 HIS CG ND1 sing Y N 168 HIS CG CD2 doub Y N 169 HIS ND1 CE1 doub Y N 170 HIS ND1 HD1 sing N N 171 HIS CD2 NE2 sing Y N 172 HIS CD2 HD2 sing N N 173 HIS CE1 NE2 sing Y N 174 HIS CE1 HE1 sing N N 175 HIS NE2 HE2 sing N N 176 HIS OXT HXT sing N N 177 HOH O H1 sing N N 178 HOH O H2 sing N N 179 ILE N CA sing N N 180 ILE N H sing N N 181 ILE N H2 sing N N 182 ILE CA C sing N N 183 ILE CA CB sing N N 184 ILE CA HA sing N N 185 ILE C O doub N N 186 ILE C OXT sing N N 187 ILE CB CG1 sing N N 188 ILE CB CG2 sing N N 189 ILE CB HB sing N N 190 ILE CG1 CD1 sing N N 191 ILE CG1 HG12 sing N N 192 ILE CG1 HG13 sing N N 193 ILE CG2 HG21 sing N N 194 ILE CG2 HG22 sing N N 195 ILE CG2 HG23 sing N N 196 ILE CD1 HD11 sing N N 197 ILE CD1 HD12 sing N N 198 ILE CD1 HD13 sing N N 199 ILE OXT HXT sing N N 200 LEU N CA sing N N 201 LEU N H sing N N 202 LEU N H2 sing N N 203 LEU CA C sing N N 204 LEU CA CB sing N N 205 LEU CA HA sing N N 206 LEU C O doub N N 207 LEU C OXT sing N N 208 LEU CB CG sing N N 209 LEU CB HB2 sing N N 210 LEU CB HB3 sing N N 211 LEU CG CD1 sing N N 212 LEU CG CD2 sing N N 213 LEU CG HG sing N N 214 LEU CD1 HD11 sing N N 215 LEU CD1 HD12 sing N N 216 LEU CD1 HD13 sing N N 217 LEU CD2 HD21 sing N N 218 LEU CD2 HD22 sing N N 219 LEU CD2 HD23 sing N N 220 LEU OXT HXT sing N N 221 LYS N CA sing N N 222 LYS N H sing N N 223 LYS N H2 sing N N 224 LYS CA C sing N N 225 LYS CA CB sing N N 226 LYS CA HA sing N N 227 LYS C O doub N N 228 LYS C OXT sing N N 229 LYS CB CG sing N N 230 LYS CB HB2 sing N N 231 LYS CB HB3 sing N N 232 LYS CG CD sing N N 233 LYS CG HG2 sing N N 234 LYS CG HG3 sing N N 235 LYS CD CE sing N N 236 LYS CD HD2 sing N N 237 LYS CD HD3 sing N N 238 LYS CE NZ sing N N 239 LYS CE HE2 sing N N 240 LYS CE HE3 sing N N 241 LYS NZ HZ1 sing N N 242 LYS NZ HZ2 sing N N 243 LYS NZ HZ3 sing N N 244 LYS OXT HXT sing N N 245 MET N CA sing N N 246 MET N H sing N N 247 MET N H2 sing N N 248 MET CA C sing N N 249 MET CA CB sing N N 250 MET CA HA sing N N 251 MET C O doub N N 252 MET C OXT sing N N 253 MET CB CG sing N N 254 MET CB HB2 sing N N 255 MET CB HB3 sing N N 256 MET CG SD sing N N 257 MET CG HG2 sing N N 258 MET CG HG3 sing N N 259 MET SD CE sing N N 260 MET CE HE1 sing N N 261 MET CE HE2 sing N N 262 MET CE HE3 sing N N 263 MET OXT HXT sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # _pdbx_audit_support.funding_organization 'Engineering and Physical Sciences Research Council' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9HRR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9S4H _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010149 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010149 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007770 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #