data_9SN0 # _entry.id 9SN0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9SN0 pdb_00009sn0 10.2210/pdb9sn0/pdb WWPDB D_1292149717 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9SN0 _pdbx_database_status.recvd_initial_deposition_date 2025-09-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email ruth.herbst@meduniwien.ac.at _pdbx_contact_author.name_first Ruth _pdbx_contact_author.name_last Herbst _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7764-5363 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Proemer, J.J.' 1 0000-0002-3357-0128 'Murphy, J.W.' 2 0000-0002-3046-6034 'Lemmon, M.A.' 3 0000-0002-3379-5319 'Tsutsui, Y.' 4 0000-0002-3286-3295 'Herbst, R.' 5 0000-0002-7764-5363 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 483 _citation.language ? _citation.page_first 1221 _citation.page_last 1235 _citation.title 'An S752D activation loop mutation dynamically primes Muscle-Specific Kinase for activation.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20260159 _citation.pdbx_database_id_PubMed 42240394 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Promer, J.J.' 1 0000-0002-3357-0128 primary 'Murphy, J.W.' 2 0000-0002-3046-6034 primary 'Lemmon, M.A.' 3 0000-0002-3379-5319 primary 'Tsutsui, Y.' 4 0000-0002-3286-3295 primary 'Herbst, R.' 5 0000-0002-7764-5363 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Muscle, skeletal receptor tyrosine-protein kinase' 39930.918 1 2.7.10.1 ? ? 'C-terminal fragment of MuSK encoding juxtamembrane region and tyrosine kinase domain' 2 non-polymer syn 'THIOCYANATE ION' 58.082 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 2 ? ? ? ? 4 water nat water 18.015 125 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Muscle-specific tyrosine-protein kinase receptor,MuSK,Muscle-specific kinase receptor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKKGHHHHHHGESAAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLL PYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSL SHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKA NENDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLC WSKLPADRPSFTSIHRILERMCERAEGTVSV ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKGHHHHHHGESAAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLL PYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSL SHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKA NENDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLC WSKLPADRPSFTSIHRILERMCERAEGTVSV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'THIOCYANATE ION' SCN 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 GLY n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 GLU n 1 13 SER n 1 14 ALA n 1 15 ALA n 1 16 VAL n 1 17 THR n 1 18 LEU n 1 19 THR n 1 20 THR n 1 21 LEU n 1 22 PRO n 1 23 SER n 1 24 GLU n 1 25 LEU n 1 26 LEU n 1 27 LEU n 1 28 ASP n 1 29 ARG n 1 30 LEU n 1 31 HIS n 1 32 PRO n 1 33 ASN n 1 34 PRO n 1 35 MET n 1 36 TYR n 1 37 GLN n 1 38 ARG n 1 39 MET n 1 40 PRO n 1 41 LEU n 1 42 LEU n 1 43 LEU n 1 44 ASN n 1 45 PRO n 1 46 LYS n 1 47 LEU n 1 48 LEU n 1 49 SER n 1 50 LEU n 1 51 GLU n 1 52 TYR n 1 53 PRO n 1 54 ARG n 1 55 ASN n 1 56 ASN n 1 57 ILE n 1 58 GLU n 1 59 TYR n 1 60 VAL n 1 61 ARG n 1 62 ASP n 1 63 ILE n 1 64 GLY n 1 65 GLU n 1 66 GLY n 1 67 ALA n 1 68 PHE n 1 69 GLY n 1 70 ARG n 1 71 VAL n 1 72 PHE n 1 73 GLN n 1 74 ALA n 1 75 ARG n 1 76 ALA n 1 77 PRO n 1 78 GLY n 1 79 LEU n 1 80 LEU n 1 81 PRO n 1 82 TYR n 1 83 GLU n 1 84 PRO n 1 85 PHE n 1 86 THR n 1 87 MET n 1 88 VAL n 1 89 ALA n 1 90 VAL n 1 91 LYS n 1 92 MET n 1 93 LEU n 1 94 LYS n 1 95 GLU n 1 96 GLU n 1 97 ALA n 1 98 SER n 1 99 ALA n 1 100 ASP n 1 101 MET n 1 102 GLN n 1 103 ALA n 1 104 ASP n 1 105 PHE n 1 106 GLN n 1 107 ARG n 1 108 GLU n 1 109 ALA n 1 110 ALA n 1 111 LEU n 1 112 MET n 1 113 ALA n 1 114 GLU n 1 115 PHE n 1 116 ASP n 1 117 ASN n 1 118 PRO n 1 119 ASN n 1 120 ILE n 1 121 VAL n 1 122 LYS n 1 123 LEU n 1 124 LEU n 1 125 GLY n 1 126 VAL n 1 127 CYS n 1 128 ALA n 1 129 VAL n 1 130 GLY n 1 131 LYS n 1 132 PRO n 1 133 MET n 1 134 CYS n 1 135 LEU n 1 136 LEU n 1 137 PHE n 1 138 GLU n 1 139 TYR n 1 140 MET n 1 141 ALA n 1 142 TYR n 1 143 GLY n 1 144 ASP n 1 145 LEU n 1 146 ASN n 1 147 GLU n 1 148 PHE n 1 149 LEU n 1 150 ARG n 1 151 SER n 1 152 MET n 1 153 SER n 1 154 PRO n 1 155 HIS n 1 156 THR n 1 157 VAL n 1 158 CYS n 1 159 SER n 1 160 LEU n 1 161 SER n 1 162 HIS n 1 163 SER n 1 164 ASP n 1 165 LEU n 1 166 SER n 1 167 MET n 1 168 ARG n 1 169 ALA n 1 170 GLN n 1 171 VAL n 1 172 SER n 1 173 SER n 1 174 PRO n 1 175 GLY n 1 176 PRO n 1 177 PRO n 1 178 PRO n 1 179 LEU n 1 180 SER n 1 181 CYS n 1 182 ALA n 1 183 GLU n 1 184 GLN n 1 185 LEU n 1 186 CYS n 1 187 ILE n 1 188 ALA n 1 189 ARG n 1 190 GLN n 1 191 VAL n 1 192 ALA n 1 193 ALA n 1 194 GLY n 1 195 MET n 1 196 ALA n 1 197 TYR n 1 198 LEU n 1 199 SER n 1 200 GLU n 1 201 ARG n 1 202 LYS n 1 203 PHE n 1 204 VAL n 1 205 HIS n 1 206 ARG n 1 207 ASP n 1 208 LEU n 1 209 ALA n 1 210 THR n 1 211 ARG n 1 212 ASN n 1 213 CYS n 1 214 LEU n 1 215 VAL n 1 216 GLY n 1 217 GLU n 1 218 ASN n 1 219 MET n 1 220 VAL n 1 221 VAL n 1 222 LYS n 1 223 ILE n 1 224 ALA n 1 225 ASP n 1 226 PHE n 1 227 GLY n 1 228 LEU n 1 229 SER n 1 230 ARG n 1 231 ASN n 1 232 ILE n 1 233 TYR n 1 234 SER n 1 235 ALA n 1 236 ASP n 1 237 TYR n 1 238 TYR n 1 239 LYS n 1 240 ALA n 1 241 ASN n 1 242 GLU n 1 243 ASN n 1 244 ASP n 1 245 ALA n 1 246 ILE n 1 247 PRO n 1 248 ILE n 1 249 ARG n 1 250 TRP n 1 251 MET n 1 252 PRO n 1 253 PRO n 1 254 GLU n 1 255 SER n 1 256 ILE n 1 257 PHE n 1 258 TYR n 1 259 ASN n 1 260 ARG n 1 261 TYR n 1 262 THR n 1 263 THR n 1 264 GLU n 1 265 SER n 1 266 ASP n 1 267 VAL n 1 268 TRP n 1 269 ALA n 1 270 TYR n 1 271 GLY n 1 272 VAL n 1 273 VAL n 1 274 LEU n 1 275 TRP n 1 276 GLU n 1 277 ILE n 1 278 PHE n 1 279 SER n 1 280 TYR n 1 281 GLY n 1 282 LEU n 1 283 GLN n 1 284 PRO n 1 285 TYR n 1 286 TYR n 1 287 GLY n 1 288 MET n 1 289 ALA n 1 290 HIS n 1 291 GLU n 1 292 GLU n 1 293 VAL n 1 294 ILE n 1 295 TYR n 1 296 TYR n 1 297 VAL n 1 298 ARG n 1 299 ASP n 1 300 GLY n 1 301 ASN n 1 302 ILE n 1 303 LEU n 1 304 SER n 1 305 CYS n 1 306 PRO n 1 307 GLU n 1 308 ASN n 1 309 CYS n 1 310 PRO n 1 311 VAL n 1 312 GLU n 1 313 LEU n 1 314 TYR n 1 315 ASN n 1 316 LEU n 1 317 MET n 1 318 ARG n 1 319 LEU n 1 320 CYS n 1 321 TRP n 1 322 SER n 1 323 LYS n 1 324 LEU n 1 325 PRO n 1 326 ALA n 1 327 ASP n 1 328 ARG n 1 329 PRO n 1 330 SER n 1 331 PHE n 1 332 THR n 1 333 SER n 1 334 ILE n 1 335 HIS n 1 336 ARG n 1 337 ILE n 1 338 LEU n 1 339 GLU n 1 340 ARG n 1 341 MET n 1 342 CYS n 1 343 GLU n 1 344 ARG n 1 345 ALA n 1 346 GLU n 1 347 GLY n 1 348 THR n 1 349 VAL n 1 350 SER n 1 351 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 351 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MUSK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue muscle _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc CRL-1711 _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculorivirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'His tagged human MuSK Tyrosine kinase domain' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pFastBac1-His-MuSK-homo-wt-530-869 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SCN non-polymer . 'THIOCYANATE ION' ? 'C N S -1' 58.082 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 519 ? ? ? A . n A 1 2 LYS 2 520 ? ? ? A . n A 1 3 LYS 3 521 ? ? ? A . n A 1 4 GLY 4 522 ? ? ? A . n A 1 5 HIS 5 523 ? ? ? A . n A 1 6 HIS 6 524 ? ? ? A . n A 1 7 HIS 7 525 ? ? ? A . n A 1 8 HIS 8 526 ? ? ? A . n A 1 9 HIS 9 527 ? ? ? A . n A 1 10 HIS 10 528 ? ? ? A . n A 1 11 GLY 11 529 ? ? ? A . n A 1 12 GLU 12 530 ? ? ? A . n A 1 13 SER 13 531 ? ? ? A . n A 1 14 ALA 14 532 ? ? ? A . n A 1 15 ALA 15 533 ? ? ? A . n A 1 16 VAL 16 534 ? ? ? A . n A 1 17 THR 17 535 ? ? ? A . n A 1 18 LEU 18 536 ? ? ? A . n A 1 19 THR 19 537 ? ? ? A . n A 1 20 THR 20 538 ? ? ? A . n A 1 21 LEU 21 539 ? ? ? A . n A 1 22 PRO 22 540 ? ? ? A . n A 1 23 SER 23 541 ? ? ? A . n A 1 24 GLU 24 542 ? ? ? A . n A 1 25 LEU 25 543 ? ? ? A . n A 1 26 LEU 26 544 ? ? ? A . n A 1 27 LEU 27 545 ? ? ? A . n A 1 28 ASP 28 546 ? ? ? A . n A 1 29 ARG 29 547 ? ? ? A . n A 1 30 LEU 30 548 ? ? ? A . n A 1 31 HIS 31 549 ? ? ? A . n A 1 32 PRO 32 550 ? ? ? A . n A 1 33 ASN 33 551 ? ? ? A . n A 1 34 PRO 34 552 ? ? ? A . n A 1 35 MET 35 553 ? ? ? A . n A 1 36 TYR 36 554 ? ? ? A . n A 1 37 GLN 37 555 ? ? ? A . n A 1 38 ARG 38 556 ? ? ? A . n A 1 39 MET 39 557 ? ? ? A . n A 1 40 PRO 40 558 ? ? ? A . n A 1 41 LEU 41 559 ? ? ? A . n A 1 42 LEU 42 560 560 LEU LEU A . n A 1 43 LEU 43 561 561 LEU LEU A . n A 1 44 ASN 44 562 562 ASN ASN A . n A 1 45 PRO 45 563 563 PRO PRO A . n A 1 46 LYS 46 564 564 LYS LYS A . n A 1 47 LEU 47 565 565 LEU LEU A . n A 1 48 LEU 48 566 566 LEU LEU A . n A 1 49 SER 49 567 567 SER SER A . n A 1 50 LEU 50 568 568 LEU LEU A . n A 1 51 GLU 51 569 569 GLU GLU A . n A 1 52 TYR 52 570 570 TYR TYR A . n A 1 53 PRO 53 571 571 PRO PRO A . n A 1 54 ARG 54 572 572 ARG ARG A . n A 1 55 ASN 55 573 573 ASN ASN A . n A 1 56 ASN 56 574 574 ASN ASN A . n A 1 57 ILE 57 575 575 ILE ILE A . n A 1 58 GLU 58 576 576 GLU GLU A . n A 1 59 TYR 59 577 577 TYR TYR A . n A 1 60 VAL 60 578 578 VAL VAL A . n A 1 61 ARG 61 579 579 ARG ARG A . n A 1 62 ASP 62 580 580 ASP ASP A . n A 1 63 ILE 63 581 581 ILE ILE A . n A 1 64 GLY 64 582 582 GLY GLY A . n A 1 65 GLU 65 583 583 GLU GLU A . n A 1 66 GLY 66 584 584 GLY GLY A . n A 1 67 ALA 67 585 585 ALA ALA A . n A 1 68 PHE 68 586 586 PHE PHE A . n A 1 69 GLY 69 587 587 GLY GLY A . n A 1 70 ARG 70 588 588 ARG ARG A . n A 1 71 VAL 71 589 589 VAL VAL A . n A 1 72 PHE 72 590 590 PHE PHE A . n A 1 73 GLN 73 591 591 GLN GLN A . n A 1 74 ALA 74 592 592 ALA ALA A . n A 1 75 ARG 75 593 593 ARG ARG A . n A 1 76 ALA 76 594 594 ALA ALA A . n A 1 77 PRO 77 595 595 PRO PRO A . n A 1 78 GLY 78 596 596 GLY GLY A . n A 1 79 LEU 79 597 597 LEU LEU A . n A 1 80 LEU 80 598 598 LEU LEU A . n A 1 81 PRO 81 599 599 PRO PRO A . n A 1 82 TYR 82 600 600 TYR TYR A . n A 1 83 GLU 83 601 601 GLU GLU A . n A 1 84 PRO 84 602 602 PRO PRO A . n A 1 85 PHE 85 603 603 PHE PHE A . n A 1 86 THR 86 604 604 THR THR A . n A 1 87 MET 87 605 605 MET MET A . n A 1 88 VAL 88 606 606 VAL VAL A . n A 1 89 ALA 89 607 607 ALA ALA A . n A 1 90 VAL 90 608 608 VAL VAL A . n A 1 91 LYS 91 609 609 LYS LYS A . n A 1 92 MET 92 610 610 MET MET A . n A 1 93 LEU 93 611 611 LEU LEU A . n A 1 94 LYS 94 612 612 LYS LYS A . n A 1 95 GLU 95 613 613 GLU GLU A . n A 1 96 GLU 96 614 614 GLU GLU A . n A 1 97 ALA 97 615 615 ALA ALA A . n A 1 98 SER 98 616 616 SER SER A . n A 1 99 ALA 99 617 617 ALA ALA A . n A 1 100 ASP 100 618 618 ASP ASP A . n A 1 101 MET 101 619 619 MET MET A . n A 1 102 GLN 102 620 620 GLN GLN A . n A 1 103 ALA 103 621 621 ALA ALA A . n A 1 104 ASP 104 622 622 ASP ASP A . n A 1 105 PHE 105 623 623 PHE PHE A . n A 1 106 GLN 106 624 624 GLN GLN A . n A 1 107 ARG 107 625 625 ARG ARG A . n A 1 108 GLU 108 626 626 GLU GLU A . n A 1 109 ALA 109 627 627 ALA ALA A . n A 1 110 ALA 110 628 628 ALA ALA A . n A 1 111 LEU 111 629 629 LEU LEU A . n A 1 112 MET 112 630 630 MET MET A . n A 1 113 ALA 113 631 631 ALA ALA A . n A 1 114 GLU 114 632 632 GLU GLU A . n A 1 115 PHE 115 633 633 PHE PHE A . n A 1 116 ASP 116 634 634 ASP ASP A . n A 1 117 ASN 117 635 635 ASN ASN A . n A 1 118 PRO 118 636 636 PRO PRO A . n A 1 119 ASN 119 637 637 ASN ASN A . n A 1 120 ILE 120 638 638 ILE ILE A . n A 1 121 VAL 121 639 639 VAL VAL A . n A 1 122 LYS 122 640 640 LYS LYS A . n A 1 123 LEU 123 641 641 LEU LEU A . n A 1 124 LEU 124 642 642 LEU LEU A . n A 1 125 GLY 125 643 643 GLY GLY A . n A 1 126 VAL 126 644 644 VAL VAL A . n A 1 127 CYS 127 645 645 CYS CYS A . n A 1 128 ALA 128 646 646 ALA ALA A . n A 1 129 VAL 129 647 647 VAL VAL A . n A 1 130 GLY 130 648 648 GLY GLY A . n A 1 131 LYS 131 649 649 LYS LYS A . n A 1 132 PRO 132 650 650 PRO PRO A . n A 1 133 MET 133 651 651 MET MET A . n A 1 134 CYS 134 652 652 CYS CYS A . n A 1 135 LEU 135 653 653 LEU LEU A . n A 1 136 LEU 136 654 654 LEU LEU A . n A 1 137 PHE 137 655 655 PHE PHE A . n A 1 138 GLU 138 656 656 GLU GLU A . n A 1 139 TYR 139 657 657 TYR TYR A . n A 1 140 MET 140 658 658 MET MET A . n A 1 141 ALA 141 659 659 ALA ALA A . n A 1 142 TYR 142 660 660 TYR TYR A . n A 1 143 GLY 143 661 661 GLY GLY A . n A 1 144 ASP 144 662 662 ASP ASP A . n A 1 145 LEU 145 663 663 LEU LEU A . n A 1 146 ASN 146 664 664 ASN ASN A . n A 1 147 GLU 147 665 665 GLU GLU A . n A 1 148 PHE 148 666 666 PHE PHE A . n A 1 149 LEU 149 667 667 LEU LEU A . n A 1 150 ARG 150 668 668 ARG ARG A . n A 1 151 SER 151 669 669 SER SER A . n A 1 152 MET 152 670 670 MET MET A . n A 1 153 SER 153 671 671 SER SER A . n A 1 154 PRO 154 672 672 PRO PRO A . n A 1 155 HIS 155 673 ? ? ? A . n A 1 156 THR 156 674 ? ? ? A . n A 1 157 VAL 157 675 ? ? ? A . n A 1 158 CYS 158 676 ? ? ? A . n A 1 159 SER 159 677 ? ? ? A . n A 1 160 LEU 160 678 ? ? ? A . n A 1 161 SER 161 679 ? ? ? A . n A 1 162 HIS 162 680 ? ? ? A . n A 1 163 SER 163 681 ? ? ? A . n A 1 164 ASP 164 682 ? ? ? A . n A 1 165 LEU 165 683 ? ? ? A . n A 1 166 SER 166 684 ? ? ? A . n A 1 167 MET 167 685 ? ? ? A . n A 1 168 ARG 168 686 ? ? ? A . n A 1 169 ALA 169 687 ? ? ? A . n A 1 170 GLN 170 688 ? ? ? A . n A 1 171 VAL 171 689 ? ? ? A . n A 1 172 SER 172 690 ? ? ? A . n A 1 173 SER 173 691 ? ? ? A . n A 1 174 PRO 174 692 ? ? ? A . n A 1 175 GLY 175 693 ? ? ? A . n A 1 176 PRO 176 694 ? ? ? A . n A 1 177 PRO 177 695 ? ? ? A . n A 1 178 PRO 178 696 696 PRO PRO A . n A 1 179 LEU 179 697 697 LEU LEU A . n A 1 180 SER 180 698 698 SER SER A . n A 1 181 CYS 181 699 699 CYS CYS A . n A 1 182 ALA 182 700 700 ALA ALA A . n A 1 183 GLU 183 701 701 GLU GLU A . n A 1 184 GLN 184 702 702 GLN GLN A . n A 1 185 LEU 185 703 703 LEU LEU A . n A 1 186 CYS 186 704 704 CYS CYS A . n A 1 187 ILE 187 705 705 ILE ILE A . n A 1 188 ALA 188 706 706 ALA ALA A . n A 1 189 ARG 189 707 707 ARG ARG A . n A 1 190 GLN 190 708 708 GLN GLN A . n A 1 191 VAL 191 709 709 VAL VAL A . n A 1 192 ALA 192 710 710 ALA ALA A . n A 1 193 ALA 193 711 711 ALA ALA A . n A 1 194 GLY 194 712 712 GLY GLY A . n A 1 195 MET 195 713 713 MET MET A . n A 1 196 ALA 196 714 714 ALA ALA A . n A 1 197 TYR 197 715 715 TYR TYR A . n A 1 198 LEU 198 716 716 LEU LEU A . n A 1 199 SER 199 717 717 SER SER A . n A 1 200 GLU 200 718 718 GLU GLU A . n A 1 201 ARG 201 719 719 ARG ARG A . n A 1 202 LYS 202 720 720 LYS LYS A . n A 1 203 PHE 203 721 721 PHE PHE A . n A 1 204 VAL 204 722 722 VAL VAL A . n A 1 205 HIS 205 723 723 HIS HIS A . n A 1 206 ARG 206 724 724 ARG ARG A . n A 1 207 ASP 207 725 725 ASP ASP A . n A 1 208 LEU 208 726 726 LEU LEU A . n A 1 209 ALA 209 727 727 ALA ALA A . n A 1 210 THR 210 728 728 THR THR A . n A 1 211 ARG 211 729 729 ARG ARG A . n A 1 212 ASN 212 730 730 ASN ASN A . n A 1 213 CYS 213 731 731 CYS CYS A . n A 1 214 LEU 214 732 732 LEU LEU A . n A 1 215 VAL 215 733 733 VAL VAL A . n A 1 216 GLY 216 734 734 GLY GLY A . n A 1 217 GLU 217 735 735 GLU GLU A . n A 1 218 ASN 218 736 736 ASN ASN A . n A 1 219 MET 219 737 737 MET MET A . n A 1 220 VAL 220 738 738 VAL VAL A . n A 1 221 VAL 221 739 739 VAL VAL A . n A 1 222 LYS 222 740 740 LYS LYS A . n A 1 223 ILE 223 741 741 ILE ILE A . n A 1 224 ALA 224 742 742 ALA ALA A . n A 1 225 ASP 225 743 743 ASP ASP A . n A 1 226 PHE 226 744 744 PHE PHE A . n A 1 227 GLY 227 745 745 GLY GLY A . n A 1 228 LEU 228 746 746 LEU LEU A . n A 1 229 SER 229 747 747 SER SER A . n A 1 230 ARG 230 748 748 ARG ARG A . n A 1 231 ASN 231 749 749 ASN ASN A . n A 1 232 ILE 232 750 750 ILE ILE A . n A 1 233 TYR 233 751 751 TYR TYR A . n A 1 234 SER 234 752 752 SER SER A . n A 1 235 ALA 235 753 753 ALA ALA A . n A 1 236 ASP 236 754 754 ASP ASP A . n A 1 237 TYR 237 755 755 TYR TYR A . n A 1 238 TYR 238 756 756 TYR TYR A . n A 1 239 LYS 239 757 757 LYS LYS A . n A 1 240 ALA 240 758 758 ALA ALA A . n A 1 241 ASN 241 759 759 ASN ASN A . n A 1 242 GLU 242 760 760 GLU GLU A . n A 1 243 ASN 243 761 761 ASN ASN A . n A 1 244 ASP 244 762 762 ASP ASP A . n A 1 245 ALA 245 763 763 ALA ALA A . n A 1 246 ILE 246 764 764 ILE ILE A . n A 1 247 PRO 247 765 765 PRO PRO A . n A 1 248 ILE 248 766 766 ILE ILE A . n A 1 249 ARG 249 767 767 ARG ARG A . n A 1 250 TRP 250 768 768 TRP TRP A . n A 1 251 MET 251 769 769 MET MET A . n A 1 252 PRO 252 770 770 PRO PRO A . n A 1 253 PRO 253 771 771 PRO PRO A . n A 1 254 GLU 254 772 772 GLU GLU A . n A 1 255 SER 255 773 773 SER SER A . n A 1 256 ILE 256 774 774 ILE ILE A . n A 1 257 PHE 257 775 775 PHE PHE A . n A 1 258 TYR 258 776 776 TYR TYR A . n A 1 259 ASN 259 777 777 ASN ASN A . n A 1 260 ARG 260 778 778 ARG ARG A . n A 1 261 TYR 261 779 779 TYR TYR A . n A 1 262 THR 262 780 780 THR THR A . n A 1 263 THR 263 781 781 THR THR A . n A 1 264 GLU 264 782 782 GLU GLU A . n A 1 265 SER 265 783 783 SER SER A . n A 1 266 ASP 266 784 784 ASP ASP A . n A 1 267 VAL 267 785 785 VAL VAL A . n A 1 268 TRP 268 786 786 TRP TRP A . n A 1 269 ALA 269 787 787 ALA ALA A . n A 1 270 TYR 270 788 788 TYR TYR A . n A 1 271 GLY 271 789 789 GLY GLY A . n A 1 272 VAL 272 790 790 VAL VAL A . n A 1 273 VAL 273 791 791 VAL VAL A . n A 1 274 LEU 274 792 792 LEU LEU A . n A 1 275 TRP 275 793 793 TRP TRP A . n A 1 276 GLU 276 794 794 GLU GLU A . n A 1 277 ILE 277 795 795 ILE ILE A . n A 1 278 PHE 278 796 796 PHE PHE A . n A 1 279 SER 279 797 797 SER SER A . n A 1 280 TYR 280 798 798 TYR TYR A . n A 1 281 GLY 281 799 799 GLY GLY A . n A 1 282 LEU 282 800 800 LEU LEU A . n A 1 283 GLN 283 801 801 GLN GLN A . n A 1 284 PRO 284 802 802 PRO PRO A . n A 1 285 TYR 285 803 803 TYR TYR A . n A 1 286 TYR 286 804 804 TYR TYR A . n A 1 287 GLY 287 805 805 GLY GLY A . n A 1 288 MET 288 806 806 MET MET A . n A 1 289 ALA 289 807 807 ALA ALA A . n A 1 290 HIS 290 808 808 HIS HIS A . n A 1 291 GLU 291 809 809 GLU GLU A . n A 1 292 GLU 292 810 810 GLU GLU A . n A 1 293 VAL 293 811 811 VAL VAL A . n A 1 294 ILE 294 812 812 ILE ILE A . n A 1 295 TYR 295 813 813 TYR TYR A . n A 1 296 TYR 296 814 814 TYR TYR A . n A 1 297 VAL 297 815 815 VAL VAL A . n A 1 298 ARG 298 816 816 ARG ARG A . n A 1 299 ASP 299 817 817 ASP ASP A . n A 1 300 GLY 300 818 818 GLY GLY A . n A 1 301 ASN 301 819 819 ASN ASN A . n A 1 302 ILE 302 820 820 ILE ILE A . n A 1 303 LEU 303 821 821 LEU LEU A . n A 1 304 SER 304 822 822 SER SER A . n A 1 305 CYS 305 823 823 CYS CYS A . n A 1 306 PRO 306 824 824 PRO PRO A . n A 1 307 GLU 307 825 825 GLU GLU A . n A 1 308 ASN 308 826 826 ASN ASN A . n A 1 309 CYS 309 827 827 CYS CYS A . n A 1 310 PRO 310 828 828 PRO PRO A . n A 1 311 VAL 311 829 829 VAL VAL A . n A 1 312 GLU 312 830 830 GLU GLU A . n A 1 313 LEU 313 831 831 LEU LEU A . n A 1 314 TYR 314 832 832 TYR TYR A . n A 1 315 ASN 315 833 833 ASN ASN A . n A 1 316 LEU 316 834 834 LEU LEU A . n A 1 317 MET 317 835 835 MET MET A . n A 1 318 ARG 318 836 836 ARG ARG A . n A 1 319 LEU 319 837 837 LEU LEU A . n A 1 320 CYS 320 838 838 CYS CYS A . n A 1 321 TRP 321 839 839 TRP TRP A . n A 1 322 SER 322 840 840 SER SER A . n A 1 323 LYS 323 841 841 LYS LYS A . n A 1 324 LEU 324 842 842 LEU LEU A . n A 1 325 PRO 325 843 843 PRO PRO A . n A 1 326 ALA 326 844 844 ALA ALA A . n A 1 327 ASP 327 845 845 ASP ASP A . n A 1 328 ARG 328 846 846 ARG ARG A . n A 1 329 PRO 329 847 847 PRO PRO A . n A 1 330 SER 330 848 848 SER SER A . n A 1 331 PHE 331 849 849 PHE PHE A . n A 1 332 THR 332 850 850 THR THR A . n A 1 333 SER 333 851 851 SER SER A . n A 1 334 ILE 334 852 852 ILE ILE A . n A 1 335 HIS 335 853 853 HIS HIS A . n A 1 336 ARG 336 854 854 ARG ARG A . n A 1 337 ILE 337 855 855 ILE ILE A . n A 1 338 LEU 338 856 856 LEU LEU A . n A 1 339 GLU 339 857 857 GLU GLU A . n A 1 340 ARG 340 858 858 ARG ARG A . n A 1 341 MET 341 859 859 MET MET A . n A 1 342 CYS 342 860 860 CYS CYS A . n A 1 343 GLU 343 861 861 GLU GLU A . n A 1 344 ARG 344 862 862 ARG ARG A . n A 1 345 ALA 345 863 863 ALA ALA A . n A 1 346 GLU 346 864 ? ? ? A . n A 1 347 GLY 347 865 ? ? ? A . n A 1 348 THR 348 866 ? ? ? A . n A 1 349 VAL 349 867 ? ? ? A . n A 1 350 SER 350 868 ? ? ? A . n A 1 351 VAL 351 869 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SCN 1 901 864 SCN SCN A . C 3 NA 1 902 865 NA NA A . D 3 NA 1 903 866 NA NA A . E 4 HOH 1 1001 908 HOH HOH A . E 4 HOH 2 1002 931 HOH HOH A . E 4 HOH 3 1003 939 HOH HOH A . E 4 HOH 4 1004 990 HOH HOH A . E 4 HOH 5 1005 991 HOH HOH A . E 4 HOH 6 1006 980 HOH HOH A . E 4 HOH 7 1007 894 HOH HOH A . E 4 HOH 8 1008 901 HOH HOH A . E 4 HOH 9 1009 912 HOH HOH A . E 4 HOH 10 1010 987 HOH HOH A . E 4 HOH 11 1011 923 HOH HOH A . E 4 HOH 12 1012 955 HOH HOH A . E 4 HOH 13 1013 928 HOH HOH A . E 4 HOH 14 1014 877 HOH HOH A . E 4 HOH 15 1015 871 HOH HOH A . E 4 HOH 16 1016 899 HOH HOH A . E 4 HOH 17 1017 977 HOH HOH A . E 4 HOH 18 1018 924 HOH HOH A . E 4 HOH 19 1019 875 HOH HOH A . E 4 HOH 20 1020 889 HOH HOH A . E 4 HOH 21 1021 927 HOH HOH A . E 4 HOH 22 1022 967 HOH HOH A . E 4 HOH 23 1023 929 HOH HOH A . E 4 HOH 24 1024 876 HOH HOH A . E 4 HOH 25 1025 882 HOH HOH A . E 4 HOH 26 1026 870 HOH HOH A . E 4 HOH 27 1027 943 HOH HOH A . E 4 HOH 28 1028 916 HOH HOH A . E 4 HOH 29 1029 895 HOH HOH A . E 4 HOH 30 1030 918 HOH HOH A . E 4 HOH 31 1031 874 HOH HOH A . E 4 HOH 32 1032 892 HOH HOH A . E 4 HOH 33 1033 952 HOH HOH A . E 4 HOH 34 1034 945 HOH HOH A . E 4 HOH 35 1035 867 HOH HOH A . E 4 HOH 36 1036 905 HOH HOH A . E 4 HOH 37 1037 910 HOH HOH A . E 4 HOH 38 1038 880 HOH HOH A . E 4 HOH 39 1039 946 HOH HOH A . E 4 HOH 40 1040 922 HOH HOH A . E 4 HOH 41 1041 897 HOH HOH A . E 4 HOH 42 1042 890 HOH HOH A . E 4 HOH 43 1043 869 HOH HOH A . E 4 HOH 44 1044 879 HOH HOH A . E 4 HOH 45 1045 949 HOH HOH A . E 4 HOH 46 1046 900 HOH HOH A . E 4 HOH 47 1047 915 HOH HOH A . E 4 HOH 48 1048 872 HOH HOH A . E 4 HOH 49 1049 903 HOH HOH A . E 4 HOH 50 1050 962 HOH HOH A . E 4 HOH 51 1051 885 HOH HOH A . E 4 HOH 52 1052 961 HOH HOH A . E 4 HOH 53 1053 898 HOH HOH A . E 4 HOH 54 1054 883 HOH HOH A . E 4 HOH 55 1055 934 HOH HOH A . E 4 HOH 56 1056 937 HOH HOH A . E 4 HOH 57 1057 936 HOH HOH A . E 4 HOH 58 1058 986 HOH HOH A . E 4 HOH 59 1059 925 HOH HOH A . E 4 HOH 60 1060 984 HOH HOH A . E 4 HOH 61 1061 868 HOH HOH A . E 4 HOH 62 1062 891 HOH HOH A . E 4 HOH 63 1063 917 HOH HOH A . E 4 HOH 64 1064 884 HOH HOH A . E 4 HOH 65 1065 888 HOH HOH A . E 4 HOH 66 1066 911 HOH HOH A . E 4 HOH 67 1067 935 HOH HOH A . E 4 HOH 68 1068 878 HOH HOH A . E 4 HOH 69 1069 954 HOH HOH A . E 4 HOH 70 1070 982 HOH HOH A . E 4 HOH 71 1071 904 HOH HOH A . E 4 HOH 72 1072 881 HOH HOH A . E 4 HOH 73 1073 920 HOH HOH A . E 4 HOH 74 1074 964 HOH HOH A . E 4 HOH 75 1075 950 HOH HOH A . E 4 HOH 76 1076 944 HOH HOH A . E 4 HOH 77 1077 951 HOH HOH A . E 4 HOH 78 1078 966 HOH HOH A . E 4 HOH 79 1079 887 HOH HOH A . E 4 HOH 80 1080 926 HOH HOH A . E 4 HOH 81 1081 965 HOH HOH A . E 4 HOH 82 1082 906 HOH HOH A . E 4 HOH 83 1083 975 HOH HOH A . E 4 HOH 84 1084 921 HOH HOH A . E 4 HOH 85 1085 971 HOH HOH A . E 4 HOH 86 1086 983 HOH HOH A . E 4 HOH 87 1087 907 HOH HOH A . E 4 HOH 88 1088 963 HOH HOH A . E 4 HOH 89 1089 886 HOH HOH A . E 4 HOH 90 1090 919 HOH HOH A . E 4 HOH 91 1091 940 HOH HOH A . E 4 HOH 92 1092 981 HOH HOH A . E 4 HOH 93 1093 893 HOH HOH A . E 4 HOH 94 1094 941 HOH HOH A . E 4 HOH 95 1095 958 HOH HOH A . E 4 HOH 96 1096 948 HOH HOH A . E 4 HOH 97 1097 902 HOH HOH A . E 4 HOH 98 1098 956 HOH HOH A . E 4 HOH 99 1099 914 HOH HOH A . E 4 HOH 100 1100 978 HOH HOH A . E 4 HOH 101 1101 959 HOH HOH A . E 4 HOH 102 1102 942 HOH HOH A . E 4 HOH 103 1103 972 HOH HOH A . E 4 HOH 104 1104 989 HOH HOH A . E 4 HOH 105 1105 953 HOH HOH A . E 4 HOH 106 1106 968 HOH HOH A . E 4 HOH 107 1107 938 HOH HOH A . E 4 HOH 108 1108 960 HOH HOH A . E 4 HOH 109 1109 988 HOH HOH A . E 4 HOH 110 1110 973 HOH HOH A . E 4 HOH 111 1111 969 HOH HOH A . E 4 HOH 112 1112 974 HOH HOH A . E 4 HOH 113 1113 985 HOH HOH A . E 4 HOH 114 1114 930 HOH HOH A . E 4 HOH 115 1115 976 HOH HOH A . E 4 HOH 116 1116 932 HOH HOH A . E 4 HOH 117 1117 970 HOH HOH A . E 4 HOH 118 1118 933 HOH HOH A . E 4 HOH 119 1119 909 HOH HOH A . E 4 HOH 120 1120 913 HOH HOH A . E 4 HOH 121 1121 957 HOH HOH A . E 4 HOH 122 1122 873 HOH HOH A . E 4 HOH 123 1123 979 HOH HOH A . E 4 HOH 124 1124 896 HOH HOH A . E 4 HOH 125 1125 947 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 718 ? CG ? A GLU 200 CG 2 1 Y 1 A GLU 718 ? CD ? A GLU 200 CD 3 1 Y 1 A GLU 718 ? OE1 ? A GLU 200 OE1 4 1 Y 1 A GLU 718 ? OE2 ? A GLU 200 OE2 5 1 Y 1 A LYS 757 ? CG ? A LYS 239 CG 6 1 Y 1 A LYS 757 ? CD ? A LYS 239 CD 7 1 Y 1 A LYS 757 ? CE ? A LYS 239 CE 8 1 Y 1 A LYS 757 ? NZ ? A LYS 239 NZ 9 1 Y 1 A GLU 760 ? CG ? A GLU 242 CG 10 1 Y 1 A GLU 760 ? CD ? A GLU 242 CD 11 1 Y 1 A GLU 760 ? OE1 ? A GLU 242 OE1 12 1 Y 1 A GLU 760 ? OE2 ? A GLU 242 OE2 13 1 Y 1 A ASN 761 ? CG ? A ASN 243 CG 14 1 Y 1 A ASN 761 ? OD1 ? A ASN 243 OD1 15 1 Y 1 A ASN 761 ? ND2 ? A ASN 243 ND2 16 1 Y 1 A ASP 762 ? CG ? A ASP 244 CG 17 1 Y 1 A ASP 762 ? OD1 ? A ASP 244 OD1 18 1 Y 1 A ASP 762 ? OD2 ? A ASP 244 OD2 19 1 Y 1 A TYR 804 ? CG ? A TYR 286 CG 20 1 Y 1 A TYR 804 ? CD1 ? A TYR 286 CD1 21 1 Y 1 A TYR 804 ? CD2 ? A TYR 286 CD2 22 1 Y 1 A TYR 804 ? CE1 ? A TYR 286 CE1 23 1 Y 1 A TYR 804 ? CE2 ? A TYR 286 CE2 24 1 Y 1 A TYR 804 ? CZ ? A TYR 286 CZ 25 1 Y 1 A TYR 804 ? OH ? A TYR 286 OH 26 1 Y 1 A GLU 825 ? CG ? A GLU 307 CG 27 1 Y 1 A GLU 825 ? CD ? A GLU 307 CD 28 1 Y 1 A GLU 825 ? OE1 ? A GLU 307 OE1 29 1 Y 1 A GLU 825 ? OE2 ? A GLU 307 OE2 30 1 Y 1 A ARG 854 ? CG ? A ARG 336 CG 31 1 Y 1 A ARG 854 ? CD ? A ARG 336 CD 32 1 Y 1 A ARG 854 ? NE ? A ARG 336 NE 33 1 Y 1 A ARG 854 ? CZ ? A ARG 336 CZ 34 1 Y 1 A ARG 854 ? NH1 ? A ARG 336 NH1 35 1 Y 1 A ARG 854 ? NH2 ? A ARG 336 NH2 36 1 Y 1 A ARG 858 ? CG ? A ARG 340 CG 37 1 Y 1 A ARG 858 ? CD ? A ARG 340 CD 38 1 Y 1 A ARG 858 ? NE ? A ARG 340 NE 39 1 Y 1 A ARG 858 ? CZ ? A ARG 340 CZ 40 1 Y 1 A ARG 858 ? NH1 ? A ARG 340 NH1 41 1 Y 1 A ARG 858 ? NH2 ? A ARG 340 NH2 42 1 Y 1 A GLU 861 ? CG ? A GLU 343 CG 43 1 Y 1 A GLU 861 ? CD ? A GLU 343 CD 44 1 Y 1 A GLU 861 ? OE1 ? A GLU 343 OE1 45 1 Y 1 A GLU 861 ? OE2 ? A GLU 343 OE2 46 1 Y 1 A ARG 862 ? CG ? A ARG 344 CG 47 1 Y 1 A ARG 862 ? CD ? A ARG 344 CD 48 1 Y 1 A ARG 862 ? NE ? A ARG 344 NE 49 1 Y 1 A ARG 862 ? CZ ? A ARG 344 CZ 50 1 Y 1 A ARG 862 ? NH1 ? A ARG 344 NH1 51 1 Y 1 A ARG 862 ? NH2 ? A ARG 344 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 'v1.21.2 -5419' ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? TRUNCATE ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9SN0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 148.378 _cell.length_a_esd ? _cell.length_b 148.378 _cell.length_b_esd ? _cell.length_c 39.345 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9SN0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 79 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9SN0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.67 _exptl_crystal.description 'body centered tetragonal space group I4, growing in rods' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details Incubator _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES pH 7.0, 0.5 M ammonium sulfate, 0.1 M sodium thiocyanate, 2 % glycerol, 1.5mM TCEP' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-03-03 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979330 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979330 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-2 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 33.451 _reflns.entry_id 9SN0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 46.92 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22194 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.18 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.157 _reflns.pdbx_Rpim_I_all 0.079 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.135 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1880 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.2 _reflns_shell.pdbx_chi_squared 1.86 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.293 _reflns_shell.pdbx_Rpim_I_all 0.866 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.640 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.5 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.967 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 43.11 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9SN0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 38.03 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22004 _refine.ls_number_reflns_R_free 1134 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.03 _refine.ls_percent_reflns_R_free 5.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2310 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2101 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 38.03 _refine_hist.number_atoms_solvent 125 _refine_hist.number_atoms_total 2339 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2209 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2 _refine_ls_shell.d_res_low 2.3 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 154 _refine_ls_shell.number_reflns_R_work 2544 _refine_ls_shell.percent_reflns_obs 93.46 _refine_ls_shell.percent_reflns_R_free 6.05 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.4297 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.4884 # _struct.entry_id 9SN0 _struct.title 'TKD of human Muscle Specific Kinase (MuSK)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9SN0 _struct_keywords.text 'tyrosine kinase domain, neuromuscular junction, receptor tyrosine kinase, phosphorylation, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MUSK_HUMAN _struct_ref.pdbx_db_accession O15146 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ESAAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVK MLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQV SSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWM PPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSF TSIHRILERMCERAEGTVSV ; _struct_ref.pdbx_align_begin 530 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9SN0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 351 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15146 _struct_ref_seq.db_align_beg 530 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 869 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 530 _struct_ref_seq.pdbx_auth_seq_align_end 869 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9SN0 MET A 1 ? UNP O15146 ? ? 'initiating methionine' 519 1 1 9SN0 LYS A 2 ? UNP O15146 ? ? 'expression tag' 520 2 1 9SN0 LYS A 3 ? UNP O15146 ? ? 'expression tag' 521 3 1 9SN0 GLY A 4 ? UNP O15146 ? ? 'expression tag' 522 4 1 9SN0 HIS A 5 ? UNP O15146 ? ? 'expression tag' 523 5 1 9SN0 HIS A 6 ? UNP O15146 ? ? 'expression tag' 524 6 1 9SN0 HIS A 7 ? UNP O15146 ? ? 'expression tag' 525 7 1 9SN0 HIS A 8 ? UNP O15146 ? ? 'expression tag' 526 8 1 9SN0 HIS A 9 ? UNP O15146 ? ? 'expression tag' 527 9 1 9SN0 HIS A 10 ? UNP O15146 ? ? 'expression tag' 528 10 1 9SN0 GLY A 11 ? UNP O15146 ? ? 'expression tag' 529 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 470 ? 1 MORE -24 ? 1 'SSA (A^2)' 13470 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'mass spectrometry' 'intact mass analysis' 2 1 'gel filtration' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 44 ? LEU A 50 ? ASN A 562 LEU A 568 1 ? 7 HELX_P HELX_P2 AA2 PRO A 53 ? ILE A 57 ? PRO A 571 ILE A 575 5 ? 5 HELX_P HELX_P3 AA3 SER A 98 ? GLU A 114 ? SER A 616 GLU A 632 1 ? 17 HELX_P HELX_P4 AA4 ASP A 144 ? MET A 152 ? ASP A 662 MET A 670 1 ? 9 HELX_P HELX_P5 AA5 SER A 180 ? ARG A 201 ? SER A 698 ARG A 719 1 ? 22 HELX_P HELX_P6 AA6 ALA A 209 ? ARG A 211 ? ALA A 727 ARG A 729 5 ? 3 HELX_P HELX_P7 AA7 GLU A 217 ? MET A 219 ? GLU A 735 MET A 737 5 ? 3 HELX_P HELX_P8 AA8 LEU A 228 ? TYR A 233 ? LEU A 746 TYR A 751 1 ? 6 HELX_P HELX_P9 AA9 SER A 234 ? TYR A 237 ? SER A 752 TYR A 755 5 ? 4 HELX_P HELX_P10 AB1 PRO A 247 ? MET A 251 ? PRO A 765 MET A 769 5 ? 5 HELX_P HELX_P11 AB2 PRO A 252 ? ASN A 259 ? PRO A 770 ASN A 777 1 ? 8 HELX_P HELX_P12 AB3 THR A 262 ? PHE A 278 ? THR A 780 PHE A 796 1 ? 17 HELX_P HELX_P13 AB4 ALA A 289 ? ASP A 299 ? ALA A 807 ASP A 817 1 ? 11 HELX_P HELX_P14 AB5 PRO A 310 ? TRP A 321 ? PRO A 828 TRP A 839 1 ? 12 HELX_P HELX_P15 AB6 LEU A 324 ? ARG A 328 ? LEU A 842 ARG A 846 5 ? 5 HELX_P HELX_P16 AB7 SER A 330 ? ALA A 345 ? SER A 848 ALA A 863 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 58 OE1 ? ? ? 1_555 D NA . NA ? ? A GLU 576 A NA 903 1_555 ? ? ? ? ? ? ? 2.280 ? ? metalc2 metalc ? ? D NA . NA ? ? ? 1_555 E HOH . O ? ? A NA 903 A HOH 1109 1_555 ? ? ? ? ? ? ? 2.302 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OE1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id GLU _pdbx_struct_conn_angle.ptnr1_label_seq_id 58 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr1_auth_seq_id 576 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id NA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id D _pdbx_struct_conn_angle.ptnr2_label_comp_id NA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id NA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 903 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id E _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 1109 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 106.5 _pdbx_struct_conn_angle.value_esd ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 131 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 649 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 132 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 650 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 58 ? GLU A 65 ? GLU A 576 GLU A 583 AA1 2 ARG A 70 ? PRO A 77 ? ARG A 588 PRO A 595 AA1 3 PHE A 85 ? MET A 92 ? PHE A 603 MET A 610 AA1 4 CYS A 134 ? GLU A 138 ? CYS A 652 GLU A 656 AA1 5 LEU A 123 ? CYS A 127 ? LEU A 641 CYS A 645 AA2 1 CYS A 213 ? VAL A 215 ? CYS A 731 VAL A 733 AA2 2 VAL A 221 ? ILE A 223 ? VAL A 739 ILE A 741 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 58 ? N GLU A 576 O ARG A 75 ? O ARG A 593 AA1 2 3 N PHE A 72 ? N PHE A 590 O VAL A 90 ? O VAL A 608 AA1 3 4 N LYS A 91 ? N LYS A 609 O LEU A 135 ? O LEU A 653 AA1 4 5 O LEU A 136 ? O LEU A 654 N GLY A 125 ? N GLY A 643 AA2 1 2 N LEU A 214 ? N LEU A 732 O LYS A 222 ? O LYS A 740 # _pdbx_entry_details.entry_id 9SN0 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 725 ? ? -153.54 43.36 2 1 ASP A 743 ? ? -154.33 57.60 3 1 ALA A 758 ? ? -86.95 -78.01 4 1 ASN A 759 ? ? -107.15 -157.70 5 1 THR A 780 ? ? -126.76 -164.19 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 1125 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.15 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 519 ? A MET 1 2 1 Y 1 A LYS 520 ? A LYS 2 3 1 Y 1 A LYS 521 ? A LYS 3 4 1 Y 1 A GLY 522 ? A GLY 4 5 1 Y 1 A HIS 523 ? A HIS 5 6 1 Y 1 A HIS 524 ? A HIS 6 7 1 Y 1 A HIS 525 ? A HIS 7 8 1 Y 1 A HIS 526 ? A HIS 8 9 1 Y 1 A HIS 527 ? A HIS 9 10 1 Y 1 A HIS 528 ? A HIS 10 11 1 Y 1 A GLY 529 ? A GLY 11 12 1 Y 1 A GLU 530 ? A GLU 12 13 1 Y 1 A SER 531 ? A SER 13 14 1 Y 1 A ALA 532 ? A ALA 14 15 1 Y 1 A ALA 533 ? A ALA 15 16 1 Y 1 A VAL 534 ? A VAL 16 17 1 Y 1 A THR 535 ? A THR 17 18 1 Y 1 A LEU 536 ? A LEU 18 19 1 Y 1 A THR 537 ? A THR 19 20 1 Y 1 A THR 538 ? A THR 20 21 1 Y 1 A LEU 539 ? A LEU 21 22 1 Y 1 A PRO 540 ? A PRO 22 23 1 Y 1 A SER 541 ? A SER 23 24 1 Y 1 A GLU 542 ? A GLU 24 25 1 Y 1 A LEU 543 ? A LEU 25 26 1 Y 1 A LEU 544 ? A LEU 26 27 1 Y 1 A LEU 545 ? A LEU 27 28 1 Y 1 A ASP 546 ? A ASP 28 29 1 Y 1 A ARG 547 ? A ARG 29 30 1 Y 1 A LEU 548 ? A LEU 30 31 1 Y 1 A HIS 549 ? A HIS 31 32 1 Y 1 A PRO 550 ? A PRO 32 33 1 Y 1 A ASN 551 ? A ASN 33 34 1 Y 1 A PRO 552 ? A PRO 34 35 1 Y 1 A MET 553 ? A MET 35 36 1 Y 1 A TYR 554 ? A TYR 36 37 1 Y 1 A GLN 555 ? A GLN 37 38 1 Y 1 A ARG 556 ? A ARG 38 39 1 Y 1 A MET 557 ? A MET 39 40 1 Y 1 A PRO 558 ? A PRO 40 41 1 Y 1 A LEU 559 ? A LEU 41 42 1 Y 1 A HIS 673 ? A HIS 155 43 1 Y 1 A THR 674 ? A THR 156 44 1 Y 1 A VAL 675 ? A VAL 157 45 1 Y 1 A CYS 676 ? A CYS 158 46 1 Y 1 A SER 677 ? A SER 159 47 1 Y 1 A LEU 678 ? A LEU 160 48 1 Y 1 A SER 679 ? A SER 161 49 1 Y 1 A HIS 680 ? A HIS 162 50 1 Y 1 A SER 681 ? A SER 163 51 1 Y 1 A ASP 682 ? A ASP 164 52 1 Y 1 A LEU 683 ? A LEU 165 53 1 Y 1 A SER 684 ? A SER 166 54 1 Y 1 A MET 685 ? A MET 167 55 1 Y 1 A ARG 686 ? A ARG 168 56 1 Y 1 A ALA 687 ? A ALA 169 57 1 Y 1 A GLN 688 ? A GLN 170 58 1 Y 1 A VAL 689 ? A VAL 171 59 1 Y 1 A SER 690 ? A SER 172 60 1 Y 1 A SER 691 ? A SER 173 61 1 Y 1 A PRO 692 ? A PRO 174 62 1 Y 1 A GLY 693 ? A GLY 175 63 1 Y 1 A PRO 694 ? A PRO 176 64 1 Y 1 A PRO 695 ? A PRO 177 65 1 Y 1 A GLU 864 ? A GLU 346 66 1 Y 1 A GLY 865 ? A GLY 347 67 1 Y 1 A THR 866 ? A THR 348 68 1 Y 1 A VAL 867 ? A VAL 349 69 1 Y 1 A SER 868 ? A SER 350 70 1 Y 1 A VAL 869 ? A VAL 351 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NA NA NA N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SCN S S N N 291 SCN C C N N 292 SCN N N N N 293 SER N N N N 294 SER CA C N S 295 SER C C N N 296 SER O O N N 297 SER CB C N N 298 SER OG O N N 299 SER OXT O N N 300 SER H H N N 301 SER H2 H N N 302 SER HA H N N 303 SER HB2 H N N 304 SER HB3 H N N 305 SER HG H N N 306 SER HXT H N N 307 THR N N N N 308 THR CA C N S 309 THR C C N N 310 THR O O N N 311 THR CB C N R 312 THR OG1 O N N 313 THR CG2 C N N 314 THR OXT O N N 315 THR H H N N 316 THR H2 H N N 317 THR HA H N N 318 THR HB H N N 319 THR HG1 H N N 320 THR HG21 H N N 321 THR HG22 H N N 322 THR HG23 H N N 323 THR HXT H N N 324 TRP N N N N 325 TRP CA C N S 326 TRP C C N N 327 TRP O O N N 328 TRP CB C N N 329 TRP CG C Y N 330 TRP CD1 C Y N 331 TRP CD2 C Y N 332 TRP NE1 N Y N 333 TRP CE2 C Y N 334 TRP CE3 C Y N 335 TRP CZ2 C Y N 336 TRP CZ3 C Y N 337 TRP CH2 C Y N 338 TRP OXT O N N 339 TRP H H N N 340 TRP H2 H N N 341 TRP HA H N N 342 TRP HB2 H N N 343 TRP HB3 H N N 344 TRP HD1 H N N 345 TRP HE1 H N N 346 TRP HE3 H N N 347 TRP HZ2 H N N 348 TRP HZ3 H N N 349 TRP HH2 H N N 350 TRP HXT H N N 351 TYR N N N N 352 TYR CA C N S 353 TYR C C N N 354 TYR O O N N 355 TYR CB C N N 356 TYR CG C Y N 357 TYR CD1 C Y N 358 TYR CD2 C Y N 359 TYR CE1 C Y N 360 TYR CE2 C Y N 361 TYR CZ C Y N 362 TYR OH O N N 363 TYR OXT O N N 364 TYR H H N N 365 TYR H2 H N N 366 TYR HA H N N 367 TYR HB2 H N N 368 TYR HB3 H N N 369 TYR HD1 H N N 370 TYR HD2 H N N 371 TYR HE1 H N N 372 TYR HE2 H N N 373 TYR HH H N N 374 TYR HXT H N N 375 VAL N N N N 376 VAL CA C N S 377 VAL C C N N 378 VAL O O N N 379 VAL CB C N N 380 VAL CG1 C N N 381 VAL CG2 C N N 382 VAL OXT O N N 383 VAL H H N N 384 VAL H2 H N N 385 VAL HA H N N 386 VAL HB H N N 387 VAL HG11 H N N 388 VAL HG12 H N N 389 VAL HG13 H N N 390 VAL HG21 H N N 391 VAL HG22 H N N 392 VAL HG23 H N N 393 VAL HXT H N N 394 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SCN S C sing N N 277 SCN C N trip N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TRP N CA sing N N 308 TRP N H sing N N 309 TRP N H2 sing N N 310 TRP CA C sing N N 311 TRP CA CB sing N N 312 TRP CA HA sing N N 313 TRP C O doub N N 314 TRP C OXT sing N N 315 TRP CB CG sing N N 316 TRP CB HB2 sing N N 317 TRP CB HB3 sing N N 318 TRP CG CD1 doub Y N 319 TRP CG CD2 sing Y N 320 TRP CD1 NE1 sing Y N 321 TRP CD1 HD1 sing N N 322 TRP CD2 CE2 doub Y N 323 TRP CD2 CE3 sing Y N 324 TRP NE1 CE2 sing Y N 325 TRP NE1 HE1 sing N N 326 TRP CE2 CZ2 sing Y N 327 TRP CE3 CZ3 doub Y N 328 TRP CE3 HE3 sing N N 329 TRP CZ2 CH2 doub Y N 330 TRP CZ2 HZ2 sing N N 331 TRP CZ3 CH2 sing Y N 332 TRP CZ3 HZ3 sing N N 333 TRP CH2 HH2 sing N N 334 TRP OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Austrian Science Fund' Austria P31199-B27 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R35 GM122485' 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1LUF _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.5281/zenodo.17086410 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _atom_sites.entry_id 9SN0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.006740 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006740 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025416 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NA O S # loop_ #