data_9SOS # _entry.id 9SOS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9SOS pdb_00009sos 10.2210/pdb9sos/pdb WWPDB D_1292150880 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-09-24 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9SOS _pdbx_database_status.recvd_initial_deposition_date 2025-09-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email arnout.voet@kuleuven.be _pdbx_contact_author.name_first Arnout _pdbx_contact_author.name_last Voet _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3329-2703 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shemy, A.' 1 0000-0002-3599-846X 'Voet, A.' 2 0000-0002-3329-2703 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Tissue Inhibitor of Matrix Metalloproteinase-1 (TIMP-1)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shemy, A.' 1 0000-0002-3599-846X primary 'Voet, A.' 2 0000-0002-3329-2703 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Metalloproteinase inhibitor 1' 20732.848 1 ? ? ? ? 2 water nat water 18.015 46 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Erythroid-potentiating activity,EPA,Fibroblast collagenase inhibitor,Collagenase inhibitor,Tissue inhibitor of metalloproteinases 1,TIMP-1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS EEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQ SRHLACLPREPGLCTWQSLRSQIA ; _entity_poly.pdbx_seq_one_letter_code_can ;CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS EEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQ SRHLACLPREPGLCTWQSLRSQIA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 THR n 1 3 CYS n 1 4 VAL n 1 5 PRO n 1 6 PRO n 1 7 HIS n 1 8 PRO n 1 9 GLN n 1 10 THR n 1 11 ALA n 1 12 PHE n 1 13 CYS n 1 14 ASN n 1 15 SER n 1 16 ASP n 1 17 LEU n 1 18 VAL n 1 19 ILE n 1 20 ARG n 1 21 ALA n 1 22 LYS n 1 23 PHE n 1 24 VAL n 1 25 GLY n 1 26 THR n 1 27 PRO n 1 28 GLU n 1 29 VAL n 1 30 ASN n 1 31 GLN n 1 32 THR n 1 33 THR n 1 34 LEU n 1 35 TYR n 1 36 GLN n 1 37 ARG n 1 38 TYR n 1 39 GLU n 1 40 ILE n 1 41 LYS n 1 42 MET n 1 43 THR n 1 44 LYS n 1 45 MET n 1 46 TYR n 1 47 LYS n 1 48 GLY n 1 49 PHE n 1 50 GLN n 1 51 ALA n 1 52 LEU n 1 53 GLY n 1 54 ASP n 1 55 ALA n 1 56 ALA n 1 57 ASP n 1 58 ILE n 1 59 ARG n 1 60 PHE n 1 61 VAL n 1 62 TYR n 1 63 THR n 1 64 PRO n 1 65 ALA n 1 66 MET n 1 67 GLU n 1 68 SER n 1 69 VAL n 1 70 CYS n 1 71 GLY n 1 72 TYR n 1 73 PHE n 1 74 HIS n 1 75 ARG n 1 76 SER n 1 77 HIS n 1 78 ASN n 1 79 ARG n 1 80 SER n 1 81 GLU n 1 82 GLU n 1 83 PHE n 1 84 LEU n 1 85 ILE n 1 86 ALA n 1 87 GLY n 1 88 LYS n 1 89 LEU n 1 90 GLN n 1 91 ASP n 1 92 GLY n 1 93 LEU n 1 94 LEU n 1 95 HIS n 1 96 ILE n 1 97 THR n 1 98 THR n 1 99 CYS n 1 100 SER n 1 101 PHE n 1 102 VAL n 1 103 ALA n 1 104 PRO n 1 105 TRP n 1 106 ASN n 1 107 SER n 1 108 LEU n 1 109 SER n 1 110 LEU n 1 111 ALA n 1 112 GLN n 1 113 ARG n 1 114 ARG n 1 115 GLY n 1 116 PHE n 1 117 THR n 1 118 LYS n 1 119 THR n 1 120 TYR n 1 121 THR n 1 122 VAL n 1 123 GLY n 1 124 CYS n 1 125 GLU n 1 126 GLU n 1 127 CYS n 1 128 THR n 1 129 VAL n 1 130 PHE n 1 131 PRO n 1 132 CYS n 1 133 LEU n 1 134 SER n 1 135 ILE n 1 136 PRO n 1 137 CYS n 1 138 LYS n 1 139 LEU n 1 140 GLN n 1 141 SER n 1 142 GLY n 1 143 THR n 1 144 HIS n 1 145 CYS n 1 146 LEU n 1 147 TRP n 1 148 THR n 1 149 ASP n 1 150 GLN n 1 151 LEU n 1 152 LEU n 1 153 GLN n 1 154 GLY n 1 155 SER n 1 156 GLU n 1 157 LYS n 1 158 GLY n 1 159 PHE n 1 160 GLN n 1 161 SER n 1 162 ARG n 1 163 HIS n 1 164 LEU n 1 165 ALA n 1 166 CYS n 1 167 LEU n 1 168 PRO n 1 169 ARG n 1 170 GLU n 1 171 PRO n 1 172 GLY n 1 173 LEU n 1 174 CYS n 1 175 THR n 1 176 TRP n 1 177 GLN n 1 178 SER n 1 179 LEU n 1 180 ARG n 1 181 SER n 1 182 GLN n 1 183 ILE n 1 184 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 184 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TIMP1, CLGI, TIMP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 CYS 124 124 124 CYS CYS A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 CYS 145 145 145 CYS CYS A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TRP 147 147 147 TRP TRP A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLN 150 150 150 GLN ALA A . n A 1 151 LEU 151 151 151 LEU ALA A . n A 1 152 LEU 152 152 ? ? ? A . n A 1 153 GLN 153 153 ? ? ? A . n A 1 154 GLY 154 154 ? ? ? A . n A 1 155 SER 155 155 ? ? ? A . n A 1 156 GLU 156 156 ? ? ? A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 HIS 163 163 163 HIS HIS A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 CYS 166 166 166 CYS CYS A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 TRP 176 176 176 TRP TRP A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 SER 181 181 ? ? ? A . n A 1 182 GLN 182 182 ? ? ? A . n A 1 183 ILE 183 183 ? ? ? A . n A 1 184 ALA 184 184 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 97 HOH HOH A . B 2 HOH 2 202 38 HOH HOH A . B 2 HOH 3 203 9 HOH HOH A . B 2 HOH 4 204 85 HOH HOH A . B 2 HOH 5 205 82 HOH HOH A . B 2 HOH 6 206 104 HOH HOH A . B 2 HOH 7 207 46 HOH HOH A . B 2 HOH 8 208 93 HOH HOH A . B 2 HOH 9 209 16 HOH HOH A . B 2 HOH 10 210 29 HOH HOH A . B 2 HOH 11 211 61 HOH HOH A . B 2 HOH 12 212 88 HOH HOH A . B 2 HOH 13 213 5 HOH HOH A . B 2 HOH 14 214 2 HOH HOH A . B 2 HOH 15 215 14 HOH HOH A . B 2 HOH 16 216 90 HOH HOH A . B 2 HOH 17 217 40 HOH HOH A . B 2 HOH 18 218 51 HOH HOH A . B 2 HOH 19 219 92 HOH HOH A . B 2 HOH 20 220 34 HOH HOH A . B 2 HOH 21 221 84 HOH HOH A . B 2 HOH 22 222 13 HOH HOH A . B 2 HOH 23 223 11 HOH HOH A . B 2 HOH 24 224 91 HOH HOH A . B 2 HOH 25 225 99 HOH HOH A . B 2 HOH 26 226 39 HOH HOH A . B 2 HOH 27 227 69 HOH HOH A . B 2 HOH 28 228 87 HOH HOH A . B 2 HOH 29 229 81 HOH HOH A . B 2 HOH 30 230 74 HOH HOH A . B 2 HOH 31 231 4 HOH HOH A . B 2 HOH 32 232 12 HOH HOH A . B 2 HOH 33 233 96 HOH HOH A . B 2 HOH 34 234 98 HOH HOH A . B 2 HOH 35 235 103 HOH HOH A . B 2 HOH 36 236 86 HOH HOH A . B 2 HOH 37 237 49 HOH HOH A . B 2 HOH 38 238 37 HOH HOH A . B 2 HOH 39 239 100 HOH HOH A . B 2 HOH 40 240 108 HOH HOH A . B 2 HOH 41 241 107 HOH HOH A . B 2 HOH 42 242 110 HOH HOH A . B 2 HOH 43 243 105 HOH HOH A . B 2 HOH 44 244 106 HOH HOH A . B 2 HOH 45 245 109 HOH HOH A . B 2 HOH 46 246 101 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 2 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 3 1 Y 1 A GLU 28 ? CG ? A GLU 28 CG 4 1 Y 1 A GLU 28 ? CD ? A GLU 28 CD 5 1 Y 1 A GLU 28 ? OE1 ? A GLU 28 OE1 6 1 Y 1 A GLU 28 ? OE2 ? A GLU 28 OE2 7 1 Y 1 A LYS 41 ? CD ? A LYS 41 CD 8 1 Y 1 A LYS 41 ? CE ? A LYS 41 CE 9 1 Y 1 A LYS 41 ? NZ ? A LYS 41 NZ 10 1 Y 1 A LYS 44 ? CD ? A LYS 44 CD 11 1 Y 1 A LYS 44 ? CE ? A LYS 44 CE 12 1 Y 1 A LYS 44 ? NZ ? A LYS 44 NZ 13 1 Y 1 A GLN 50 ? CB ? A GLN 50 CB 14 1 Y 1 A GLN 50 ? CG ? A GLN 50 CG 15 1 Y 1 A GLN 50 ? CD ? A GLN 50 CD 16 1 Y 1 A GLN 50 ? OE1 ? A GLN 50 OE1 17 1 Y 1 A GLN 50 ? NE2 ? A GLN 50 NE2 18 1 Y 1 A ALA 51 ? CB ? A ALA 51 CB 19 1 Y 1 A LEU 52 ? CD2 ? A LEU 52 CD2 20 1 Y 1 A ASP 54 ? CG ? A ASP 54 CG 21 1 Y 1 A ASP 54 ? OD1 ? A ASP 54 OD1 22 1 Y 1 A ASP 54 ? OD2 ? A ASP 54 OD2 23 1 Y 1 A ILE 58 ? CD1 ? A ILE 58 CD1 24 1 Y 1 A ARG 79 ? NE ? A ARG 79 NE 25 1 Y 1 A ARG 79 ? CZ ? A ARG 79 CZ 26 1 Y 1 A ARG 79 ? NH1 ? A ARG 79 NH1 27 1 Y 1 A ARG 79 ? NH2 ? A ARG 79 NH2 28 1 Y 1 A GLN 90 ? CG ? A GLN 90 CG 29 1 Y 1 A GLN 90 ? CD ? A GLN 90 CD 30 1 Y 1 A GLN 90 ? OE1 ? A GLN 90 OE1 31 1 Y 1 A GLN 90 ? NE2 ? A GLN 90 NE2 32 1 Y 1 A ASP 91 ? CG ? A ASP 91 CG 33 1 Y 1 A ASP 91 ? OD1 ? A ASP 91 OD1 34 1 Y 1 A ASP 91 ? OD2 ? A ASP 91 OD2 35 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 36 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 37 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 38 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 39 1 Y 1 A GLU 125 ? CD ? A GLU 125 CD 40 1 Y 1 A GLU 125 ? OE1 ? A GLU 125 OE1 41 1 Y 1 A GLU 125 ? OE2 ? A GLU 125 OE2 42 1 Y 1 A GLU 126 ? CG ? A GLU 126 CG 43 1 Y 1 A GLU 126 ? CD ? A GLU 126 CD 44 1 Y 1 A GLU 126 ? OE1 ? A GLU 126 OE1 45 1 Y 1 A GLU 126 ? OE2 ? A GLU 126 OE2 46 1 Y 1 A ILE 135 ? CB ? A ILE 135 CB 47 1 Y 1 A ILE 135 ? CG1 ? A ILE 135 CG1 48 1 Y 1 A ILE 135 ? CG2 ? A ILE 135 CG2 49 1 Y 1 A ILE 135 ? CD1 ? A ILE 135 CD1 50 1 Y 1 A GLN 150 ? CG ? A GLN 150 CG 51 1 Y 1 A GLN 150 ? CD ? A GLN 150 CD 52 1 Y 1 A GLN 150 ? OE1 ? A GLN 150 OE1 53 1 Y 1 A GLN 150 ? NE2 ? A GLN 150 NE2 54 1 Y 1 A LEU 151 ? CG ? A LEU 151 CG 55 1 Y 1 A LEU 151 ? CD1 ? A LEU 151 CD1 56 1 Y 1 A LEU 151 ? CD2 ? A LEU 151 CD2 57 1 Y 1 A LYS 157 ? CG ? A LYS 157 CG 58 1 Y 1 A LYS 157 ? CD ? A LYS 157 CD 59 1 Y 1 A LYS 157 ? CE ? A LYS 157 CE 60 1 Y 1 A LYS 157 ? NZ ? A LYS 157 NZ 61 1 Y 1 A ARG 180 ? CG ? A ARG 180 CG 62 1 Y 1 A ARG 180 ? CD ? A ARG 180 CD 63 1 Y 1 A ARG 180 ? NE ? A ARG 180 NE 64 1 Y 1 A ARG 180 ? CZ ? A ARG 180 CZ 65 1 Y 1 A ARG 180 ? NH1 ? A ARG 180 NH1 66 1 Y 1 A ARG 180 ? NH2 ? A ARG 180 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.15 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? 3.19 ? 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? gemmi ? ? ? 0.7.1 ? 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0431 (refmacat 0.4.105)' ? 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.15 ? 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? 3.19 ? 6 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? gemmi ? ? ? 0.7.1 ? 7 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0431 (refmacat 0.4.105)' ? 8 ? phasing ? ? ? ? ? ? ? ? ? ? ? DIMPLE ? ? ? 2.6.2 ? 9 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9SOS _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.165 _cell.length_a_esd ? _cell.length_b 61.324 _cell.length_b_esd ? _cell.length_c 87.737 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9SOS _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 2 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9SOS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Lithium Citrate tribasic tetrahydrate, 20% PEG3350 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-05-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9SOS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 43.87 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12629 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.72 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.100 _reflns.pdbx_Rpim_I_all 0.067 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 8.94 43.87 ? 40.4 ? ? ? ? 154 ? ? ? ? ? ? ? ? ? ? ? 2.8 1.78 ? ? 0.054 0.036 ? 1 ? 0.994 ? ? 89.3 ? 0.039 ? ? ? ? ? ? ? ? ? 2.00 2.05 ? 1.1 ? ? ? ? 930 ? ? ? ? ? ? ? ? ? ? ? 3.0 0.10 ? ? 0.398 0.265 ? 2 ? 0.912 ? ? 99.8 ? 0.296 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -1.323 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 5.109 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -3.785 _refine.B_iso_max ? _refine.B_iso_mean 40.619 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.961 _refine.correlation_coeff_Fo_to_Fc_free 0.928 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9SOS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.000 _refine.ls_d_res_low 43.868 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12603 _refine.ls_number_reflns_R_free 569 _refine.ls_number_reflns_R_work 12034 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.671 _refine.ls_percent_reflns_R_free 4.515 _refine.ls_R_factor_all 0.202 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2550 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1995 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.187 _refine.pdbx_overall_ESU_R_Free 0.176 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.583 _refine.overall_SU_ML 0.184 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.000 _refine_hist.d_res_low 43.868 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 1365 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1319 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.012 1361 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.003 0.016 1192 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 2.254 1.808 1856 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.922 1.719 2752 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 9.020 5.000 173 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 14.969 5.000 8 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 16.172 10.000 197 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.315 10.000 52 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.121 0.200 206 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 1609 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 329 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.190 0.200 223 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 1157 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.178 0.200 654 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.086 0.200 805 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.145 0.200 55 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.131 0.200 11 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.156 0.200 68 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.197 0.200 8 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 5.301 3.984 698 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 5.289 3.984 698 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 7.797 7.142 869 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 7.794 7.146 870 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 6.061 4.274 663 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 6.049 4.274 663 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 8.409 7.704 987 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 8.410 7.705 988 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 11.014 42.230 1441 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 11.014 42.221 1436 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.000 2.052 930 . 47 880 99.6774 . 0.325 . . 0.330 . . . . . 0.315 . . . . . 20 . 0.873 0.890 0.247 'X-RAY DIFFRACTION' 2.052 2.108 913 . 42 869 99.7809 . 0.298 . . 0.296 . . . . . 0.273 . . . . . 20 . 0.893 0.876 0.343 'X-RAY DIFFRACTION' 2.108 2.169 899 . 49 847 99.6663 . 0.296 . . 0.293 . . . . . 0.262 . . . . . 20 . 0.902 0.881 0.345 'X-RAY DIFFRACTION' 2.169 2.236 872 . 37 833 99.7706 . 0.296 . . 0.289 . . . . . 0.254 . . . . . 20 . 0.913 0.792 0.449 'X-RAY DIFFRACTION' 2.236 2.309 845 . 36 796 98.4615 . 0.262 . . 0.262 . . . . . 0.231 . . . . . 20 . 0.932 0.937 0.265 'X-RAY DIFFRACTION' 2.309 2.390 808 . 34 754 97.5247 . 0.232 . . 0.230 . . . . . 0.204 . . . . . 20 . 0.953 0.946 0.277 'X-RAY DIFFRACTION' 2.390 2.479 800 . 34 756 98.7500 . 0.213 . . 0.211 . . . . . 0.186 . . . . . 20 . 0.962 0.948 0.272 'X-RAY DIFFRACTION' 2.479 2.580 759 . 32 716 98.5507 . 0.220 . . 0.217 . . . . . 0.184 . . . . . 20 . 0.966 0.924 0.274 'X-RAY DIFFRACTION' 2.580 2.695 736 . 33 685 97.5544 . 0.217 . . 0.217 . . . . . 0.180 . . . . . 20 . 0.967 0.962 0.224 'X-RAY DIFFRACTION' 2.695 2.826 712 . 30 639 93.9607 . 0.208 . . 0.206 . . . . . 0.173 . . . . . 20 . 0.969 0.947 0.260 'X-RAY DIFFRACTION' 2.826 2.978 650 . 26 548 88.3077 . 0.192 . . 0.186 . . . . . 0.157 . . . . . 20 . 0.976 0.937 0.322 'X-RAY DIFFRACTION' 2.978 3.158 655 . 31 553 89.1603 . 0.184 . . 0.180 . . . . . 0.153 . . . . . 20 . 0.978 0.959 0.264 'X-RAY DIFFRACTION' 3.158 3.374 607 . 24 572 98.1878 . 0.176 . . 0.174 . . . . . 0.154 . . . . . 20 . 0.981 0.961 0.215 'X-RAY DIFFRACTION' 3.374 3.643 556 . 24 519 97.6619 . 0.168 . . 0.164 . . . . . 0.151 . . . . . 20 . 0.984 0.966 0.248 'X-RAY DIFFRACTION' 3.643 3.988 529 . 17 498 97.3535 . 0.157 . . 0.155 . . . . . 0.142 . . . . . 20 . 0.986 0.971 0.216 'X-RAY DIFFRACTION' 3.988 4.454 479 . 31 429 96.0334 . 0.142 . . 0.141 . . . . . 0.139 . . . . . 20 . 0.988 0.981 0.167 'X-RAY DIFFRACTION' 4.454 5.134 428 . 14 391 94.6262 . 0.153 . . 0.152 . . . . . 0.147 . . . . . 20 . 0.987 0.974 0.184 'X-RAY DIFFRACTION' 5.134 6.267 367 . 11 335 94.2779 . 0.204 . . 0.200 . . . . . 0.189 . . . . . 20 . 0.976 0.968 0.308 'X-RAY DIFFRACTION' 6.267 8.773 304 . 13 262 90.4605 . 0.235 . . 0.235 . . . . . 0.235 . . . . . 20 . 0.965 0.979 0.231 'X-RAY DIFFRACTION' 8.773 43.868 187 . 4 152 83.4225 . 0.217 . . 0.213 . . . . . 0.231 . . . . . 20 . 0.970 0.925 0.339 # _struct.entry_id 9SOS _struct.title 'Tissue Inhibitor of Matrix Metalloproteinase-1 (TIMP-1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9SOS _struct_keywords.text 'Hydrolase Inhibitor, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIMP1_HUMAN _struct_ref.pdbx_db_accession P01033 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS EEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQ SRHLACLPREPGLCTWQSLRSQIA ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9SOS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 184 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01033 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 207 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 184 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9260 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 7 ? SER A 15 ? HIS A 7 SER A 15 1 ? 9 HELX_P HELX_P2 AA2 MET A 66 ? CYS A 70 ? MET A 66 CYS A 70 5 ? 5 HELX_P HELX_P3 AA3 ASN A 106 ? LEU A 108 ? ASN A 106 LEU A 108 5 ? 3 HELX_P HELX_P4 AA4 SER A 109 ? LYS A 118 ? SER A 109 LYS A 118 1 ? 10 HELX_P HELX_P5 AA5 THR A 119 ? CYS A 124 ? THR A 119 CYS A 124 5 ? 6 HELX_P HELX_P6 AA6 GLY A 158 ? LEU A 164 ? GLY A 158 LEU A 164 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 1 A CYS 70 1_555 ? ? ? ? ? ? ? 2.103 ? ? disulf2 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 99 SG ? ? A CYS 3 A CYS 99 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 124 SG ? ? A CYS 13 A CYS 124 1_555 ? ? ? ? ? ? ? 2.082 ? ? disulf4 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 127 A CYS 174 1_555 ? ? ? ? ? ? ? 2.202 ? ? disulf5 disulf ? ? A CYS 132 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 132 A CYS 137 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf6 disulf ? ? A CYS 145 SG ? ? ? 1_555 A CYS 166 SG ? ? A CYS 145 A CYS 166 1_555 ? ? ? ? ? ? ? 2.105 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 1 ? CYS A 70 ? CYS A 1 ? 1_555 CYS A 70 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 3 ? CYS A 99 ? CYS A 3 ? 1_555 CYS A 99 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 13 ? CYS A 124 ? CYS A 13 ? 1_555 CYS A 124 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 127 ? CYS A 174 ? CYS A 127 ? 1_555 CYS A 174 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 132 ? CYS A 137 ? CYS A 132 ? 1_555 CYS A 137 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 145 ? CYS A 166 ? CYS A 145 ? 1_555 CYS A 166 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 6 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 28 ? VAL A 29 ? GLU A 28 VAL A 29 AA1 2 TYR A 35 ? LYS A 47 ? TYR A 35 LYS A 47 AA1 3 LEU A 17 ? PHE A 23 ? LEU A 17 PHE A 23 AA1 4 GLU A 82 ? GLN A 90 ? GLU A 82 GLN A 90 AA1 5 VAL A 102 ? PRO A 104 ? VAL A 102 PRO A 104 AA2 1 GLU A 28 ? VAL A 29 ? GLU A 28 VAL A 29 AA2 2 TYR A 35 ? LYS A 47 ? TYR A 35 LYS A 47 AA2 3 PHE A 60 ? PRO A 64 ? PHE A 60 PRO A 64 AA2 4 LEU A 93 ? HIS A 95 ? LEU A 93 HIS A 95 AA2 5 GLU A 82 ? GLN A 90 ? GLU A 82 GLN A 90 AA2 6 VAL A 102 ? PRO A 104 ? VAL A 102 PRO A 104 AA3 1 THR A 128 ? PRO A 131 ? THR A 128 PRO A 131 AA3 2 HIS A 144 ? TRP A 147 ? HIS A 144 TRP A 147 AA4 1 ALA A 165 ? GLU A 170 ? ALA A 165 GLU A 170 AA4 2 LEU A 173 ? GLN A 177 ? LEU A 173 GLN A 177 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 28 ? N GLU A 28 O ARG A 37 ? O ARG A 37 AA1 2 3 O LYS A 44 ? O LYS A 44 N ARG A 20 ? N ARG A 20 AA1 3 4 N ALA A 21 ? N ALA A 21 O PHE A 83 ? O PHE A 83 AA1 4 5 N LEU A 84 ? N LEU A 84 O ALA A 103 ? O ALA A 103 AA2 1 2 N GLU A 28 ? N GLU A 28 O ARG A 37 ? O ARG A 37 AA2 2 3 N GLN A 36 ? N GLN A 36 O THR A 63 ? O THR A 63 AA2 3 4 N TYR A 62 ? N TYR A 62 O LEU A 94 ? O LEU A 94 AA2 4 5 O LEU A 93 ? O LEU A 93 N GLN A 90 ? N GLN A 90 AA2 5 6 N LEU A 84 ? N LEU A 84 O ALA A 103 ? O ALA A 103 AA3 1 2 N PHE A 130 ? N PHE A 130 O TRP A 147 ? O TRP A 147 AA4 1 2 N ARG A 169 ? N ARG A 169 O LEU A 173 ? O LEU A 173 # _pdbx_entry_details.entry_id 9SOS _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A ARG 59 ? ? CD A ARG 59 ? ? NE A ARG 59 ? ? 127.83 111.80 16.03 2.10 N 2 1 NE A ARG 59 ? ? CZ A ARG 59 ? ? NH1 A ARG 59 ? ? 124.90 120.30 4.60 0.50 N 3 1 CB A CYS 132 ? ? CA A CYS 132 ? ? C A CYS 132 ? ? 120.52 111.50 9.02 1.20 N 4 1 CB A LYS 138 ? ? CA A LYS 138 ? ? C A LYS 138 ? ? 123.27 110.40 12.87 2.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 118 ? ? -144.88 -62.06 2 1 GLN A 150 ? ? -72.25 -70.57 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 THR _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 117 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 118 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -148.61 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 59 ? ? 0.136 'SIDE CHAIN' 2 1 ARG A 114 ? ? 0.080 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 152 ? A LEU 152 2 1 Y 1 A GLN 153 ? A GLN 153 3 1 Y 1 A GLY 154 ? A GLY 154 4 1 Y 1 A SER 155 ? A SER 155 5 1 Y 1 A GLU 156 ? A GLU 156 6 1 Y 1 A SER 181 ? A SER 181 7 1 Y 1 A GLN 182 ? A GLN 182 8 1 Y 1 A ILE 183 ? A ILE 183 9 1 Y 1 A ALA 184 ? A ALA 184 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Research Foundation - Flanders (FWO)' Belgium 1S11123N 1 'Research Foundation - Flanders (FWO)' Belgium 1S11125N 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6mav _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9SOS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.029270 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016307 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011398 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0462 # loop_ #