data_9SOU # _entry.id 9SOU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9SOU pdb_00009sou 10.2210/pdb9sou/pdb WWPDB D_1292150866 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-02 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9SOU _pdbx_database_status.recvd_initial_deposition_date 2025-09-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB WT 9SMY unspecified PDB 'equal sequence' 9SNN unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email miguel.matilla@eez.csic.es _pdbx_contact_author.name_first A. _pdbx_contact_author.name_last Miguel _pdbx_contact_author.name_mi Matilla _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8468-9604 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gavira, J.A.' 1 0000-0002-7386-6484 'Matilla, M.A.' 2 0000-0002-8468-9604 'Rico-Jimenez, M.' 3 0000-0002-0126-1478 'Ortega, A.' 4 0000-0001-8202-293X 'Roca, A.' 5 0009-0000-8011-9236 'Krell, T.' 6 0000-0002-9040-3166 'Zhulin, I.B.' 7 0000-0002-6708-5323 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first 154135 _citation.page_last 154135 _citation.title 'Evolution of monomodular all-helical receptor ligand-binding domains from bimodular ancestors.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2026.154135 _citation.pdbx_database_id_PubMed 42617770 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gavira, J.A.' 1 ? primary 'Rico-Jimenez, M.' 2 ? primary 'Ortega, A.' 3 ? primary 'Roca, A.' 4 ? primary 'Krell, T.' 5 ? primary 'Zhulin, I.B.' 6 ? primary 'Matilla, M.A.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ancestral PcpI' 30024.271 1 ? ? ? ? 2 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMGWHGMDSIIDRGDKLGNISVIQQYTQELRIARQHYQRQPDETSVAELEKALGNLDRQVQ LMVGQIEQPTDRQRLEQQREAVRSYQQAFSELKQAGQRREASRGVLGDSADKAAELIGRVQRGLLQGGDISQYQHAVEVS ALLQQARFQVRGYTYSGNADFQQTALKAIDQALAELRALPAKVPPEHAASLDDATTALGGYRDAVTQFGNAQATSEQALQ RMAEQGTVLLQTSQAMTLSQTEVRDAGAAQAKT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMGWHGMDSIIDRGDKLGNISVIQQYTQELRIARQHYQRQPDETSVAELEKALGNLDRQVQ LMVGQIEQPTDRQRLEQQREAVRSYQQAFSELKQAGQRREASRGVLGDSADKAAELIGRVQRGLLQGGDISQYQHAVEVS ALLQQARFQVRGYTYSGNADFQQTALKAIDQALAELRALPAKVPPEHAASLDDATTALGGYRDAVTQFGNAQATSEQALQ RMAEQGTVLLQTSQAMTLSQTEVRDAGAAQAKT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CITRIC ACID' CIT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLY n 1 23 TRP n 1 24 HIS n 1 25 GLY n 1 26 MET n 1 27 ASP n 1 28 SER n 1 29 ILE n 1 30 ILE n 1 31 ASP n 1 32 ARG n 1 33 GLY n 1 34 ASP n 1 35 LYS n 1 36 LEU n 1 37 GLY n 1 38 ASN n 1 39 ILE n 1 40 SER n 1 41 VAL n 1 42 ILE n 1 43 GLN n 1 44 GLN n 1 45 TYR n 1 46 THR n 1 47 GLN n 1 48 GLU n 1 49 LEU n 1 50 ARG n 1 51 ILE n 1 52 ALA n 1 53 ARG n 1 54 GLN n 1 55 HIS n 1 56 TYR n 1 57 GLN n 1 58 ARG n 1 59 GLN n 1 60 PRO n 1 61 ASP n 1 62 GLU n 1 63 THR n 1 64 SER n 1 65 VAL n 1 66 ALA n 1 67 GLU n 1 68 LEU n 1 69 GLU n 1 70 LYS n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 ASN n 1 75 LEU n 1 76 ASP n 1 77 ARG n 1 78 GLN n 1 79 VAL n 1 80 GLN n 1 81 LEU n 1 82 MET n 1 83 VAL n 1 84 GLY n 1 85 GLN n 1 86 ILE n 1 87 GLU n 1 88 GLN n 1 89 PRO n 1 90 THR n 1 91 ASP n 1 92 ARG n 1 93 GLN n 1 94 ARG n 1 95 LEU n 1 96 GLU n 1 97 GLN n 1 98 GLN n 1 99 ARG n 1 100 GLU n 1 101 ALA n 1 102 VAL n 1 103 ARG n 1 104 SER n 1 105 TYR n 1 106 GLN n 1 107 GLN n 1 108 ALA n 1 109 PHE n 1 110 SER n 1 111 GLU n 1 112 LEU n 1 113 LYS n 1 114 GLN n 1 115 ALA n 1 116 GLY n 1 117 GLN n 1 118 ARG n 1 119 ARG n 1 120 GLU n 1 121 ALA n 1 122 SER n 1 123 ARG n 1 124 GLY n 1 125 VAL n 1 126 LEU n 1 127 GLY n 1 128 ASP n 1 129 SER n 1 130 ALA n 1 131 ASP n 1 132 LYS n 1 133 ALA n 1 134 ALA n 1 135 GLU n 1 136 LEU n 1 137 ILE n 1 138 GLY n 1 139 ARG n 1 140 VAL n 1 141 GLN n 1 142 ARG n 1 143 GLY n 1 144 LEU n 1 145 LEU n 1 146 GLN n 1 147 GLY n 1 148 GLY n 1 149 ASP n 1 150 ILE n 1 151 SER n 1 152 GLN n 1 153 TYR n 1 154 GLN n 1 155 HIS n 1 156 ALA n 1 157 VAL n 1 158 GLU n 1 159 VAL n 1 160 SER n 1 161 ALA n 1 162 LEU n 1 163 LEU n 1 164 GLN n 1 165 GLN n 1 166 ALA n 1 167 ARG n 1 168 PHE n 1 169 GLN n 1 170 VAL n 1 171 ARG n 1 172 GLY n 1 173 TYR n 1 174 THR n 1 175 TYR n 1 176 SER n 1 177 GLY n 1 178 ASN n 1 179 ALA n 1 180 ASP n 1 181 PHE n 1 182 GLN n 1 183 GLN n 1 184 THR n 1 185 ALA n 1 186 LEU n 1 187 LYS n 1 188 ALA n 1 189 ILE n 1 190 ASP n 1 191 GLN n 1 192 ALA n 1 193 LEU n 1 194 ALA n 1 195 GLU n 1 196 LEU n 1 197 ARG n 1 198 ALA n 1 199 LEU n 1 200 PRO n 1 201 ALA n 1 202 LYS n 1 203 VAL n 1 204 PRO n 1 205 PRO n 1 206 GLU n 1 207 HIS n 1 208 ALA n 1 209 ALA n 1 210 SER n 1 211 LEU n 1 212 ASP n 1 213 ASP n 1 214 ALA n 1 215 THR n 1 216 THR n 1 217 ALA n 1 218 LEU n 1 219 GLY n 1 220 GLY n 1 221 TYR n 1 222 ARG n 1 223 ASP n 1 224 ALA n 1 225 VAL n 1 226 THR n 1 227 GLN n 1 228 PHE n 1 229 GLY n 1 230 ASN n 1 231 ALA n 1 232 GLN n 1 233 ALA n 1 234 THR n 1 235 SER n 1 236 GLU n 1 237 GLN n 1 238 ALA n 1 239 LEU n 1 240 GLN n 1 241 ARG n 1 242 MET n 1 243 ALA n 1 244 GLU n 1 245 GLN n 1 246 GLY n 1 247 THR n 1 248 VAL n 1 249 LEU n 1 250 LEU n 1 251 GLN n 1 252 THR n 1 253 SER n 1 254 GLN n 1 255 ALA n 1 256 MET n 1 257 THR n 1 258 LEU n 1 259 SER n 1 260 GLN n 1 261 THR n 1 262 GLU n 1 263 VAL n 1 264 ARG n 1 265 ASP n 1 266 ALA n 1 267 GLY n 1 268 ALA n 1 269 ALA n 1 270 GLN n 1 271 ALA n 1 272 LYS n 1 273 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 273 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas sp. SID14000' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1986221 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 15 ? ? ? A . n A 1 2 GLY 2 16 ? ? ? A . n A 1 3 SER 3 17 ? ? ? A . n A 1 4 SER 4 18 ? ? ? A . n A 1 5 HIS 5 19 ? ? ? A . n A 1 6 HIS 6 20 ? ? ? A . n A 1 7 HIS 7 21 ? ? ? A . n A 1 8 HIS 8 22 ? ? ? A . n A 1 9 HIS 9 23 ? ? ? A . n A 1 10 HIS 10 24 ? ? ? A . n A 1 11 SER 11 25 ? ? ? A . n A 1 12 SER 12 26 ? ? ? A . n A 1 13 GLY 13 27 ? ? ? A . n A 1 14 LEU 14 28 ? ? ? A . n A 1 15 VAL 15 29 ? ? ? A . n A 1 16 PRO 16 30 ? ? ? A . n A 1 17 ARG 17 31 ? ? ? A . n A 1 18 GLY 18 32 ? ? ? A . n A 1 19 SER 19 33 ? ? ? A . n A 1 20 HIS 20 34 ? ? ? A . n A 1 21 MET 21 35 ? ? ? A . n A 1 22 GLY 22 36 ? ? ? A . n A 1 23 TRP 23 37 ? ? ? A . n A 1 24 HIS 24 38 ? ? ? A . n A 1 25 GLY 25 39 ? ? ? A . n A 1 26 MET 26 40 40 MET MET A . n A 1 27 ASP 27 41 41 ASP ASP A . n A 1 28 SER 28 42 42 SER SER A . n A 1 29 ILE 29 43 43 ILE ILE A . n A 1 30 ILE 30 44 44 ILE ILE A . n A 1 31 ASP 31 45 45 ASP ASP A . n A 1 32 ARG 32 46 46 ARG ARG A . n A 1 33 GLY 33 47 47 GLY GLY A . n A 1 34 ASP 34 48 48 ASP ASP A . n A 1 35 LYS 35 49 49 LYS LYS A . n A 1 36 LEU 36 50 50 LEU LEU A . n A 1 37 GLY 37 51 51 GLY GLY A . n A 1 38 ASN 38 52 52 ASN ASN A . n A 1 39 ILE 39 53 53 ILE ILE A . n A 1 40 SER 40 54 54 SER SER A . n A 1 41 VAL 41 55 55 VAL VAL A . n A 1 42 ILE 42 56 56 ILE ILE A . n A 1 43 GLN 43 57 57 GLN GLN A . n A 1 44 GLN 44 58 58 GLN GLN A . n A 1 45 TYR 45 59 59 TYR TYR A . n A 1 46 THR 46 60 60 THR THR A . n A 1 47 GLN 47 61 61 GLN GLN A . n A 1 48 GLU 48 62 62 GLU GLU A . n A 1 49 LEU 49 63 63 LEU LEU A . n A 1 50 ARG 50 64 64 ARG ARG A . n A 1 51 ILE 51 65 65 ILE ILE A . n A 1 52 ALA 52 66 66 ALA ALA A . n A 1 53 ARG 53 67 67 ARG ARG A . n A 1 54 GLN 54 68 68 GLN GLN A . n A 1 55 HIS 55 69 69 HIS HIS A . n A 1 56 TYR 56 70 70 TYR TYR A . n A 1 57 GLN 57 71 71 GLN GLN A . n A 1 58 ARG 58 72 72 ARG ARG A . n A 1 59 GLN 59 73 73 GLN GLN A . n A 1 60 PRO 60 74 74 PRO PRO A . n A 1 61 ASP 61 75 75 ASP ASP A . n A 1 62 GLU 62 76 76 GLU GLU A . n A 1 63 THR 63 77 77 THR THR A . n A 1 64 SER 64 78 78 SER SER A . n A 1 65 VAL 65 79 79 VAL VAL A . n A 1 66 ALA 66 80 80 ALA ALA A . n A 1 67 GLU 67 81 81 GLU GLU A . n A 1 68 LEU 68 82 82 LEU LEU A . n A 1 69 GLU 69 83 83 GLU GLU A . n A 1 70 LYS 70 84 84 LYS LYS A . n A 1 71 ALA 71 85 85 ALA ALA A . n A 1 72 LEU 72 86 86 LEU LEU A . n A 1 73 GLY 73 87 87 GLY GLY A . n A 1 74 ASN 74 88 88 ASN ASN A . n A 1 75 LEU 75 89 89 LEU LEU A . n A 1 76 ASP 76 90 90 ASP ASP A . n A 1 77 ARG 77 91 91 ARG ARG A . n A 1 78 GLN 78 92 92 GLN GLN A . n A 1 79 VAL 79 93 93 VAL VAL A . n A 1 80 GLN 80 94 94 GLN GLN A . n A 1 81 LEU 81 95 95 LEU LEU A . n A 1 82 MET 82 96 96 MET MET A . n A 1 83 VAL 83 97 97 VAL VAL A . n A 1 84 GLY 84 98 98 GLY GLY A . n A 1 85 GLN 85 99 99 GLN GLN A . n A 1 86 ILE 86 100 100 ILE ILE A . n A 1 87 GLU 87 101 101 GLU GLU A . n A 1 88 GLN 88 102 102 GLN GLN A . n A 1 89 PRO 89 103 103 PRO PRO A . n A 1 90 THR 90 104 104 THR THR A . n A 1 91 ASP 91 105 105 ASP ASP A . n A 1 92 ARG 92 106 106 ARG ARG A . n A 1 93 GLN 93 107 107 GLN GLN A . n A 1 94 ARG 94 108 108 ARG ARG A . n A 1 95 LEU 95 109 109 LEU LEU A . n A 1 96 GLU 96 110 110 GLU GLU A . n A 1 97 GLN 97 111 111 GLN GLN A . n A 1 98 GLN 98 112 112 GLN GLN A . n A 1 99 ARG 99 113 113 ARG ARG A . n A 1 100 GLU 100 114 114 GLU GLU A . n A 1 101 ALA 101 115 115 ALA ALA A . n A 1 102 VAL 102 116 116 VAL VAL A . n A 1 103 ARG 103 117 117 ARG ARG A . n A 1 104 SER 104 118 118 SER SER A . n A 1 105 TYR 105 119 119 TYR TYR A . n A 1 106 GLN 106 120 120 GLN GLN A . n A 1 107 GLN 107 121 121 GLN GLN A . n A 1 108 ALA 108 122 122 ALA ALA A . n A 1 109 PHE 109 123 123 PHE PHE A . n A 1 110 SER 110 124 124 SER SER A . n A 1 111 GLU 111 125 125 GLU GLU A . n A 1 112 LEU 112 126 126 LEU LEU A . n A 1 113 LYS 113 127 127 LYS LYS A . n A 1 114 GLN 114 128 128 GLN GLN A . n A 1 115 ALA 115 129 129 ALA ALA A . n A 1 116 GLY 116 130 130 GLY GLY A . n A 1 117 GLN 117 131 131 GLN GLN A . n A 1 118 ARG 118 132 132 ARG ARG A . n A 1 119 ARG 119 133 133 ARG ARG A . n A 1 120 GLU 120 134 134 GLU GLU A . n A 1 121 ALA 121 135 135 ALA ALA A . n A 1 122 SER 122 136 136 SER SER A . n A 1 123 ARG 123 137 137 ARG ARG A . n A 1 124 GLY 124 138 138 GLY GLY A . n A 1 125 VAL 125 139 139 VAL VAL A . n A 1 126 LEU 126 140 140 LEU LEU A . n A 1 127 GLY 127 141 141 GLY GLY A . n A 1 128 ASP 128 142 142 ASP ASP A . n A 1 129 SER 129 143 143 SER SER A . n A 1 130 ALA 130 144 144 ALA ALA A . n A 1 131 ASP 131 145 145 ASP ASP A . n A 1 132 LYS 132 146 146 LYS LYS A . n A 1 133 ALA 133 147 147 ALA ALA A . n A 1 134 ALA 134 148 148 ALA ALA A . n A 1 135 GLU 135 149 149 GLU GLU A . n A 1 136 LEU 136 150 150 LEU LEU A . n A 1 137 ILE 137 151 151 ILE ILE A . n A 1 138 GLY 138 152 152 GLY GLY A . n A 1 139 ARG 139 153 153 ARG ARG A . n A 1 140 VAL 140 154 154 VAL VAL A . n A 1 141 GLN 141 155 155 GLN GLN A . n A 1 142 ARG 142 156 156 ARG ARG A . n A 1 143 GLY 143 157 157 GLY GLY A . n A 1 144 LEU 144 158 158 LEU LEU A . n A 1 145 LEU 145 159 159 LEU LEU A . n A 1 146 GLN 146 160 160 GLN GLN A . n A 1 147 GLY 147 161 161 GLY GLY A . n A 1 148 GLY 148 162 162 GLY GLY A . n A 1 149 ASP 149 163 163 ASP ASP A . n A 1 150 ILE 150 164 164 ILE ILE A . n A 1 151 SER 151 165 165 SER SER A . n A 1 152 GLN 152 166 166 GLN GLN A . n A 1 153 TYR 153 167 167 TYR TYR A . n A 1 154 GLN 154 168 168 GLN GLN A . n A 1 155 HIS 155 169 169 HIS HIS A . n A 1 156 ALA 156 170 170 ALA ALA A . n A 1 157 VAL 157 171 171 VAL VAL A . n A 1 158 GLU 158 172 172 GLU GLU A . n A 1 159 VAL 159 173 173 VAL VAL A . n A 1 160 SER 160 174 174 SER SER A . n A 1 161 ALA 161 175 175 ALA ALA A . n A 1 162 LEU 162 176 176 LEU LEU A . n A 1 163 LEU 163 177 177 LEU LEU A . n A 1 164 GLN 164 178 178 GLN GLN A . n A 1 165 GLN 165 179 179 GLN GLN A . n A 1 166 ALA 166 180 180 ALA ALA A . n A 1 167 ARG 167 181 181 ARG ARG A . n A 1 168 PHE 168 182 182 PHE PHE A . n A 1 169 GLN 169 183 183 GLN GLN A . n A 1 170 VAL 170 184 184 VAL VAL A . n A 1 171 ARG 171 185 185 ARG ARG A . n A 1 172 GLY 172 186 186 GLY GLY A . n A 1 173 TYR 173 187 187 TYR TYR A . n A 1 174 THR 174 188 188 THR THR A . n A 1 175 TYR 175 189 189 TYR TYR A . n A 1 176 SER 176 190 190 SER SER A . n A 1 177 GLY 177 191 191 GLY GLY A . n A 1 178 ASN 178 192 192 ASN ASN A . n A 1 179 ALA 179 193 193 ALA ALA A . n A 1 180 ASP 180 194 194 ASP ASP A . n A 1 181 PHE 181 195 195 PHE PHE A . n A 1 182 GLN 182 196 196 GLN GLN A . n A 1 183 GLN 183 197 197 GLN GLN A . n A 1 184 THR 184 198 198 THR THR A . n A 1 185 ALA 185 199 199 ALA ALA A . n A 1 186 LEU 186 200 200 LEU LEU A . n A 1 187 LYS 187 201 201 LYS LYS A . n A 1 188 ALA 188 202 202 ALA ALA A . n A 1 189 ILE 189 203 203 ILE ILE A . n A 1 190 ASP 190 204 204 ASP ASP A . n A 1 191 GLN 191 205 205 GLN GLN A . n A 1 192 ALA 192 206 206 ALA ALA A . n A 1 193 LEU 193 207 207 LEU LEU A . n A 1 194 ALA 194 208 208 ALA ALA A . n A 1 195 GLU 195 209 209 GLU GLU A . n A 1 196 LEU 196 210 210 LEU LEU A . n A 1 197 ARG 197 211 211 ARG ARG A . n A 1 198 ALA 198 212 212 ALA ALA A . n A 1 199 LEU 199 213 213 LEU LEU A . n A 1 200 PRO 200 214 214 PRO PRO A . n A 1 201 ALA 201 215 215 ALA ALA A . n A 1 202 LYS 202 216 216 LYS LYS A . n A 1 203 VAL 203 217 217 VAL VAL A . n A 1 204 PRO 204 218 218 PRO PRO A . n A 1 205 PRO 205 219 219 PRO PRO A . n A 1 206 GLU 206 220 220 GLU GLU A . n A 1 207 HIS 207 221 221 HIS HIS A . n A 1 208 ALA 208 222 222 ALA ALA A . n A 1 209 ALA 209 223 223 ALA ALA A . n A 1 210 SER 210 224 224 SER SER A . n A 1 211 LEU 211 225 225 LEU LEU A . n A 1 212 ASP 212 226 226 ASP ASP A . n A 1 213 ASP 213 227 227 ASP ASP A . n A 1 214 ALA 214 228 228 ALA ALA A . n A 1 215 THR 215 229 229 THR THR A . n A 1 216 THR 216 230 230 THR THR A . n A 1 217 ALA 217 231 231 ALA ALA A . n A 1 218 LEU 218 232 232 LEU LEU A . n A 1 219 GLY 219 233 233 GLY GLY A . n A 1 220 GLY 220 234 234 GLY GLY A . n A 1 221 TYR 221 235 235 TYR TYR A . n A 1 222 ARG 222 236 236 ARG ARG A . n A 1 223 ASP 223 237 237 ASP ASP A . n A 1 224 ALA 224 238 238 ALA ALA A . n A 1 225 VAL 225 239 239 VAL VAL A . n A 1 226 THR 226 240 240 THR THR A . n A 1 227 GLN 227 241 241 GLN GLN A . n A 1 228 PHE 228 242 242 PHE PHE A . n A 1 229 GLY 229 243 243 GLY GLY A . n A 1 230 ASN 230 244 244 ASN ASN A . n A 1 231 ALA 231 245 245 ALA ALA A . n A 1 232 GLN 232 246 246 GLN GLN A . n A 1 233 ALA 233 247 247 ALA ALA A . n A 1 234 THR 234 248 248 THR THR A . n A 1 235 SER 235 249 249 SER SER A . n A 1 236 GLU 236 250 250 GLU GLU A . n A 1 237 GLN 237 251 251 GLN GLN A . n A 1 238 ALA 238 252 252 ALA ALA A . n A 1 239 LEU 239 253 253 LEU LEU A . n A 1 240 GLN 240 254 254 GLN GLN A . n A 1 241 ARG 241 255 255 ARG ARG A . n A 1 242 MET 242 256 256 MET MET A . n A 1 243 ALA 243 257 257 ALA ALA A . n A 1 244 GLU 244 258 258 GLU GLU A . n A 1 245 GLN 245 259 259 GLN GLN A . n A 1 246 GLY 246 260 260 GLY GLY A . n A 1 247 THR 247 261 261 THR THR A . n A 1 248 VAL 248 262 262 VAL VAL A . n A 1 249 LEU 249 263 263 LEU LEU A . n A 1 250 LEU 250 264 264 LEU LEU A . n A 1 251 GLN 251 265 265 GLN GLN A . n A 1 252 THR 252 266 266 THR THR A . n A 1 253 SER 253 267 267 SER SER A . n A 1 254 GLN 254 268 268 GLN GLN A . n A 1 255 ALA 255 269 269 ALA ALA A . n A 1 256 MET 256 270 ? ? ? A . n A 1 257 THR 257 271 ? ? ? A . n A 1 258 LEU 258 272 ? ? ? A . n A 1 259 SER 259 273 ? ? ? A . n A 1 260 GLN 260 274 ? ? ? A . n A 1 261 THR 261 275 ? ? ? A . n A 1 262 GLU 262 276 ? ? ? A . n A 1 263 VAL 263 277 ? ? ? A . n A 1 264 ARG 264 278 ? ? ? A . n A 1 265 ASP 265 279 ? ? ? A . n A 1 266 ALA 266 280 ? ? ? A . n A 1 267 GLY 267 281 ? ? ? A . n A 1 268 ALA 268 282 ? ? ? A . n A 1 269 ALA 269 283 ? ? ? A . n A 1 270 GLN 270 284 ? ? ? A . n A 1 271 ALA 271 285 ? ? ? A . n A 1 272 LYS 272 286 ? ? ? A . n A 1 273 THR 273 287 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CIT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CIT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CIT 1 301 315 CIT CIT A . C 3 HOH 1 401 2 HOH HOH A . C 3 HOH 2 402 3 HOH HOH A . C 3 HOH 3 403 1 HOH HOH A . C 3 HOH 4 404 4 HOH HOH A . C 3 HOH 5 405 5 HOH HOH A . C 3 HOH 6 406 6 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21.2_5419: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9SOU _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.195 _cell.length_a_esd ? _cell.length_b 59.837 _cell.length_b_esd ? _cell.length_c 123.164 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9SOU _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9SOU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.8 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.6 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Magnesium chloride hexahydrate, 0.1 M of Tris-HCl pH 8.5, 30% w/v PEG 4K' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-05-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9SOU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 123.16 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13505 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.99 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.120 _reflns.pdbx_Rpim_I_all 0.047 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 86944 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.110 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 8568 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1278 _reflns_shell.percent_possible_obs 99.9 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.7 _reflns_shell.pdbx_chi_squared 1.01 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.3 _reflns_shell.pdbx_Rrim_I_all 1.964 _reflns_shell.pdbx_Rpim_I_all 0.753 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.624 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.812 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9SOU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 53.82 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13418 _refine.ls_number_reflns_R_free 701 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.39 _refine.ls_percent_reflns_R_free 5.22 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2863 _refine.ls_R_factor_R_free 0.3285 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2840 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 41.36 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.34 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1785 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1804 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 53.82 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1840 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.858 ? 2486 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 22.240 ? 712 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 273 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 343 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.48 . . 148 2468 100.00 . . . . 0.3670 . . . . . . . . . . . . . . . 0.3900 'X-RAY DIFFRACTION' 2.48 2.73 . . 128 2508 100.00 . . . . 0.3331 . . . . . . . . . . . . . . . 0.3826 'X-RAY DIFFRACTION' 2.73 3.12 . . 132 2505 99.00 . . . . 0.3132 . . . . . . . . . . . . . . . 0.4393 'X-RAY DIFFRACTION' 3.12 3.93 . . 157 2555 100.00 . . . . 0.2867 . . . . . . . . . . . . . . . 0.2865 'X-RAY DIFFRACTION' 3.93 53.82 . . 136 2681 99.00 . . . . 0.2555 . . . . . . . . . . . . . . . 0.3068 # _struct.entry_id 9SOU _struct.title 'Structure of the ligand binding domain of the ancestral reconstructed Pseudomonas chemoreceptor aPcpI in complex with citrate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9SOU _struct_keywords.text 'Chemotactic transducer, CHEMORECEPTOR, Signaling protein, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9SOU _struct_ref.pdbx_db_accession 9SOU _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9SOU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 273 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9SOU _struct_ref_seq.db_align_beg 15 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 287 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 15 _struct_ref_seq.pdbx_auth_seq_align_end 287 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 400 ? 1 MORE 2 ? 1 'SSA (A^2)' 13040 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 26 ? GLY A 33 ? MET A 40 GLY A 47 1 ? 8 HELX_P HELX_P2 AA2 ASP A 34 ? GLN A 59 ? ASP A 48 GLN A 73 1 ? 26 HELX_P HELX_P3 AA3 ASP A 61 ? MET A 82 ? ASP A 75 MET A 96 1 ? 22 HELX_P HELX_P4 AA4 GLN A 88 ? GLY A 148 ? GLN A 102 GLY A 162 1 ? 61 HELX_P HELX_P5 AA5 ASP A 149 ? GLY A 177 ? ASP A 163 GLY A 191 1 ? 29 HELX_P HELX_P6 AA6 ASN A 178 ? ASP A 180 ? ASN A 192 ASP A 194 5 ? 3 HELX_P HELX_P7 AA7 PHE A 181 ? LEU A 199 ? PHE A 195 LEU A 213 1 ? 19 HELX_P HELX_P8 AA8 PRO A 200 ? VAL A 203 ? PRO A 214 VAL A 217 5 ? 4 HELX_P HELX_P9 AA9 PRO A 204 ? GLU A 206 ? PRO A 218 GLU A 220 5 ? 3 HELX_P HELX_P10 AB1 HIS A 207 ? GLN A 254 ? HIS A 221 GLN A 268 1 ? 48 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9SOU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 73 ? ? -150.91 89.99 2 1 ASP A 75 ? ? -106.32 -167.63 3 1 GLU A 101 ? ? -133.97 -34.05 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 401 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 9.4708 15.3183 4.1701 0.1931 ? 0.2103 ? -0.0153 ? 0.7187 ? 0.0442 ? 0.4868 ? 1.3207 ? 0.7757 ? -1.5183 ? 1.6187 ? -0.1008 ? 4.1862 ? 0.0575 ? -0.2554 ? -0.0802 ? 0.2412 ? -0.0643 ? -0.0407 ? 0.2089 ? 0.6267 ? -0.1168 ? 2 'X-RAY DIFFRACTION' ? refined 2.9779 17.6117 25.6842 0.8237 ? -0.1148 ? -0.0045 ? 0.4827 ? 0.0094 ? 0.4667 ? 0.9430 ? -0.0091 ? -0.1395 ? 1.8838 ? -0.3701 ? 3.7093 ? 0.0675 ? 0.2801 ? 0.2722 ? 0.8752 ? -0.0205 ? -0.0777 ? -0.5236 ? -0.1496 ? -0.2755 ? 3 'X-RAY DIFFRACTION' ? refined -3.8362 10.9686 43.2415 2.0391 ? -0.0031 ? 0.1719 ? 0.6217 ? -0.0856 ? 0.2935 ? 0.1206 ? -0.0337 ? -0.1734 ? 0.4146 ? -1.0685 ? 2.3644 ? -0.1577 ? -0.0220 ? 0.1834 ? 1.5446 ? -0.0474 ? 0.1746 ? 0.0856 ? -0.4634 ? 0.0933 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 40 through 95 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 96 through 161 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 162 through 269 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 15 ? A MET 1 2 1 Y 1 A GLY 16 ? A GLY 2 3 1 Y 1 A SER 17 ? A SER 3 4 1 Y 1 A SER 18 ? A SER 4 5 1 Y 1 A HIS 19 ? A HIS 5 6 1 Y 1 A HIS 20 ? A HIS 6 7 1 Y 1 A HIS 21 ? A HIS 7 8 1 Y 1 A HIS 22 ? A HIS 8 9 1 Y 1 A HIS 23 ? A HIS 9 10 1 Y 1 A HIS 24 ? A HIS 10 11 1 Y 1 A SER 25 ? A SER 11 12 1 Y 1 A SER 26 ? A SER 12 13 1 Y 1 A GLY 27 ? A GLY 13 14 1 Y 1 A LEU 28 ? A LEU 14 15 1 Y 1 A VAL 29 ? A VAL 15 16 1 Y 1 A PRO 30 ? A PRO 16 17 1 Y 1 A ARG 31 ? A ARG 17 18 1 Y 1 A GLY 32 ? A GLY 18 19 1 Y 1 A SER 33 ? A SER 19 20 1 Y 1 A HIS 34 ? A HIS 20 21 1 Y 1 A MET 35 ? A MET 21 22 1 Y 1 A GLY 36 ? A GLY 22 23 1 Y 1 A TRP 37 ? A TRP 23 24 1 Y 1 A HIS 38 ? A HIS 24 25 1 Y 1 A GLY 39 ? A GLY 25 26 1 Y 1 A MET 270 ? A MET 256 27 1 Y 1 A THR 271 ? A THR 257 28 1 Y 1 A LEU 272 ? A LEU 258 29 1 Y 1 A SER 273 ? A SER 259 30 1 Y 1 A GLN 274 ? A GLN 260 31 1 Y 1 A THR 275 ? A THR 261 32 1 Y 1 A GLU 276 ? A GLU 262 33 1 Y 1 A VAL 277 ? A VAL 263 34 1 Y 1 A ARG 278 ? A ARG 264 35 1 Y 1 A ASP 279 ? A ASP 265 36 1 Y 1 A ALA 280 ? A ALA 266 37 1 Y 1 A GLY 281 ? A GLY 267 38 1 Y 1 A ALA 282 ? A ALA 268 39 1 Y 1 A ALA 283 ? A ALA 269 40 1 Y 1 A GLN 284 ? A GLN 270 41 1 Y 1 A ALA 285 ? A ALA 271 42 1 Y 1 A LYS 286 ? A LYS 272 43 1 Y 1 A THR 287 ? A THR 273 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CIT C1 C N N 74 CIT O1 O N N 75 CIT O2 O N N 76 CIT C2 C N N 77 CIT C3 C N N 78 CIT O7 O N N 79 CIT C4 C N N 80 CIT C5 C N N 81 CIT O3 O N N 82 CIT O4 O N N 83 CIT C6 C N N 84 CIT O5 O N N 85 CIT O6 O N N 86 CIT HO2 H N N 87 CIT H21 H N N 88 CIT H22 H N N 89 CIT HO7 H N N 90 CIT H41 H N N 91 CIT H42 H N N 92 CIT HO4 H N N 93 CIT HO6 H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CIT C1 O1 doub N N 70 CIT C1 O2 sing N N 71 CIT C1 C2 sing N N 72 CIT O2 HO2 sing N N 73 CIT C2 C3 sing N N 74 CIT C2 H21 sing N N 75 CIT C2 H22 sing N N 76 CIT C3 O7 sing N N 77 CIT C3 C4 sing N N 78 CIT C3 C6 sing N N 79 CIT O7 HO7 sing N N 80 CIT C4 C5 sing N N 81 CIT C4 H41 sing N N 82 CIT C4 H42 sing N N 83 CIT C5 O3 doub N N 84 CIT C5 O4 sing N N 85 CIT O4 HO4 sing N N 86 CIT C6 O5 doub N N 87 CIT C6 O6 sing N N 88 CIT O6 HO6 sing N N 89 GLN N CA sing N N 90 GLN N H sing N N 91 GLN N H2 sing N N 92 GLN CA C sing N N 93 GLN CA CB sing N N 94 GLN CA HA sing N N 95 GLN C O doub N N 96 GLN C OXT sing N N 97 GLN CB CG sing N N 98 GLN CB HB2 sing N N 99 GLN CB HB3 sing N N 100 GLN CG CD sing N N 101 GLN CG HG2 sing N N 102 GLN CG HG3 sing N N 103 GLN CD OE1 doub N N 104 GLN CD NE2 sing N N 105 GLN NE2 HE21 sing N N 106 GLN NE2 HE22 sing N N 107 GLN OXT HXT sing N N 108 GLU N CA sing N N 109 GLU N H sing N N 110 GLU N H2 sing N N 111 GLU CA C sing N N 112 GLU CA CB sing N N 113 GLU CA HA sing N N 114 GLU C O doub N N 115 GLU C OXT sing N N 116 GLU CB CG sing N N 117 GLU CB HB2 sing N N 118 GLU CB HB3 sing N N 119 GLU CG CD sing N N 120 GLU CG HG2 sing N N 121 GLU CG HG3 sing N N 122 GLU CD OE1 doub N N 123 GLU CD OE2 sing N N 124 GLU OE2 HE2 sing N N 125 GLU OXT HXT sing N N 126 GLY N CA sing N N 127 GLY N H sing N N 128 GLY N H2 sing N N 129 GLY CA C sing N N 130 GLY CA HA2 sing N N 131 GLY CA HA3 sing N N 132 GLY C O doub N N 133 GLY C OXT sing N N 134 GLY OXT HXT sing N N 135 HIS N CA sing N N 136 HIS N H sing N N 137 HIS N H2 sing N N 138 HIS CA C sing N N 139 HIS CA CB sing N N 140 HIS CA HA sing N N 141 HIS C O doub N N 142 HIS C OXT sing N N 143 HIS CB CG sing N N 144 HIS CB HB2 sing N N 145 HIS CB HB3 sing N N 146 HIS CG ND1 sing Y N 147 HIS CG CD2 doub Y N 148 HIS ND1 CE1 doub Y N 149 HIS ND1 HD1 sing N N 150 HIS CD2 NE2 sing Y N 151 HIS CD2 HD2 sing N N 152 HIS CE1 NE2 sing Y N 153 HIS CE1 HE1 sing N N 154 HIS NE2 HE2 sing N N 155 HIS OXT HXT sing N N 156 HOH O H1 sing N N 157 HOH O H2 sing N N 158 ILE N CA sing N N 159 ILE N H sing N N 160 ILE N H2 sing N N 161 ILE CA C sing N N 162 ILE CA CB sing N N 163 ILE CA HA sing N N 164 ILE C O doub N N 165 ILE C OXT sing N N 166 ILE CB CG1 sing N N 167 ILE CB CG2 sing N N 168 ILE CB HB sing N N 169 ILE CG1 CD1 sing N N 170 ILE CG1 HG12 sing N N 171 ILE CG1 HG13 sing N N 172 ILE CG2 HG21 sing N N 173 ILE CG2 HG22 sing N N 174 ILE CG2 HG23 sing N N 175 ILE CD1 HD11 sing N N 176 ILE CD1 HD12 sing N N 177 ILE CD1 HD13 sing N N 178 ILE OXT HXT sing N N 179 LEU N CA sing N N 180 LEU N H sing N N 181 LEU N H2 sing N N 182 LEU CA C sing N N 183 LEU CA CB sing N N 184 LEU CA HA sing N N 185 LEU C O doub N N 186 LEU C OXT sing N N 187 LEU CB CG sing N N 188 LEU CB HB2 sing N N 189 LEU CB HB3 sing N N 190 LEU CG CD1 sing N N 191 LEU CG CD2 sing N N 192 LEU CG HG sing N N 193 LEU CD1 HD11 sing N N 194 LEU CD1 HD12 sing N N 195 LEU CD1 HD13 sing N N 196 LEU CD2 HD21 sing N N 197 LEU CD2 HD22 sing N N 198 LEU CD2 HD23 sing N N 199 LEU OXT HXT sing N N 200 LYS N CA sing N N 201 LYS N H sing N N 202 LYS N H2 sing N N 203 LYS CA C sing N N 204 LYS CA CB sing N N 205 LYS CA HA sing N N 206 LYS C O doub N N 207 LYS C OXT sing N N 208 LYS CB CG sing N N 209 LYS CB HB2 sing N N 210 LYS CB HB3 sing N N 211 LYS CG CD sing N N 212 LYS CG HG2 sing N N 213 LYS CG HG3 sing N N 214 LYS CD CE sing N N 215 LYS CD HD2 sing N N 216 LYS CD HD3 sing N N 217 LYS CE NZ sing N N 218 LYS CE HE2 sing N N 219 LYS CE HE3 sing N N 220 LYS NZ HZ1 sing N N 221 LYS NZ HZ2 sing N N 222 LYS NZ HZ3 sing N N 223 LYS OXT HXT sing N N 224 MET N CA sing N N 225 MET N H sing N N 226 MET N H2 sing N N 227 MET CA C sing N N 228 MET CA CB sing N N 229 MET CA HA sing N N 230 MET C O doub N N 231 MET C OXT sing N N 232 MET CB CG sing N N 233 MET CB HB2 sing N N 234 MET CB HB3 sing N N 235 MET CG SD sing N N 236 MET CG HG2 sing N N 237 MET CG HG3 sing N N 238 MET SD CE sing N N 239 MET CE HE1 sing N N 240 MET CE HE2 sing N N 241 MET CE HE3 sing N N 242 MET OXT HXT sing N N 243 PHE N CA sing N N 244 PHE N H sing N N 245 PHE N H2 sing N N 246 PHE CA C sing N N 247 PHE CA CB sing N N 248 PHE CA HA sing N N 249 PHE C O doub N N 250 PHE C OXT sing N N 251 PHE CB CG sing N N 252 PHE CB HB2 sing N N 253 PHE CB HB3 sing N N 254 PHE CG CD1 doub Y N 255 PHE CG CD2 sing Y N 256 PHE CD1 CE1 sing Y N 257 PHE CD1 HD1 sing N N 258 PHE CD2 CE2 doub Y N 259 PHE CD2 HD2 sing N N 260 PHE CE1 CZ doub Y N 261 PHE CE1 HE1 sing N N 262 PHE CE2 CZ sing Y N 263 PHE CE2 HE2 sing N N 264 PHE CZ HZ sing N N 265 PHE OXT HXT sing N N 266 PRO N CA sing N N 267 PRO N CD sing N N 268 PRO N H sing N N 269 PRO CA C sing N N 270 PRO CA CB sing N N 271 PRO CA HA sing N N 272 PRO C O doub N N 273 PRO C OXT sing N N 274 PRO CB CG sing N N 275 PRO CB HB2 sing N N 276 PRO CB HB3 sing N N 277 PRO CG CD sing N N 278 PRO CG HG2 sing N N 279 PRO CG HG3 sing N N 280 PRO CD HD2 sing N N 281 PRO CD HD3 sing N N 282 PRO OXT HXT sing N N 283 SER N CA sing N N 284 SER N H sing N N 285 SER N H2 sing N N 286 SER CA C sing N N 287 SER CA CB sing N N 288 SER CA HA sing N N 289 SER C O doub N N 290 SER C OXT sing N N 291 SER CB OG sing N N 292 SER CB HB2 sing N N 293 SER CB HB3 sing N N 294 SER OG HG sing N N 295 SER OXT HXT sing N N 296 THR N CA sing N N 297 THR N H sing N N 298 THR N H2 sing N N 299 THR CA C sing N N 300 THR CA CB sing N N 301 THR CA HA sing N N 302 THR C O doub N N 303 THR C OXT sing N N 304 THR CB OG1 sing N N 305 THR CB CG2 sing N N 306 THR CB HB sing N N 307 THR OG1 HG1 sing N N 308 THR CG2 HG21 sing N N 309 THR CG2 HG22 sing N N 310 THR CG2 HG23 sing N N 311 THR OXT HXT sing N N 312 TRP N CA sing N N 313 TRP N H sing N N 314 TRP N H2 sing N N 315 TRP CA C sing N N 316 TRP CA CB sing N N 317 TRP CA HA sing N N 318 TRP C O doub N N 319 TRP C OXT sing N N 320 TRP CB CG sing N N 321 TRP CB HB2 sing N N 322 TRP CB HB3 sing N N 323 TRP CG CD1 doub Y N 324 TRP CG CD2 sing Y N 325 TRP CD1 NE1 sing Y N 326 TRP CD1 HD1 sing N N 327 TRP CD2 CE2 doub Y N 328 TRP CD2 CE3 sing Y N 329 TRP NE1 CE2 sing Y N 330 TRP NE1 HE1 sing N N 331 TRP CE2 CZ2 sing Y N 332 TRP CE3 CZ3 doub Y N 333 TRP CE3 HE3 sing N N 334 TRP CZ2 CH2 doub Y N 335 TRP CZ2 HZ2 sing N N 336 TRP CZ3 CH2 sing Y N 337 TRP CZ3 HZ3 sing N N 338 TRP CH2 HH2 sing N N 339 TRP OXT HXT sing N N 340 TYR N CA sing N N 341 TYR N H sing N N 342 TYR N H2 sing N N 343 TYR CA C sing N N 344 TYR CA CB sing N N 345 TYR CA HA sing N N 346 TYR C O doub N N 347 TYR C OXT sing N N 348 TYR CB CG sing N N 349 TYR CB HB2 sing N N 350 TYR CB HB3 sing N N 351 TYR CG CD1 doub Y N 352 TYR CG CD2 sing Y N 353 TYR CD1 CE1 sing Y N 354 TYR CD1 HD1 sing N N 355 TYR CD2 CE2 doub Y N 356 TYR CD2 HD2 sing N N 357 TYR CE1 CZ doub Y N 358 TYR CE1 HE1 sing N N 359 TYR CE2 CZ sing Y N 360 TYR CE2 HE2 sing N N 361 TYR CZ OH sing N N 362 TYR OH HH sing N N 363 TYR OXT HXT sing N N 364 VAL N CA sing N N 365 VAL N H sing N N 366 VAL N H2 sing N N 367 VAL CA C sing N N 368 VAL CA CB sing N N 369 VAL CA HA sing N N 370 VAL C O doub N N 371 VAL C OXT sing N N 372 VAL CB CG1 sing N N 373 VAL CB CG2 sing N N 374 VAL CB HB sing N N 375 VAL CG1 HG11 sing N N 376 VAL CG1 HG12 sing N N 377 VAL CG1 HG13 sing N N 378 VAL CG2 HG21 sing N N 379 VAL CG2 HG22 sing N N 380 VAL CG2 HG23 sing N N 381 VAL OXT HXT sing N N 382 # _pdbx_audit_support.funding_organization 'Ministerio de Ciencia e Innovacion (MCIN)' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number PID2023-146281NB-I00 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9SOU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.025513 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016712 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008119 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #