data_9SR5 # _entry.id 9SR5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9SR5 pdb_00009sr5 10.2210/pdb9sr5/pdb WWPDB D_1292151009 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-07 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9SR5 _pdbx_database_status.recvd_initial_deposition_date 2025-09-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email thilo.stehle@uni-tuebingen.de _pdbx_contact_author.name_first Thilo _pdbx_contact_author.name_last Stehle _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4571-8548 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Voelpel, S.V.' 1 0000-0001-7506-3784 'Stehle, T.' 2 0000-0002-4571-8548 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of the NlpC/P60 Peptidase YkfC from Bacillus subtilis' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Voelpel, S.V.' 1 0000-0001-7506-3784 primary 'Mayer, C.' 2 0000-0003-4731-4851 primary 'Stehle, T.' 3 0000-0002-4571-8548 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase' 35033.953 1 3.4.14.13 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 207.290 2 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 5 non-polymer syn GLYCEROL 92.094 5 ? ? ? ? 6 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cell wall endopeptidase YkfC' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MMHTVISAVANIWTAPDSPRPSDQFMLQPTVMIRDWLERMTYDERLGLCTDNVIQTQVLFGEKVLVTAEQGEWVSVIVPS QPSRKDPRGYPGWMKKYQLEKTKPIHTQHDVMISKPAAFLYRSNGEKEIELSFLTVLPLIAKENGYFKVSTVFGERFVRQ SDAVPVSQQKGTAEDIIQTGAFFLGLPYLWGGISGFGFD(OCS)SGFMYSIFKANGYSIPRDAGDQAKAGKGVPLDDMKA GDLLFFAYEEGKGAIHHVGLYVGGGKMLHSPKTGKSIEILTLTETIYEKELCAVRRCFSEENLYFQGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MMHTVISAVANIWTAPDSPRPSDQFMLQPTVMIRDWLERMTYDERLGLCTDNVIQTQVLFGEKVLVTAEQGEWVSVIVPS QPSRKDPRGYPGWMKKYQLEKTKPIHTQHDVMISKPAAFLYRSNGEKEIELSFLTVLPLIAKENGYFKVSTVFGERFVRQ SDAVPVSQQKGTAEDIIQTGAFFLGLPYLWGGISGFGFDCSGFMYSIFKANGYSIPRDAGDQAKAGKGVPLDDMKAGDLL FFAYEEGKGAIHHVGLYVGGGKMLHSPKTGKSIEILTLTETIYEKELCAVRRCFSEENLYFQGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' NHE 4 'SULFATE ION' SO4 5 GLYCEROL GOL 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 HIS n 1 4 THR n 1 5 VAL n 1 6 ILE n 1 7 SER n 1 8 ALA n 1 9 VAL n 1 10 ALA n 1 11 ASN n 1 12 ILE n 1 13 TRP n 1 14 THR n 1 15 ALA n 1 16 PRO n 1 17 ASP n 1 18 SER n 1 19 PRO n 1 20 ARG n 1 21 PRO n 1 22 SER n 1 23 ASP n 1 24 GLN n 1 25 PHE n 1 26 MET n 1 27 LEU n 1 28 GLN n 1 29 PRO n 1 30 THR n 1 31 VAL n 1 32 MET n 1 33 ILE n 1 34 ARG n 1 35 ASP n 1 36 TRP n 1 37 LEU n 1 38 GLU n 1 39 ARG n 1 40 MET n 1 41 THR n 1 42 TYR n 1 43 ASP n 1 44 GLU n 1 45 ARG n 1 46 LEU n 1 47 GLY n 1 48 LEU n 1 49 CYS n 1 50 THR n 1 51 ASP n 1 52 ASN n 1 53 VAL n 1 54 ILE n 1 55 GLN n 1 56 THR n 1 57 GLN n 1 58 VAL n 1 59 LEU n 1 60 PHE n 1 61 GLY n 1 62 GLU n 1 63 LYS n 1 64 VAL n 1 65 LEU n 1 66 VAL n 1 67 THR n 1 68 ALA n 1 69 GLU n 1 70 GLN n 1 71 GLY n 1 72 GLU n 1 73 TRP n 1 74 VAL n 1 75 SER n 1 76 VAL n 1 77 ILE n 1 78 VAL n 1 79 PRO n 1 80 SER n 1 81 GLN n 1 82 PRO n 1 83 SER n 1 84 ARG n 1 85 LYS n 1 86 ASP n 1 87 PRO n 1 88 ARG n 1 89 GLY n 1 90 TYR n 1 91 PRO n 1 92 GLY n 1 93 TRP n 1 94 MET n 1 95 LYS n 1 96 LYS n 1 97 TYR n 1 98 GLN n 1 99 LEU n 1 100 GLU n 1 101 LYS n 1 102 THR n 1 103 LYS n 1 104 PRO n 1 105 ILE n 1 106 HIS n 1 107 THR n 1 108 GLN n 1 109 HIS n 1 110 ASP n 1 111 VAL n 1 112 MET n 1 113 ILE n 1 114 SER n 1 115 LYS n 1 116 PRO n 1 117 ALA n 1 118 ALA n 1 119 PHE n 1 120 LEU n 1 121 TYR n 1 122 ARG n 1 123 SER n 1 124 ASN n 1 125 GLY n 1 126 GLU n 1 127 LYS n 1 128 GLU n 1 129 ILE n 1 130 GLU n 1 131 LEU n 1 132 SER n 1 133 PHE n 1 134 LEU n 1 135 THR n 1 136 VAL n 1 137 LEU n 1 138 PRO n 1 139 LEU n 1 140 ILE n 1 141 ALA n 1 142 LYS n 1 143 GLU n 1 144 ASN n 1 145 GLY n 1 146 TYR n 1 147 PHE n 1 148 LYS n 1 149 VAL n 1 150 SER n 1 151 THR n 1 152 VAL n 1 153 PHE n 1 154 GLY n 1 155 GLU n 1 156 ARG n 1 157 PHE n 1 158 VAL n 1 159 ARG n 1 160 GLN n 1 161 SER n 1 162 ASP n 1 163 ALA n 1 164 VAL n 1 165 PRO n 1 166 VAL n 1 167 SER n 1 168 GLN n 1 169 GLN n 1 170 LYS n 1 171 GLY n 1 172 THR n 1 173 ALA n 1 174 GLU n 1 175 ASP n 1 176 ILE n 1 177 ILE n 1 178 GLN n 1 179 THR n 1 180 GLY n 1 181 ALA n 1 182 PHE n 1 183 PHE n 1 184 LEU n 1 185 GLY n 1 186 LEU n 1 187 PRO n 1 188 TYR n 1 189 LEU n 1 190 TRP n 1 191 GLY n 1 192 GLY n 1 193 ILE n 1 194 SER n 1 195 GLY n 1 196 PHE n 1 197 GLY n 1 198 PHE n 1 199 ASP n 1 200 OCS n 1 201 SER n 1 202 GLY n 1 203 PHE n 1 204 MET n 1 205 TYR n 1 206 SER n 1 207 ILE n 1 208 PHE n 1 209 LYS n 1 210 ALA n 1 211 ASN n 1 212 GLY n 1 213 TYR n 1 214 SER n 1 215 ILE n 1 216 PRO n 1 217 ARG n 1 218 ASP n 1 219 ALA n 1 220 GLY n 1 221 ASP n 1 222 GLN n 1 223 ALA n 1 224 LYS n 1 225 ALA n 1 226 GLY n 1 227 LYS n 1 228 GLY n 1 229 VAL n 1 230 PRO n 1 231 LEU n 1 232 ASP n 1 233 ASP n 1 234 MET n 1 235 LYS n 1 236 ALA n 1 237 GLY n 1 238 ASP n 1 239 LEU n 1 240 LEU n 1 241 PHE n 1 242 PHE n 1 243 ALA n 1 244 TYR n 1 245 GLU n 1 246 GLU n 1 247 GLY n 1 248 LYS n 1 249 GLY n 1 250 ALA n 1 251 ILE n 1 252 HIS n 1 253 HIS n 1 254 VAL n 1 255 GLY n 1 256 LEU n 1 257 TYR n 1 258 VAL n 1 259 GLY n 1 260 GLY n 1 261 GLY n 1 262 LYS n 1 263 MET n 1 264 LEU n 1 265 HIS n 1 266 SER n 1 267 PRO n 1 268 LYS n 1 269 THR n 1 270 GLY n 1 271 LYS n 1 272 SER n 1 273 ILE n 1 274 GLU n 1 275 ILE n 1 276 LEU n 1 277 THR n 1 278 LEU n 1 279 THR n 1 280 GLU n 1 281 THR n 1 282 ILE n 1 283 TYR n 1 284 GLU n 1 285 LYS n 1 286 GLU n 1 287 LEU n 1 288 CYS n 1 289 ALA n 1 290 VAL n 1 291 ARG n 1 292 ARG n 1 293 CYS n 1 294 PHE n 1 295 SER n 1 296 GLU n 1 297 GLU n 1 298 ASN n 1 299 LEU n 1 300 TYR n 1 301 PHE n 1 302 GLN n 1 303 GLY n 1 304 LEU n 1 305 GLU n 1 306 HIS n 1 307 HIS n 1 308 HIS n 1 309 HIS n 1 310 HIS n 1 311 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ykfC, BSU12990' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis subsp. subtilis str. 168' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NHE non-polymer . '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 'N-CYCLOHEXYLTAURINE; CHES' 'C8 H17 N O3 S' 207.290 OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ? 'C3 H7 N O5 S' 169.156 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 TRP 190 190 190 TRP TRP A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 OCS 200 200 200 OCS OCS A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 MET 234 234 234 MET MET A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 PHE 241 241 241 PHE PHE A . n A 1 242 PHE 242 242 242 PHE PHE A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 GLY 247 247 247 GLY GLY A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 ILE 251 251 251 ILE ILE A . n A 1 252 HIS 252 252 252 HIS HIS A . n A 1 253 HIS 253 253 253 HIS HIS A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 MET 263 263 263 MET MET A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 HIS 265 265 265 HIS HIS A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 PRO 267 267 267 PRO PRO A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 THR 269 269 269 THR THR A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 LYS 271 271 271 LYS LYS A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 THR 277 277 277 THR THR A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 THR 279 279 279 THR THR A . n A 1 280 GLU 280 280 280 GLU GLU A . n A 1 281 THR 281 281 281 THR THR A . n A 1 282 ILE 282 282 282 ILE ILE A . n A 1 283 TYR 283 283 283 TYR TYR A . n A 1 284 GLU 284 284 284 GLU GLU A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 GLU 286 286 286 GLU GLU A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 CYS 288 288 288 CYS CYS A . n A 1 289 ALA 289 289 289 ALA ALA A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 ARG 291 291 291 ARG ARG A . n A 1 292 ARG 292 292 292 ARG ARG A . n A 1 293 CYS 293 293 293 CYS CYS A . n A 1 294 PHE 294 294 294 PHE PHE A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 ASN 298 298 ? ? ? A . n A 1 299 LEU 299 299 ? ? ? A . n A 1 300 TYR 300 300 ? ? ? A . n A 1 301 PHE 301 301 ? ? ? A . n A 1 302 GLN 302 302 ? ? ? A . n A 1 303 GLY 303 303 ? ? ? A . n A 1 304 LEU 304 304 ? ? ? A . n A 1 305 GLU 305 305 ? ? ? A . n A 1 306 HIS 306 306 ? ? ? A . n A 1 307 HIS 307 307 ? ? ? A . n A 1 308 HIS 308 308 ? ? ? A . n A 1 309 HIS 309 309 ? ? ? A . n A 1 310 HIS 310 310 ? ? ? A . n A 1 311 HIS 311 311 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 1 ZN ZN A . C 3 NHE 1 402 2 NHE NHE A . D 3 NHE 1 403 3 NHE NHE A . E 4 SO4 1 404 4 SO4 SO4 A . F 4 SO4 1 405 5 SO4 SO4 A . G 4 SO4 1 406 6 SO4 SO4 A . H 4 SO4 1 407 7 SO4 SO4 A . I 5 GOL 1 408 8 GOL GOL A . J 5 GOL 1 409 9 GOL GOL A . K 5 GOL 1 410 10 GOL GOL A . L 5 GOL 1 411 11 GOL GOL A . M 5 GOL 1 412 12 GOL GOL A . N 6 HOH 1 501 9 HOH HOH A . N 6 HOH 2 502 3 HOH HOH A . N 6 HOH 3 503 21 HOH HOH A . N 6 HOH 4 504 13 HOH HOH A . N 6 HOH 5 505 14 HOH HOH A . N 6 HOH 6 506 4 HOH HOH A . N 6 HOH 7 507 7 HOH HOH A . N 6 HOH 8 508 10 HOH HOH A . N 6 HOH 9 509 8 HOH HOH A . N 6 HOH 10 510 16 HOH HOH A . N 6 HOH 11 511 24 HOH HOH A . N 6 HOH 12 512 25 HOH HOH A . N 6 HOH 13 513 11 HOH HOH A . N 6 HOH 14 514 12 HOH HOH A . N 6 HOH 15 515 2 HOH HOH A . N 6 HOH 16 516 1 HOH HOH A . N 6 HOH 17 517 5 HOH HOH A . N 6 HOH 18 518 23 HOH HOH A . N 6 HOH 19 519 26 HOH HOH A . N 6 HOH 20 520 20 HOH HOH A . N 6 HOH 21 521 22 HOH HOH A . N 6 HOH 22 522 19 HOH HOH A . N 6 HOH 23 523 18 HOH HOH A . N 6 HOH 24 524 6 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 1 CG 2 1 Y 1 A MET 1 ? SD ? A MET 1 SD 3 1 Y 1 A MET 1 ? CE ? A MET 1 CE 4 1 Y 1 A GLN 24 ? CG ? A GLN 24 CG 5 1 Y 1 A GLN 24 ? CD ? A GLN 24 CD 6 1 Y 1 A GLN 24 ? OE1 ? A GLN 24 OE1 7 1 Y 1 A GLN 24 ? NE2 ? A GLN 24 NE2 8 1 Y 1 A GLN 28 ? CG ? A GLN 28 CG 9 1 Y 1 A GLN 28 ? CD ? A GLN 28 CD 10 1 Y 1 A GLN 28 ? OE1 ? A GLN 28 OE1 11 1 Y 1 A GLN 28 ? NE2 ? A GLN 28 NE2 12 1 Y 1 A GLU 38 ? CG ? A GLU 38 CG 13 1 Y 1 A GLU 38 ? CD ? A GLU 38 CD 14 1 Y 1 A GLU 38 ? OE1 ? A GLU 38 OE1 15 1 Y 1 A GLU 38 ? OE2 ? A GLU 38 OE2 16 1 Y 1 A ARG 39 ? CG ? A ARG 39 CG 17 1 Y 1 A ARG 39 ? CD ? A ARG 39 CD 18 1 Y 1 A ARG 39 ? NE ? A ARG 39 NE 19 1 Y 1 A ARG 39 ? CZ ? A ARG 39 CZ 20 1 Y 1 A ARG 39 ? NH1 ? A ARG 39 NH1 21 1 Y 1 A ARG 39 ? NH2 ? A ARG 39 NH2 22 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 23 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 24 1 Y 1 A GLU 69 ? CD ? A GLU 69 CD 25 1 Y 1 A GLU 69 ? OE1 ? A GLU 69 OE1 26 1 Y 1 A GLU 69 ? OE2 ? A GLU 69 OE2 27 1 Y 1 A LYS 96 ? CG ? A LYS 96 CG 28 1 Y 1 A LYS 96 ? CD ? A LYS 96 CD 29 1 Y 1 A LYS 96 ? CE ? A LYS 96 CE 30 1 Y 1 A LYS 96 ? NZ ? A LYS 96 NZ 31 1 Y 1 A LYS 103 ? CG ? A LYS 103 CG 32 1 Y 1 A LYS 103 ? CD ? A LYS 103 CD 33 1 Y 1 A LYS 103 ? CE ? A LYS 103 CE 34 1 Y 1 A LYS 103 ? NZ ? A LYS 103 NZ 35 1 Y 1 A LYS 227 ? CD ? A LYS 227 CD 36 1 Y 1 A LYS 227 ? CE ? A LYS 227 CE 37 1 Y 1 A LYS 227 ? NZ ? A LYS 227 NZ 38 1 Y 1 A LYS 235 ? CG ? A LYS 235 CG 39 1 Y 1 A LYS 235 ? CD ? A LYS 235 CD 40 1 Y 1 A LYS 235 ? CE ? A LYS 235 CE 41 1 Y 1 A LYS 235 ? NZ ? A LYS 235 NZ 42 1 Y 1 A LYS 248 ? CD ? A LYS 248 CD 43 1 Y 1 A LYS 248 ? CE ? A LYS 248 CE 44 1 Y 1 A LYS 248 ? NZ ? A LYS 248 NZ 45 1 Y 1 A GLU 297 ? CG ? A GLU 297 CG 46 1 Y 1 A GLU 297 ? CD ? A GLU 297 CD 47 1 Y 1 A GLU 297 ? OE1 ? A GLU 297 OE1 48 1 Y 1 A GLU 297 ? OE2 ? A GLU 297 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9SR5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 85.413 _cell.length_a_esd ? _cell.length_b 85.413 _cell.length_b_esd ? _cell.length_c 117.560 _cell.length_c_esd ? _cell.volume 742742.325 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9SR5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9SR5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1.26 M Ammonium sulfate 0.1 M CHES pH 9.5 0.2 M NaCl ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-12-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 56.14 _reflns.entry_id 9SR5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.329 _reflns.d_resolution_low 46.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21755 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.55 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.01 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1315 _reflns.pdbx_Rpim_I_all 0.03954 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1253 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.329 _reflns_shell.d_res_low 2.412 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.98 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2117 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.3 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.46 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.44 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 77.29 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9SR5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.33 _refine.ls_d_res_low 46.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21687 _refine.ls_number_reflns_R_free 1085 _refine.ls_number_reflns_R_work 20602 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.51 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2332 _refine.ls_R_factor_R_free 0.2602 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2318 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 1.0000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.5585 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4238 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.33 _refine_hist.d_res_low 46.02 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 2389 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2288 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 77 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0113 ? 2413 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.4817 ? 3268 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0918 ? 350 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0083 ? 409 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 17.2683 ? 864 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.33 2.43 . . 133 2532 99.14 . . . . 0.4650 . . . . . . . . . . . . . . . 0.4830 'X-RAY DIFFRACTION' 2.43 2.56 . . 133 2526 99.63 . . . . 0.4065 . . . . . . . . . . . . . . . 0.3801 'X-RAY DIFFRACTION' 2.56 2.72 . . 134 2539 99.66 . . . . 0.3447 . . . . . . . . . . . . . . . 0.3788 'X-RAY DIFFRACTION' 2.72 2.93 . . 135 2556 99.59 . . . . 0.3146 . . . . . . . . . . . . . . . 0.3401 'X-RAY DIFFRACTION' 2.93 3.23 . . 135 2563 99.52 . . . . 0.2873 . . . . . . . . . . . . . . . 0.3404 'X-RAY DIFFRACTION' 3.23 3.70 . . 136 2576 99.49 . . . . 0.2480 . . . . . . . . . . . . . . . 0.2814 'X-RAY DIFFRACTION' 3.70 4.66 . . 136 2584 99.42 . . . . 0.1828 . . . . . . . . . . . . . . . 0.1961 'X-RAY DIFFRACTION' 4.66 46.02 . . 143 2726 99.69 . . . . 0.1714 . . . . . . . . . . . . . . . 0.2093 # _struct.entry_id 9SR5 _struct.title 'Crystal Structure of the NlpC/P60 Peptidase YkfC from Bacillus subtilis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9SR5 _struct_keywords.text 'NlpC/P60 family, Papain-like, Cysteine peptidase, Cell wall recycling, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 5 ? J N N 5 ? K N N 5 ? L N N 5 ? M N N 5 ? N N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YKFC_BACSU _struct_ref.pdbx_db_accession O35010 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMHTVISAVANIWTAPDSPRPSDQFMLQPTVMIRDWLERMTYDERLGLCTDNVIQTQVLFGEKVLVTAEQGEWVSVIVPS QPSRKDPRGYPGWMKKYQLEKTKPIHTQHDVMISKPAAFLYRSNGEKEIELSFLTVLPLIAKENGYFKVSTVFGERFVRQ SDAVPVSQQKGTAEDIIQTGAFFLGLPYLWGGISGFGFDCSGFMYSIFKANGYSIPRDAGDQAKAGKGVPLDDMKAGDLL FFAYEEGKGAIHHVGLYVGGGKMLHSPKTGKSIEILTLTETIYEKELCAVRRCFSE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9SR5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 296 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O35010 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 296 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 296 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9SR5 GLU A 297 ? UNP O35010 ? ? 'expression tag' 297 1 1 9SR5 ASN A 298 ? UNP O35010 ? ? 'expression tag' 298 2 1 9SR5 LEU A 299 ? UNP O35010 ? ? 'expression tag' 299 3 1 9SR5 TYR A 300 ? UNP O35010 ? ? 'expression tag' 300 4 1 9SR5 PHE A 301 ? UNP O35010 ? ? 'expression tag' 301 5 1 9SR5 GLN A 302 ? UNP O35010 ? ? 'expression tag' 302 6 1 9SR5 GLY A 303 ? UNP O35010 ? ? 'expression tag' 303 7 1 9SR5 LEU A 304 ? UNP O35010 ? ? 'expression tag' 304 8 1 9SR5 GLU A 305 ? UNP O35010 ? ? 'expression tag' 305 9 1 9SR5 HIS A 306 ? UNP O35010 ? ? 'expression tag' 306 10 1 9SR5 HIS A 307 ? UNP O35010 ? ? 'expression tag' 307 11 1 9SR5 HIS A 308 ? UNP O35010 ? ? 'expression tag' 308 12 1 9SR5 HIS A 309 ? UNP O35010 ? ? 'expression tag' 309 13 1 9SR5 HIS A 310 ? UNP O35010 ? ? 'expression tag' 310 14 1 9SR5 HIS A 311 ? UNP O35010 ? ? 'expression tag' 311 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2300 ? 1 MORE -59 ? 1 'SSA (A^2)' 13760 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 20 ? LEU A 27 ? ARG A 20 LEU A 27 5 ? 8 HELX_P HELX_P2 AA2 MET A 32 ? MET A 40 ? MET A 32 MET A 40 1 ? 9 HELX_P HELX_P3 AA3 THR A 41 ? ASP A 51 ? THR A 41 ASP A 51 1 ? 11 HELX_P HELX_P4 AA4 THR A 172 ? PHE A 182 ? THR A 172 PHE A 182 1 ? 11 HELX_P HELX_P5 AA5 ASP A 199 ? ASN A 211 ? ASP A 199 ASN A 211 1 ? 13 HELX_P HELX_P6 AA6 ASP A 218 ? ALA A 223 ? ASP A 218 ALA A 223 1 ? 6 HELX_P HELX_P7 AA7 GLU A 245 ? LYS A 248 ? GLU A 245 LYS A 248 5 ? 4 HELX_P HELX_P8 AA8 THR A 281 ? GLU A 286 ? THR A 281 GLU A 286 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 199 C ? ? ? 1_555 A OCS 200 N ? ? A ASP 199 A OCS 200 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale2 covale both ? A OCS 200 C ? ? ? 1_555 A SER 201 N ? ? A OCS 200 A SER 201 1_555 ? ? ? ? ? ? ? 1.317 ? ? metalc1 metalc ? ? A HIS 106 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 106 A ZN 401 4_455 ? ? ? ? ? ? ? 1.882 ? ? metalc2 metalc ? ? A HIS 252 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 252 A ZN 401 1_555 ? ? ? ? ? ? ? 2.047 ? ? metalc3 metalc ? ? A GLU 286 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 286 A ZN 401 1_555 ? ? ? ? ? ? ? 2.010 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 401 A HOH 523 1_555 ? ? ? ? ? ? ? 2.599 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 106 ? A HIS 106 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 NE2 ? A HIS 252 ? A HIS 252 ? 1_555 29.6 ? 2 ND1 ? A HIS 106 ? A HIS 106 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 OE1 ? A GLU 286 ? A GLU 286 ? 1_555 32.8 ? 3 NE2 ? A HIS 252 ? A HIS 252 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 OE1 ? A GLU 286 ? A GLU 286 ? 1_555 3.2 ? 4 ND1 ? A HIS 106 ? A HIS 106 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 O ? N HOH . ? A HOH 523 ? 1_555 32.1 ? 5 NE2 ? A HIS 252 ? A HIS 252 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 O ? N HOH . ? A HOH 523 ? 1_555 3.8 ? 6 OE1 ? A GLU 286 ? A GLU 286 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 O ? N HOH . ? A HOH 523 ? 1_555 2.6 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 OCS A 200 ? . . . . OCS A 200 ? 1_555 . . . . . . . CYS 1 OCS Oxidation 'Named protein modification' 2 OCS A 200 ? . . . . OCS A 200 ? 1_555 . . . . . . . CYS 2 OCS Hydroxylation 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 5 ? AA4 ? 2 ? AA5 ? 2 ? AA6 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA6 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 90 ? LYS A 95 ? TYR A 90 LYS A 95 AA1 2 TRP A 73 ? VAL A 78 ? TRP A 73 VAL A 78 AA1 3 LYS A 63 ? GLN A 70 ? LYS A 63 GLN A 70 AA1 4 MET A 2 ? VAL A 5 ? MET A 2 VAL A 5 AA1 5 LEU A 99 ? LYS A 101 ? LEU A 99 LYS A 101 AA2 1 VAL A 9 ? TRP A 13 ? VAL A 9 TRP A 13 AA2 2 ILE A 54 ? LEU A 59 ? ILE A 54 LEU A 59 AA3 1 GLU A 155 ? ARG A 159 ? GLU A 155 ARG A 159 AA3 2 TYR A 146 ? SER A 150 ? TYR A 146 SER A 150 AA3 3 VAL A 136 ? GLU A 143 ? VAL A 136 GLU A 143 AA3 4 HIS A 109 ? ILE A 113 ? HIS A 109 ILE A 113 AA3 5 ALA A 163 ? PRO A 165 ? ALA A 163 PRO A 165 AA4 1 ALA A 117 ? TYR A 121 ? ALA A 117 TYR A 121 AA4 2 LYS A 127 ? SER A 132 ? LYS A 127 SER A 132 AA5 1 ILE A 193 ? SER A 194 ? ILE A 193 SER A 194 AA5 2 GLY A 197 ? PHE A 198 ? GLY A 197 PHE A 198 AA6 1 LYS A 227 ? VAL A 229 ? LYS A 227 VAL A 229 AA6 2 LEU A 287 ? ARG A 292 ? LEU A 287 ARG A 292 AA6 3 LEU A 239 ? ALA A 243 ? LEU A 239 ALA A 243 AA6 4 ILE A 251 ? TYR A 257 ? ILE A 251 TYR A 257 AA6 5 LYS A 262 ? HIS A 265 ? LYS A 262 HIS A 265 AA6 6 GLU A 274 ? THR A 277 ? GLU A 274 THR A 277 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 92 ? O GLY A 92 N VAL A 76 ? N VAL A 76 AA1 2 3 O SER A 75 ? O SER A 75 N THR A 67 ? N THR A 67 AA1 3 4 O VAL A 64 ? O VAL A 64 N HIS A 3 ? N HIS A 3 AA1 4 5 N THR A 4 ? N THR A 4 O GLU A 100 ? O GLU A 100 AA2 1 2 N ILE A 12 ? N ILE A 12 O GLN A 55 ? O GLN A 55 AA3 1 2 O VAL A 158 ? O VAL A 158 N PHE A 147 ? N PHE A 147 AA3 2 3 O LYS A 148 ? O LYS A 148 N ALA A 141 ? N ALA A 141 AA3 3 4 O LEU A 137 ? O LEU A 137 N VAL A 111 ? N VAL A 111 AA3 4 5 N MET A 112 ? N MET A 112 O VAL A 164 ? O VAL A 164 AA4 1 2 N LEU A 120 ? N LEU A 120 O GLU A 128 ? O GLU A 128 AA5 1 2 N SER A 194 ? N SER A 194 O GLY A 197 ? O GLY A 197 AA6 1 2 N VAL A 229 ? N VAL A 229 O VAL A 290 ? O VAL A 290 AA6 2 3 O ARG A 291 ? O ARG A 291 N LEU A 239 ? N LEU A 239 AA6 3 4 N LEU A 240 ? N LEU A 240 O GLY A 255 ? O GLY A 255 AA6 4 5 N LEU A 256 ? N LEU A 256 O LEU A 264 ? O LEU A 264 AA6 5 6 N MET A 263 ? N MET A 263 O LEU A 276 ? O LEU A 276 # _pdbx_entry_details.entry_id 9SR5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 32 ? ? -118.75 77.56 2 1 THR A 56 ? ? -164.66 -164.57 3 1 GLN A 70 ? ? -111.71 59.51 4 1 ASP A 86 ? ? -177.56 128.35 5 1 GLU A 128 ? ? -89.99 -72.99 6 1 LEU A 134 ? ? 76.19 -6.01 7 1 THR A 151 ? ? -122.68 -168.11 8 1 GLU A 246 ? ? 39.80 45.06 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id OCS _pdbx_struct_mod_residue.label_seq_id 200 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id OCS _pdbx_struct_mod_residue.auth_seq_id 200 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -41.5145899319 _pdbx_refine_tls.origin_y -0.47061963125 _pdbx_refine_tls.origin_z 2.78999193424 _pdbx_refine_tls.T[1][1] 0.399725050056 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.102041017008 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0223017977036 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.796415900054 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.065644286098 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.378654672463 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.815933653638 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.344566497532 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.0163741321828 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 4.57956179683 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -1.18648775999 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.08760641045 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0321532794679 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.342981285644 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0322449389564 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.48562671288 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.165011878642 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.186379840714 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.190358256166 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.389711147216 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.215446189767 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 298 ? A ASN 298 2 1 Y 1 A LEU 299 ? A LEU 299 3 1 Y 1 A TYR 300 ? A TYR 300 4 1 Y 1 A PHE 301 ? A PHE 301 5 1 Y 1 A GLN 302 ? A GLN 302 6 1 Y 1 A GLY 303 ? A GLY 303 7 1 Y 1 A LEU 304 ? A LEU 304 8 1 Y 1 A GLU 305 ? A GLU 305 9 1 Y 1 A HIS 306 ? A HIS 306 10 1 Y 1 A HIS 307 ? A HIS 307 11 1 Y 1 A HIS 308 ? A HIS 308 12 1 Y 1 A HIS 309 ? A HIS 309 13 1 Y 1 A HIS 310 ? A HIS 310 14 1 Y 1 A HIS 311 ? A HIS 311 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 NHE "C3'" C N N 264 NHE "C2'" C N N 265 NHE "C1'" C N N 266 NHE "C6'" C N N 267 NHE N N N N 268 NHE C1 C N N 269 NHE C2 C N N 270 NHE S S N N 271 NHE O1 O N N 272 NHE O2 O N N 273 NHE O3 O N N 274 NHE "C5'" C N N 275 NHE "C4'" C N N 276 NHE "H3'1" H N N 277 NHE "H3'2" H N N 278 NHE "H2'1" H N N 279 NHE "H2'2" H N N 280 NHE "HC'1" H N N 281 NHE "H6'1" H N N 282 NHE "H6'2" H N N 283 NHE HN H N N 284 NHE HC11 H N N 285 NHE HC12 H N N 286 NHE HC21 H N N 287 NHE HC22 H N N 288 NHE HO3 H N N 289 NHE "H5'1" H N N 290 NHE "H5'2" H N N 291 NHE "H4'1" H N N 292 NHE "H4'2" H N N 293 OCS N N N N 294 OCS CA C N R 295 OCS CB C N N 296 OCS SG S N N 297 OCS C C N N 298 OCS O O N N 299 OCS OXT O N N 300 OCS OD1 O N N 301 OCS OD2 O N N 302 OCS OD3 O N N 303 OCS H H N N 304 OCS H2 H N N 305 OCS HA H N N 306 OCS HB2 H N N 307 OCS HB3 H N N 308 OCS HXT H N N 309 OCS HD2 H N N 310 PHE N N N N 311 PHE CA C N S 312 PHE C C N N 313 PHE O O N N 314 PHE CB C N N 315 PHE CG C Y N 316 PHE CD1 C Y N 317 PHE CD2 C Y N 318 PHE CE1 C Y N 319 PHE CE2 C Y N 320 PHE CZ C Y N 321 PHE OXT O N N 322 PHE H H N N 323 PHE H2 H N N 324 PHE HA H N N 325 PHE HB2 H N N 326 PHE HB3 H N N 327 PHE HD1 H N N 328 PHE HD2 H N N 329 PHE HE1 H N N 330 PHE HE2 H N N 331 PHE HZ H N N 332 PHE HXT H N N 333 PRO N N N N 334 PRO CA C N S 335 PRO C C N N 336 PRO O O N N 337 PRO CB C N N 338 PRO CG C N N 339 PRO CD C N N 340 PRO OXT O N N 341 PRO H H N N 342 PRO HA H N N 343 PRO HB2 H N N 344 PRO HB3 H N N 345 PRO HG2 H N N 346 PRO HG3 H N N 347 PRO HD2 H N N 348 PRO HD3 H N N 349 PRO HXT H N N 350 SER N N N N 351 SER CA C N S 352 SER C C N N 353 SER O O N N 354 SER CB C N N 355 SER OG O N N 356 SER OXT O N N 357 SER H H N N 358 SER H2 H N N 359 SER HA H N N 360 SER HB2 H N N 361 SER HB3 H N N 362 SER HG H N N 363 SER HXT H N N 364 SO4 S S N N 365 SO4 O1 O N N 366 SO4 O2 O N N 367 SO4 O3 O N N 368 SO4 O4 O N N 369 THR N N N N 370 THR CA C N S 371 THR C C N N 372 THR O O N N 373 THR CB C N R 374 THR OG1 O N N 375 THR CG2 C N N 376 THR OXT O N N 377 THR H H N N 378 THR H2 H N N 379 THR HA H N N 380 THR HB H N N 381 THR HG1 H N N 382 THR HG21 H N N 383 THR HG22 H N N 384 THR HG23 H N N 385 THR HXT H N N 386 TRP N N N N 387 TRP CA C N S 388 TRP C C N N 389 TRP O O N N 390 TRP CB C N N 391 TRP CG C Y N 392 TRP CD1 C Y N 393 TRP CD2 C Y N 394 TRP NE1 N Y N 395 TRP CE2 C Y N 396 TRP CE3 C Y N 397 TRP CZ2 C Y N 398 TRP CZ3 C Y N 399 TRP CH2 C Y N 400 TRP OXT O N N 401 TRP H H N N 402 TRP H2 H N N 403 TRP HA H N N 404 TRP HB2 H N N 405 TRP HB3 H N N 406 TRP HD1 H N N 407 TRP HE1 H N N 408 TRP HE3 H N N 409 TRP HZ2 H N N 410 TRP HZ3 H N N 411 TRP HH2 H N N 412 TRP HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 VAL N N N N 438 VAL CA C N S 439 VAL C C N N 440 VAL O O N N 441 VAL CB C N N 442 VAL CG1 C N N 443 VAL CG2 C N N 444 VAL OXT O N N 445 VAL H H N N 446 VAL H2 H N N 447 VAL HA H N N 448 VAL HB H N N 449 VAL HG11 H N N 450 VAL HG12 H N N 451 VAL HG13 H N N 452 VAL HG21 H N N 453 VAL HG22 H N N 454 VAL HG23 H N N 455 VAL HXT H N N 456 ZN ZN ZN N N 457 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 NHE "C3'" "C2'" sing N N 250 NHE "C3'" "C4'" sing N N 251 NHE "C3'" "H3'1" sing N N 252 NHE "C3'" "H3'2" sing N N 253 NHE "C2'" "C1'" sing N N 254 NHE "C2'" "H2'1" sing N N 255 NHE "C2'" "H2'2" sing N N 256 NHE "C1'" "C6'" sing N N 257 NHE "C1'" N sing N N 258 NHE "C1'" "HC'1" sing N N 259 NHE "C6'" "C5'" sing N N 260 NHE "C6'" "H6'1" sing N N 261 NHE "C6'" "H6'2" sing N N 262 NHE N C1 sing N N 263 NHE N HN sing N N 264 NHE C1 C2 sing N N 265 NHE C1 HC11 sing N N 266 NHE C1 HC12 sing N N 267 NHE C2 S sing N N 268 NHE C2 HC21 sing N N 269 NHE C2 HC22 sing N N 270 NHE S O1 doub N N 271 NHE S O2 doub N N 272 NHE S O3 sing N N 273 NHE O3 HO3 sing N N 274 NHE "C5'" "C4'" sing N N 275 NHE "C5'" "H5'1" sing N N 276 NHE "C5'" "H5'2" sing N N 277 NHE "C4'" "H4'1" sing N N 278 NHE "C4'" "H4'2" sing N N 279 OCS N CA sing N N 280 OCS N H sing N N 281 OCS N H2 sing N N 282 OCS CA CB sing N N 283 OCS CA C sing N N 284 OCS CA HA sing N N 285 OCS CB SG sing N N 286 OCS CB HB2 sing N N 287 OCS CB HB3 sing N N 288 OCS SG OD1 doub N N 289 OCS SG OD2 sing N N 290 OCS SG OD3 doub N N 291 OCS C O doub N N 292 OCS C OXT sing N N 293 OCS OXT HXT sing N N 294 OCS OD2 HD2 sing N N 295 PHE N CA sing N N 296 PHE N H sing N N 297 PHE N H2 sing N N 298 PHE CA C sing N N 299 PHE CA CB sing N N 300 PHE CA HA sing N N 301 PHE C O doub N N 302 PHE C OXT sing N N 303 PHE CB CG sing N N 304 PHE CB HB2 sing N N 305 PHE CB HB3 sing N N 306 PHE CG CD1 doub Y N 307 PHE CG CD2 sing Y N 308 PHE CD1 CE1 sing Y N 309 PHE CD1 HD1 sing N N 310 PHE CD2 CE2 doub Y N 311 PHE CD2 HD2 sing N N 312 PHE CE1 CZ doub Y N 313 PHE CE1 HE1 sing N N 314 PHE CE2 CZ sing Y N 315 PHE CE2 HE2 sing N N 316 PHE CZ HZ sing N N 317 PHE OXT HXT sing N N 318 PRO N CA sing N N 319 PRO N CD sing N N 320 PRO N H sing N N 321 PRO CA C sing N N 322 PRO CA CB sing N N 323 PRO CA HA sing N N 324 PRO C O doub N N 325 PRO C OXT sing N N 326 PRO CB CG sing N N 327 PRO CB HB2 sing N N 328 PRO CB HB3 sing N N 329 PRO CG CD sing N N 330 PRO CG HG2 sing N N 331 PRO CG HG3 sing N N 332 PRO CD HD2 sing N N 333 PRO CD HD3 sing N N 334 PRO OXT HXT sing N N 335 SER N CA sing N N 336 SER N H sing N N 337 SER N H2 sing N N 338 SER CA C sing N N 339 SER CA CB sing N N 340 SER CA HA sing N N 341 SER C O doub N N 342 SER C OXT sing N N 343 SER CB OG sing N N 344 SER CB HB2 sing N N 345 SER CB HB3 sing N N 346 SER OG HG sing N N 347 SER OXT HXT sing N N 348 SO4 S O1 doub N N 349 SO4 S O2 doub N N 350 SO4 S O3 sing N N 351 SO4 S O4 sing N N 352 THR N CA sing N N 353 THR N H sing N N 354 THR N H2 sing N N 355 THR CA C sing N N 356 THR CA CB sing N N 357 THR CA HA sing N N 358 THR C O doub N N 359 THR C OXT sing N N 360 THR CB OG1 sing N N 361 THR CB CG2 sing N N 362 THR CB HB sing N N 363 THR OG1 HG1 sing N N 364 THR CG2 HG21 sing N N 365 THR CG2 HG22 sing N N 366 THR CG2 HG23 sing N N 367 THR OXT HXT sing N N 368 TRP N CA sing N N 369 TRP N H sing N N 370 TRP N H2 sing N N 371 TRP CA C sing N N 372 TRP CA CB sing N N 373 TRP CA HA sing N N 374 TRP C O doub N N 375 TRP C OXT sing N N 376 TRP CB CG sing N N 377 TRP CB HB2 sing N N 378 TRP CB HB3 sing N N 379 TRP CG CD1 doub Y N 380 TRP CG CD2 sing Y N 381 TRP CD1 NE1 sing Y N 382 TRP CD1 HD1 sing N N 383 TRP CD2 CE2 doub Y N 384 TRP CD2 CE3 sing Y N 385 TRP NE1 CE2 sing Y N 386 TRP NE1 HE1 sing N N 387 TRP CE2 CZ2 sing Y N 388 TRP CE3 CZ3 doub Y N 389 TRP CE3 HE3 sing N N 390 TRP CZ2 CH2 doub Y N 391 TRP CZ2 HZ2 sing N N 392 TRP CZ3 CH2 sing Y N 393 TRP CZ3 HZ3 sing N N 394 TRP CH2 HH2 sing N N 395 TRP OXT HXT sing N N 396 TYR N CA sing N N 397 TYR N H sing N N 398 TYR N H2 sing N N 399 TYR CA C sing N N 400 TYR CA CB sing N N 401 TYR CA HA sing N N 402 TYR C O doub N N 403 TYR C OXT sing N N 404 TYR CB CG sing N N 405 TYR CB HB2 sing N N 406 TYR CB HB3 sing N N 407 TYR CG CD1 doub Y N 408 TYR CG CD2 sing Y N 409 TYR CD1 CE1 sing Y N 410 TYR CD1 HD1 sing N N 411 TYR CD2 CE2 doub Y N 412 TYR CD2 HD2 sing N N 413 TYR CE1 CZ doub Y N 414 TYR CE1 HE1 sing N N 415 TYR CE2 CZ sing Y N 416 TYR CE2 HE2 sing N N 417 TYR CZ OH sing N N 418 TYR OH HH sing N N 419 TYR OXT HXT sing N N 420 VAL N CA sing N N 421 VAL N H sing N N 422 VAL N H2 sing N N 423 VAL CA C sing N N 424 VAL CA CB sing N N 425 VAL CA HA sing N N 426 VAL C O doub N N 427 VAL C OXT sing N N 428 VAL CB CG1 sing N N 429 VAL CB CG2 sing N N 430 VAL CB HB sing N N 431 VAL CG1 HG11 sing N N 432 VAL CG1 HG12 sing N N 433 VAL CG1 HG13 sing N N 434 VAL CG2 HG21 sing N N 435 VAL CG2 HG22 sing N N 436 VAL CG2 HG23 sing N N 437 VAL OXT HXT sing N N 438 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3H41 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9SR5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011708 _atom_sites.fract_transf_matrix[1][2] 0.006760 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013519 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008506 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #