data_9SY9 # _entry.id 9SY9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9SY9 pdb_00009sy9 10.2210/pdb9sy9/pdb WWPDB D_1292149165 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-21 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9SY9 _pdbx_database_status.recvd_initial_deposition_date 2025-10-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email ross.anderson@bristol.ac.uk _pdbx_contact_author.name_first J.L.Ross _pdbx_contact_author.name_last Anderson _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6796-0482 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bungay, E.L.' 1 0009-0000-6097-8180 'Barringer, R.' 2 0000-0002-0948-3761 'Anderson, J.L.R.' 3 0000-0002-6796-0482 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Broad redox control of de novo cytochromes exerted through structurally conservative metalloporphyrin replacement' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mellor, C.' 1 0009-0005-3467-4569 primary 'Bungay, E.L.' 2 0009-0000-6097-8180 primary 'Barringer, R.' 3 0000-0002-0948-3761 primary 'Anderson, J.L.R.' 4 0000-0002-6796-0482 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '4D2 (mutant T19D)' 12666.130 1 ? ? ? ? 2 non-polymer syn 'Fe(III) 2,4-diformyl deuteroporphyrin IX' 620.433 2 ? ? ? ? 3 non-polymer nat 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 11 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSPELREKHRALAEQVYADGQEMLKNTSNSPELREKHRALAEQVYATGQEMLKNGSVSPSPELREKHRALAEQVYATGQE MLKNTSNSPELREKHRALAEQVYATGQEMLKN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSPELREKHRALAEQVYADGQEMLKNTSNSPELREKHRALAEQVYATGQEMLKNGSVSPSPELREKHRALAEQVYATGQE MLKNTSNSPELREKHRALAEQVYATGQEMLKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'Fe(III) 2,4-diformyl deuteroporphyrin IX' A1JTU 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 GLU n 1 5 LEU n 1 6 ARG n 1 7 GLU n 1 8 LYS n 1 9 HIS n 1 10 ARG n 1 11 ALA n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 GLN n 1 16 VAL n 1 17 TYR n 1 18 ALA n 1 19 ASP n 1 20 GLY n 1 21 GLN n 1 22 GLU n 1 23 MET n 1 24 LEU n 1 25 LYS n 1 26 ASN n 1 27 THR n 1 28 SER n 1 29 ASN n 1 30 SER n 1 31 PRO n 1 32 GLU n 1 33 LEU n 1 34 ARG n 1 35 GLU n 1 36 LYS n 1 37 HIS n 1 38 ARG n 1 39 ALA n 1 40 LEU n 1 41 ALA n 1 42 GLU n 1 43 GLN n 1 44 VAL n 1 45 TYR n 1 46 ALA n 1 47 THR n 1 48 GLY n 1 49 GLN n 1 50 GLU n 1 51 MET n 1 52 LEU n 1 53 LYS n 1 54 ASN n 1 55 GLY n 1 56 SER n 1 57 VAL n 1 58 SER n 1 59 PRO n 1 60 SER n 1 61 PRO n 1 62 GLU n 1 63 LEU n 1 64 ARG n 1 65 GLU n 1 66 LYS n 1 67 HIS n 1 68 ARG n 1 69 ALA n 1 70 LEU n 1 71 ALA n 1 72 GLU n 1 73 GLN n 1 74 VAL n 1 75 TYR n 1 76 ALA n 1 77 THR n 1 78 GLY n 1 79 GLN n 1 80 GLU n 1 81 MET n 1 82 LEU n 1 83 LYS n 1 84 ASN n 1 85 THR n 1 86 SER n 1 87 ASN n 1 88 SER n 1 89 PRO n 1 90 GLU n 1 91 LEU n 1 92 ARG n 1 93 GLU n 1 94 LYS n 1 95 HIS n 1 96 ARG n 1 97 ALA n 1 98 LEU n 1 99 ALA n 1 100 GLU n 1 101 GLN n 1 102 VAL n 1 103 TYR n 1 104 ALA n 1 105 THR n 1 106 GLY n 1 107 GLN n 1 108 GLU n 1 109 MET n 1 110 LEU n 1 111 LYS n 1 112 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 112 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1JTU non-polymer . 'Fe(III) 2,4-diformyl deuteroporphyrin IX' ? 'C32 H28 Fe N4 O6' 620.433 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 ? ? ? A . n A 1 55 GLY 55 55 ? ? ? A . n A 1 56 SER 56 56 ? ? ? A . n A 1 57 VAL 57 57 ? ? ? A . n A 1 58 SER 58 58 ? ? ? A . n A 1 59 PRO 59 59 ? ? ? A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASN 112 112 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1JTU 1 201 201 A1JTU DIF A . C 2 A1JTU 1 202 202 A1JTU DIF A . D 3 CL 1 203 1 CL CL A . E 4 HOH 1 301 23 HOH HOH A . E 4 HOH 2 302 9 HOH HOH A . E 4 HOH 3 303 26 HOH HOH A . E 4 HOH 4 304 12 HOH HOH A . E 4 HOH 5 305 8 HOH HOH A . E 4 HOH 6 306 28 HOH HOH A . E 4 HOH 7 307 14 HOH HOH A . E 4 HOH 8 308 15 HOH HOH A . E 4 HOH 9 309 10 HOH HOH A . E 4 HOH 10 310 7 HOH HOH A . E 4 HOH 11 311 27 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0430 (refmacat 0.4.105)' ? 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 5 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 120 _cell.angle_gamma_esd ? _cell.entry_id 9SY9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.271 _cell.length_a_esd ? _cell.length_b 81.271 _cell.length_b_esd ? _cell.length_c 60.967 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9SY9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9SY9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Protein Buffer 20 mM CHES, 100 mM KCl, pH 8.6. Crystallisation condition 2.1M DL-Malic Acid, pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-05-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9SY9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.997 _reflns.d_resolution_low 46.082 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10188 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.997 _reflns_shell.d_res_low 2.032 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 513 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.744 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.516 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.185 _refine.aniso_B[1][2] -1.093 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -2.185 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 7.090 _refine.B_iso_max ? _refine.B_iso_mean 45.760 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.972 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.details 'Hydrogens have not been used' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9SY9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.998 _refine.ls_d_res_low 46.082 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10158 _refine.ls_number_reflns_R_free 503 _refine.ls_number_reflns_R_work 9655 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.735 _refine.ls_percent_reflns_R_free 4.952 _refine.ls_R_factor_all 0.185 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2286 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1824 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.150 _refine.pdbx_overall_ESU_R_Free 0.146 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.116 _refine.overall_SU_ML 0.147 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.998 _refine_hist.d_res_low 46.082 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 938 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 840 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 87 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 969 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 1.882 2.023 1319 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 4.756 5.000 107 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.541 5.000 28 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 14.594 10.000 171 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.072 10.000 47 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.106 0.200 123 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.009 0.022 780 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.217 0.200 496 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.290 0.200 648 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.156 0.200 47 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.051 0.200 2 ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.222 0.200 36 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.105 0.200 6 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 4.142 4.203 428 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 5.889 7.511 535 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 6.122 4.725 541 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 8.878 8.396 784 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 10.351 49.651 1603 ? r_lrange_it ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.998 2.049 749 . 30 693 96.5287 . 0.376 . . 0.377 . . . . . 0.359 . . . . . 20 . 0.829 0.852 0.337 'X-RAY DIFFRACTION' 2.049 2.106 738 . 28 710 100.0000 . 0.345 . . 0.343 . . . . . 0.318 . . . . . 20 . 0.875 0.873 0.380 'X-RAY DIFFRACTION' 2.106 2.166 722 . 48 674 100.0000 . 0.332 . . 0.332 . . . . . 0.300 . . . . . 20 . 0.880 0.875 0.334 'X-RAY DIFFRACTION' 2.166 2.233 678 . 33 645 100.0000 . 0.277 . . 0.274 . . . . . 0.233 . . . . . 20 . 0.916 0.890 0.326 'X-RAY DIFFRACTION' 2.233 2.306 685 . 32 653 100.0000 . 0.248 . . 0.251 . . . . . 0.215 . . . . . 20 . 0.932 0.972 0.203 'X-RAY DIFFRACTION' 2.306 2.387 632 . 46 586 100.0000 . 0.229 . . 0.228 . . . . . 0.190 . . . . . 20 . 0.951 0.953 0.236 'X-RAY DIFFRACTION' 2.387 2.477 637 . 28 609 100.0000 . 0.213 . . 0.210 . . . . . 0.175 . . . . . 20 . 0.965 0.960 0.271 'X-RAY DIFFRACTION' 2.477 2.577 588 . 33 554 99.8299 . 0.204 . . 0.199 . . . . . 0.170 . . . . . 20 . 0.968 0.952 0.286 'X-RAY DIFFRACTION' 2.577 2.692 603 . 29 574 100.0000 . 0.188 . . 0.186 . . . . . 0.166 . . . . . 20 . 0.977 0.974 0.226 'X-RAY DIFFRACTION' 2.692 2.823 557 . 25 532 100.0000 . 0.178 . . 0.176 . . . . . 0.155 . . . . . 20 . 0.978 0.977 0.216 'X-RAY DIFFRACTION' 2.823 2.975 522 . 28 494 100.0000 . 0.161 . . 0.160 . . . . . 0.143 . . . . . 20 . 0.984 0.980 0.185 'X-RAY DIFFRACTION' 2.975 3.154 481 . 27 454 100.0000 . 0.150 . . 0.149 . . . . . 0.140 . . . . . 20 . 0.986 0.984 0.154 'X-RAY DIFFRACTION' 3.154 3.371 467 . 15 452 100.0000 . 0.160 . . 0.161 . . . . . 0.156 . . . . . 20 . 0.984 0.988 0.144 'X-RAY DIFFRACTION' 3.371 3.639 450 . 30 420 100.0000 . 0.153 . . 0.149 . . . . . 0.153 . . . . . 20 . 0.987 0.975 0.210 'X-RAY DIFFRACTION' 3.639 3.984 385 . 13 372 100.0000 . 0.150 . . 0.151 . . . . . 0.160 . . . . . 20 . 0.986 0.988 0.136 'X-RAY DIFFRACTION' 3.984 4.450 368 . 17 351 100.0000 . 0.147 . . 0.145 . . . . . 0.160 . . . . . 20 . 0.988 0.982 0.193 'X-RAY DIFFRACTION' 4.450 5.131 329 . 19 310 100.0000 . 0.169 . . 0.163 . . . . . 0.188 . . . . . 20 . 0.986 0.953 0.347 'X-RAY DIFFRACTION' 5.131 6.265 267 . 10 257 100.0000 . 0.179 . . 0.179 . . . . . 0.204 . . . . . 20 . 0.982 0.994 0.179 'X-RAY DIFFRACTION' 6.265 8.779 209 . 8 201 100.0000 . 0.142 . . 0.140 . . . . . 0.174 . . . . . 20 . 0.989 0.993 0.201 'X-RAY DIFFRACTION' 8.779 46.082 118 . 4 114 100.0000 . 0.165 . . 0.158 . . . . . 0.197 . . . . . 20 . 0.985 0.954 0.374 # _struct.entry_id 9SY9 _struct.title 'Crystal structure of the diheme 4D2 (mutant T19D) with bound Fe(III) 2,4-diformyl deuteroporphyrin IX' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9SY9 _struct_keywords.text 'Cytochrome, maquette, four-helix bundle, Redox, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9SY9 _struct_ref.pdbx_db_accession 9SY9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9SY9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9SY9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 112 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -7 ? 1 'SSA (A^2)' 6430 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? LYS A 25 ? SER A 2 LYS A 25 1 ? 24 HELX_P HELX_P2 AA2 SER A 30 ? LEU A 52 ? SER A 30 LEU A 52 1 ? 23 HELX_P HELX_P3 AA3 PRO A 61 ? LEU A 82 ? PRO A 61 LEU A 82 1 ? 22 HELX_P HELX_P4 AA4 SER A 88 ? MET A 109 ? SER A 88 MET A 109 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 9 NE2 ? ? ? 1_555 B A1JTU . FE ? ? A HIS 9 A A1JTU 201 1_555 ? ? ? ? ? ? ? 2.018 ? ? metalc2 metalc ? ? A HIS 37 NE2 ? ? ? 1_555 C A1JTU . FE ? ? A HIS 37 A A1JTU 202 1_555 ? ? ? ? ? ? ? 1.957 ? ? metalc3 metalc ? ? A HIS 67 NE2 ? ? ? 1_555 B A1JTU . FE ? ? A HIS 67 A A1JTU 201 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc4 metalc ? ? A HIS 95 NE2 ? ? ? 1_555 C A1JTU . FE ? ? A HIS 95 A A1JTU 202 1_555 ? ? ? ? ? ? ? 1.942 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 ND ? B A1JTU . ? A A1JTU 201 ? 1_555 89.9 ? 2 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NA ? B A1JTU . ? A A1JTU 201 ? 1_555 90.9 ? 3 ND ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NA ? B A1JTU . ? A A1JTU 201 ? 1_555 91.7 ? 4 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NC ? B A1JTU . ? A A1JTU 201 ? 1_555 89.4 ? 5 ND ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NC ? B A1JTU . ? A A1JTU 201 ? 1_555 89.6 ? 6 NA ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NC ? B A1JTU . ? A A1JTU 201 ? 1_555 178.7 ? 7 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NB ? B A1JTU . ? A A1JTU 201 ? 1_555 90.2 ? 8 ND ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NB ? B A1JTU . ? A A1JTU 201 ? 1_555 179.2 ? 9 NA ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NB ? B A1JTU . ? A A1JTU 201 ? 1_555 87.4 ? 10 NC ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NB ? B A1JTU . ? A A1JTU 201 ? 1_555 91.3 ? 11 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 174.0 ? 12 ND ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 95.9 ? 13 NA ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 87.3 ? 14 NC ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 92.3 ? 15 NB ? B A1JTU . ? A A1JTU 201 ? 1_555 FE ? B A1JTU . ? A A1JTU 201 ? 1_555 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 84.1 ? 16 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 ND ? C A1JTU . ? A A1JTU 202 ? 1_555 91.7 ? 17 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NA ? C A1JTU . ? A A1JTU 202 ? 1_555 89.4 ? 18 ND ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NA ? C A1JTU . ? A A1JTU 202 ? 1_555 89.8 ? 19 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NC ? C A1JTU . ? A A1JTU 202 ? 1_555 89.9 ? 20 ND ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NC ? C A1JTU . ? A A1JTU 202 ? 1_555 92.8 ? 21 NA ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NC ? C A1JTU . ? A A1JTU 202 ? 1_555 177.3 ? 22 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NB ? C A1JTU . ? A A1JTU 202 ? 1_555 90.1 ? 23 ND ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NB ? C A1JTU . ? A A1JTU 202 ? 1_555 176.9 ? 24 NA ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NB ? C A1JTU . ? A A1JTU 202 ? 1_555 87.6 ? 25 NC ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NB ? C A1JTU . ? A A1JTU 202 ? 1_555 89.9 ? 26 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NE2 ? A HIS 95 ? A HIS 95 ? 1_555 178.4 ? 27 ND ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NE2 ? A HIS 95 ? A HIS 95 ? 1_555 87.0 ? 28 NA ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NE2 ? A HIS 95 ? A HIS 95 ? 1_555 91.6 ? 29 NC ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NE2 ? A HIS 95 ? A HIS 95 ? 1_555 89.2 ? 30 NB ? C A1JTU . ? A A1JTU 202 ? 1_555 FE ? C A1JTU . ? A A1JTU 202 ? 1_555 NE2 ? A HIS 95 ? A HIS 95 ? 1_555 91.3 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 A1JTU B . ? HIS A 9 ? A1JTU A 201 ? 1_555 HIS A 9 ? 1_555 FE NE2 HIS 1 A1JTU None 'Metal coordination' 2 A1JTU B . ? HIS A 67 ? A1JTU A 201 ? 1_555 HIS A 67 ? 1_555 FE NE2 HIS 1 A1JTU None 'Metal coordination' 3 A1JTU C . ? HIS A 37 ? A1JTU A 202 ? 1_555 HIS A 37 ? 1_555 FE NE2 HIS 1 A1JTU None 'Metal coordination' 4 A1JTU C . ? HIS A 95 ? A1JTU A 202 ? 1_555 HIS A 95 ? 1_555 FE NE2 HIS 1 A1JTU None 'Metal coordination' # _pdbx_entry_details.entry_id 9SY9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 19 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 B _pdbx_validate_close_contact.auth_atom_id_2 ND1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HIS _pdbx_validate_close_contact.auth_seq_id_2 37 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 NC ? A A1JTU 201 ? PLANAR . 2 1 NC ? A A1JTU 202 ? PLANAR . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 54 ? A ASN 54 2 1 Y 1 A GLY 55 ? A GLY 55 3 1 Y 1 A SER 56 ? A SER 56 4 1 Y 1 A VAL 57 ? A VAL 57 5 1 Y 1 A SER 58 ? A SER 58 6 1 Y 1 A PRO 59 ? A PRO 59 7 1 Y 1 A ASN 112 ? A ASN 112 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1JTU FE FE N N 1 A1JTU NA N Y N 2 A1JTU NB N N N 3 A1JTU NC N N R 4 A1JTU ND N N N 5 A1JTU C1A C Y N 6 A1JTU CHA C N N 7 A1JTU C4D C N N 8 A1JTU C1B C N N 9 A1JTU CHB C N N 10 A1JTU C4A C Y N 11 A1JTU C1C C N N 12 A1JTU CHC C N N 13 A1JTU C4B C N N 14 A1JTU C1D C N N 15 A1JTU CHD C N N 16 A1JTU C4C C N N 17 A1JTU C2A C Y N 18 A1JTU CAA C N N 19 A1JTU C3A C Y N 20 A1JTU CMA C N N 21 A1JTU CBA C N N 22 A1JTU CGA C N N 23 A1JTU O2A O N N 24 A1JTU O1A O N N 25 A1JTU C2B C N N 26 A1JTU CMB C N N 27 A1JTU C3B C N N 28 A1JTU CAB C N N 29 A1JTU OBB O N N 30 A1JTU C2C C N N 31 A1JTU CMC C N N 32 A1JTU C3C C N N 33 A1JTU CAC C N N 34 A1JTU OBC O N N 35 A1JTU C2D C N N 36 A1JTU CMD C N N 37 A1JTU C3D C N N 38 A1JTU CAD C N N 39 A1JTU CBD C N N 40 A1JTU CGD C N N 41 A1JTU O1D O N N 42 A1JTU O2D O N N 43 A1JTU H1 H N N 44 A1JTU H2 H N N 45 A1JTU H3 H N N 46 A1JTU H4 H N N 47 A1JTU H5 H N N 48 A1JTU H6 H N N 49 A1JTU H7 H N N 50 A1JTU H8 H N N 51 A1JTU H9 H N N 52 A1JTU H10 H N N 53 A1JTU H11 H N N 54 A1JTU H12 H N N 55 A1JTU H13 H N N 56 A1JTU H14 H N N 57 A1JTU H15 H N N 58 A1JTU H16 H N N 59 A1JTU H17 H N N 60 A1JTU H18 H N N 61 A1JTU H19 H N N 62 A1JTU H20 H N N 63 A1JTU H21 H N N 64 A1JTU H22 H N N 65 A1JTU H23 H N N 66 A1JTU H24 H N N 67 A1JTU H25 H N N 68 A1JTU H26 H N N 69 A1JTU H27 H N N 70 A1JTU H28 H N N 71 ALA N N N N 72 ALA CA C N S 73 ALA C C N N 74 ALA O O N N 75 ALA CB C N N 76 ALA OXT O N N 77 ALA H H N N 78 ALA H2 H N N 79 ALA HA H N N 80 ALA HB1 H N N 81 ALA HB2 H N N 82 ALA HB3 H N N 83 ALA HXT H N N 84 ARG N N N N 85 ARG CA C N S 86 ARG C C N N 87 ARG O O N N 88 ARG CB C N N 89 ARG CG C N N 90 ARG CD C N N 91 ARG NE N N N 92 ARG CZ C N N 93 ARG NH1 N N N 94 ARG NH2 N N N 95 ARG OXT O N N 96 ARG H H N N 97 ARG H2 H N N 98 ARG HA H N N 99 ARG HB2 H N N 100 ARG HB3 H N N 101 ARG HG2 H N N 102 ARG HG3 H N N 103 ARG HD2 H N N 104 ARG HD3 H N N 105 ARG HE H N N 106 ARG HH11 H N N 107 ARG HH12 H N N 108 ARG HH21 H N N 109 ARG HH22 H N N 110 ARG HXT H N N 111 ASN N N N N 112 ASN CA C N S 113 ASN C C N N 114 ASN O O N N 115 ASN CB C N N 116 ASN CG C N N 117 ASN OD1 O N N 118 ASN ND2 N N N 119 ASN OXT O N N 120 ASN H H N N 121 ASN H2 H N N 122 ASN HA H N N 123 ASN HB2 H N N 124 ASN HB3 H N N 125 ASN HD21 H N N 126 ASN HD22 H N N 127 ASN HXT H N N 128 ASP N N N N 129 ASP CA C N S 130 ASP C C N N 131 ASP O O N N 132 ASP CB C N N 133 ASP CG C N N 134 ASP OD1 O N N 135 ASP OD2 O N N 136 ASP OXT O N N 137 ASP H H N N 138 ASP H2 H N N 139 ASP HA H N N 140 ASP HB2 H N N 141 ASP HB3 H N N 142 ASP HD2 H N N 143 ASP HXT H N N 144 CL CL CL N N 145 GLN N N N N 146 GLN CA C N S 147 GLN C C N N 148 GLN O O N N 149 GLN CB C N N 150 GLN CG C N N 151 GLN CD C N N 152 GLN OE1 O N N 153 GLN NE2 N N N 154 GLN OXT O N N 155 GLN H H N N 156 GLN H2 H N N 157 GLN HA H N N 158 GLN HB2 H N N 159 GLN HB3 H N N 160 GLN HG2 H N N 161 GLN HG3 H N N 162 GLN HE21 H N N 163 GLN HE22 H N N 164 GLN HXT H N N 165 GLU N N N N 166 GLU CA C N S 167 GLU C C N N 168 GLU O O N N 169 GLU CB C N N 170 GLU CG C N N 171 GLU CD C N N 172 GLU OE1 O N N 173 GLU OE2 O N N 174 GLU OXT O N N 175 GLU H H N N 176 GLU H2 H N N 177 GLU HA H N N 178 GLU HB2 H N N 179 GLU HB3 H N N 180 GLU HG2 H N N 181 GLU HG3 H N N 182 GLU HE2 H N N 183 GLU HXT H N N 184 GLY N N N N 185 GLY CA C N N 186 GLY C C N N 187 GLY O O N N 188 GLY OXT O N N 189 GLY H H N N 190 GLY H2 H N N 191 GLY HA2 H N N 192 GLY HA3 H N N 193 GLY HXT H N N 194 HIS N N N N 195 HIS CA C N S 196 HIS C C N N 197 HIS O O N N 198 HIS CB C N N 199 HIS CG C Y N 200 HIS ND1 N Y N 201 HIS CD2 C Y N 202 HIS CE1 C Y N 203 HIS NE2 N Y N 204 HIS OXT O N N 205 HIS H H N N 206 HIS H2 H N N 207 HIS HA H N N 208 HIS HB2 H N N 209 HIS HB3 H N N 210 HIS HD1 H N N 211 HIS HD2 H N N 212 HIS HE1 H N N 213 HIS HE2 H N N 214 HIS HXT H N N 215 HOH O O N N 216 HOH H1 H N N 217 HOH H2 H N N 218 LEU N N N N 219 LEU CA C N S 220 LEU C C N N 221 LEU O O N N 222 LEU CB C N N 223 LEU CG C N N 224 LEU CD1 C N N 225 LEU CD2 C N N 226 LEU OXT O N N 227 LEU H H N N 228 LEU H2 H N N 229 LEU HA H N N 230 LEU HB2 H N N 231 LEU HB3 H N N 232 LEU HG H N N 233 LEU HD11 H N N 234 LEU HD12 H N N 235 LEU HD13 H N N 236 LEU HD21 H N N 237 LEU HD22 H N N 238 LEU HD23 H N N 239 LEU HXT H N N 240 LYS N N N N 241 LYS CA C N S 242 LYS C C N N 243 LYS O O N N 244 LYS CB C N N 245 LYS CG C N N 246 LYS CD C N N 247 LYS CE C N N 248 LYS NZ N N N 249 LYS OXT O N N 250 LYS H H N N 251 LYS H2 H N N 252 LYS HA H N N 253 LYS HB2 H N N 254 LYS HB3 H N N 255 LYS HG2 H N N 256 LYS HG3 H N N 257 LYS HD2 H N N 258 LYS HD3 H N N 259 LYS HE2 H N N 260 LYS HE3 H N N 261 LYS HZ1 H N N 262 LYS HZ2 H N N 263 LYS HZ3 H N N 264 LYS HXT H N N 265 MET N N N N 266 MET CA C N S 267 MET C C N N 268 MET O O N N 269 MET CB C N N 270 MET CG C N N 271 MET SD S N N 272 MET CE C N N 273 MET OXT O N N 274 MET H H N N 275 MET H2 H N N 276 MET HA H N N 277 MET HB2 H N N 278 MET HB3 H N N 279 MET HG2 H N N 280 MET HG3 H N N 281 MET HE1 H N N 282 MET HE2 H N N 283 MET HE3 H N N 284 MET HXT H N N 285 PRO N N N N 286 PRO CA C N S 287 PRO C C N N 288 PRO O O N N 289 PRO CB C N N 290 PRO CG C N N 291 PRO CD C N N 292 PRO OXT O N N 293 PRO H H N N 294 PRO HA H N N 295 PRO HB2 H N N 296 PRO HB3 H N N 297 PRO HG2 H N N 298 PRO HG3 H N N 299 PRO HD2 H N N 300 PRO HD3 H N N 301 PRO HXT H N N 302 SER N N N N 303 SER CA C N S 304 SER C C N N 305 SER O O N N 306 SER CB C N N 307 SER OG O N N 308 SER OXT O N N 309 SER H H N N 310 SER H2 H N N 311 SER HA H N N 312 SER HB2 H N N 313 SER HB3 H N N 314 SER HG H N N 315 SER HXT H N N 316 THR N N N N 317 THR CA C N S 318 THR C C N N 319 THR O O N N 320 THR CB C N R 321 THR OG1 O N N 322 THR CG2 C N N 323 THR OXT O N N 324 THR H H N N 325 THR H2 H N N 326 THR HA H N N 327 THR HB H N N 328 THR HG1 H N N 329 THR HG21 H N N 330 THR HG22 H N N 331 THR HG23 H N N 332 THR HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1JTU O1D CGD doub N N 1 A1JTU CGD O2D sing N N 2 A1JTU CGD CBD sing N N 3 A1JTU O2A CGA doub N N 4 A1JTU CBD CAD sing N N 5 A1JTU CGA O1A sing N N 6 A1JTU CGA CBA sing N N 7 A1JTU CBA CAA sing N N 8 A1JTU CAD C3D sing N N 9 A1JTU CMD C2D sing N N 10 A1JTU C3D C2D doub N N 11 A1JTU C3D C4D sing N N 12 A1JTU C2D C1D sing N N 13 A1JTU C4D CHA doub N N 14 A1JTU C4D ND sing N N 15 A1JTU CHA C1A sing N N 16 A1JTU CAA C2A sing N N 17 A1JTU C1D ND doub N N 18 A1JTU C1D CHD sing N N 19 A1JTU ND FE sing N N 20 A1JTU C1A C2A doub Y N 21 A1JTU C1A NA sing Y N 22 A1JTU CHD C4C doub N N 23 A1JTU C2A C3A sing Y N 24 A1JTU NA FE sing N N 25 A1JTU NA C4A sing Y N 26 A1JTU C4C NC sing N N 27 A1JTU C4C C3C sing N N 28 A1JTU C3A CMA sing N N 29 A1JTU C3A C4A doub Y N 30 A1JTU FE NC sing N N 31 A1JTU FE NB sing N N 32 A1JTU NC C1C sing N N 33 A1JTU C4A CHB sing N N 34 A1JTU OBC CAC doub N N 35 A1JTU CAC C3C sing N N 36 A1JTU C3C C2C doub N N 37 A1JTU C1C C2C sing N N 38 A1JTU C1C CHC doub N N 39 A1JTU C2C CMC sing N N 40 A1JTU CHB C1B doub N N 41 A1JTU NB C1B sing N N 42 A1JTU NB C4B doub N N 43 A1JTU C1B C2B sing N N 44 A1JTU CHC C4B sing N N 45 A1JTU C4B C3B sing N N 46 A1JTU C2B C3B doub N N 47 A1JTU C2B CMB sing N N 48 A1JTU C3B CAB sing N N 49 A1JTU CAB OBB doub N N 50 A1JTU CHA H1 sing N N 51 A1JTU CHB H2 sing N N 52 A1JTU CHC H3 sing N N 53 A1JTU CHD H4 sing N N 54 A1JTU CAA H5 sing N N 55 A1JTU CAA H6 sing N N 56 A1JTU CMA H7 sing N N 57 A1JTU CMA H8 sing N N 58 A1JTU CMA H9 sing N N 59 A1JTU CBA H10 sing N N 60 A1JTU CBA H11 sing N N 61 A1JTU O1A H12 sing N N 62 A1JTU CMB H13 sing N N 63 A1JTU CMB H14 sing N N 64 A1JTU CMB H15 sing N N 65 A1JTU CAB H16 sing N N 66 A1JTU CMC H17 sing N N 67 A1JTU CMC H18 sing N N 68 A1JTU CMC H19 sing N N 69 A1JTU CAC H20 sing N N 70 A1JTU CMD H21 sing N N 71 A1JTU CMD H22 sing N N 72 A1JTU CMD H23 sing N N 73 A1JTU CAD H24 sing N N 74 A1JTU CAD H25 sing N N 75 A1JTU CBD H26 sing N N 76 A1JTU CBD H27 sing N N 77 A1JTU O2D H28 sing N N 78 ALA N CA sing N N 79 ALA N H sing N N 80 ALA N H2 sing N N 81 ALA CA C sing N N 82 ALA CA CB sing N N 83 ALA CA HA sing N N 84 ALA C O doub N N 85 ALA C OXT sing N N 86 ALA CB HB1 sing N N 87 ALA CB HB2 sing N N 88 ALA CB HB3 sing N N 89 ALA OXT HXT sing N N 90 ARG N CA sing N N 91 ARG N H sing N N 92 ARG N H2 sing N N 93 ARG CA C sing N N 94 ARG CA CB sing N N 95 ARG CA HA sing N N 96 ARG C O doub N N 97 ARG C OXT sing N N 98 ARG CB CG sing N N 99 ARG CB HB2 sing N N 100 ARG CB HB3 sing N N 101 ARG CG CD sing N N 102 ARG CG HG2 sing N N 103 ARG CG HG3 sing N N 104 ARG CD NE sing N N 105 ARG CD HD2 sing N N 106 ARG CD HD3 sing N N 107 ARG NE CZ sing N N 108 ARG NE HE sing N N 109 ARG CZ NH1 sing N N 110 ARG CZ NH2 doub N N 111 ARG NH1 HH11 sing N N 112 ARG NH1 HH12 sing N N 113 ARG NH2 HH21 sing N N 114 ARG NH2 HH22 sing N N 115 ARG OXT HXT sing N N 116 ASN N CA sing N N 117 ASN N H sing N N 118 ASN N H2 sing N N 119 ASN CA C sing N N 120 ASN CA CB sing N N 121 ASN CA HA sing N N 122 ASN C O doub N N 123 ASN C OXT sing N N 124 ASN CB CG sing N N 125 ASN CB HB2 sing N N 126 ASN CB HB3 sing N N 127 ASN CG OD1 doub N N 128 ASN CG ND2 sing N N 129 ASN ND2 HD21 sing N N 130 ASN ND2 HD22 sing N N 131 ASN OXT HXT sing N N 132 ASP N CA sing N N 133 ASP N H sing N N 134 ASP N H2 sing N N 135 ASP CA C sing N N 136 ASP CA CB sing N N 137 ASP CA HA sing N N 138 ASP C O doub N N 139 ASP C OXT sing N N 140 ASP CB CG sing N N 141 ASP CB HB2 sing N N 142 ASP CB HB3 sing N N 143 ASP CG OD1 doub N N 144 ASP CG OD2 sing N N 145 ASP OD2 HD2 sing N N 146 ASP OXT HXT sing N N 147 GLN N CA sing N N 148 GLN N H sing N N 149 GLN N H2 sing N N 150 GLN CA C sing N N 151 GLN CA CB sing N N 152 GLN CA HA sing N N 153 GLN C O doub N N 154 GLN C OXT sing N N 155 GLN CB CG sing N N 156 GLN CB HB2 sing N N 157 GLN CB HB3 sing N N 158 GLN CG CD sing N N 159 GLN CG HG2 sing N N 160 GLN CG HG3 sing N N 161 GLN CD OE1 doub N N 162 GLN CD NE2 sing N N 163 GLN NE2 HE21 sing N N 164 GLN NE2 HE22 sing N N 165 GLN OXT HXT sing N N 166 GLU N CA sing N N 167 GLU N H sing N N 168 GLU N H2 sing N N 169 GLU CA C sing N N 170 GLU CA CB sing N N 171 GLU CA HA sing N N 172 GLU C O doub N N 173 GLU C OXT sing N N 174 GLU CB CG sing N N 175 GLU CB HB2 sing N N 176 GLU CB HB3 sing N N 177 GLU CG CD sing N N 178 GLU CG HG2 sing N N 179 GLU CG HG3 sing N N 180 GLU CD OE1 doub N N 181 GLU CD OE2 sing N N 182 GLU OE2 HE2 sing N N 183 GLU OXT HXT sing N N 184 GLY N CA sing N N 185 GLY N H sing N N 186 GLY N H2 sing N N 187 GLY CA C sing N N 188 GLY CA HA2 sing N N 189 GLY CA HA3 sing N N 190 GLY C O doub N N 191 GLY C OXT sing N N 192 GLY OXT HXT sing N N 193 HIS N CA sing N N 194 HIS N H sing N N 195 HIS N H2 sing N N 196 HIS CA C sing N N 197 HIS CA CB sing N N 198 HIS CA HA sing N N 199 HIS C O doub N N 200 HIS C OXT sing N N 201 HIS CB CG sing N N 202 HIS CB HB2 sing N N 203 HIS CB HB3 sing N N 204 HIS CG ND1 sing Y N 205 HIS CG CD2 doub Y N 206 HIS ND1 CE1 doub Y N 207 HIS ND1 HD1 sing N N 208 HIS CD2 NE2 sing Y N 209 HIS CD2 HD2 sing N N 210 HIS CE1 NE2 sing Y N 211 HIS CE1 HE1 sing N N 212 HIS NE2 HE2 sing N N 213 HIS OXT HXT sing N N 214 HOH O H1 sing N N 215 HOH O H2 sing N N 216 LEU N CA sing N N 217 LEU N H sing N N 218 LEU N H2 sing N N 219 LEU CA C sing N N 220 LEU CA CB sing N N 221 LEU CA HA sing N N 222 LEU C O doub N N 223 LEU C OXT sing N N 224 LEU CB CG sing N N 225 LEU CB HB2 sing N N 226 LEU CB HB3 sing N N 227 LEU CG CD1 sing N N 228 LEU CG CD2 sing N N 229 LEU CG HG sing N N 230 LEU CD1 HD11 sing N N 231 LEU CD1 HD12 sing N N 232 LEU CD1 HD13 sing N N 233 LEU CD2 HD21 sing N N 234 LEU CD2 HD22 sing N N 235 LEU CD2 HD23 sing N N 236 LEU OXT HXT sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 MET N CA sing N N 262 MET N H sing N N 263 MET N H2 sing N N 264 MET CA C sing N N 265 MET CA CB sing N N 266 MET CA HA sing N N 267 MET C O doub N N 268 MET C OXT sing N N 269 MET CB CG sing N N 270 MET CB HB2 sing N N 271 MET CB HB3 sing N N 272 MET CG SD sing N N 273 MET CG HG2 sing N N 274 MET CG HG3 sing N N 275 MET SD CE sing N N 276 MET CE HE1 sing N N 277 MET CE HE2 sing N N 278 MET CE HE3 sing N N 279 MET OXT HXT sing N N 280 PRO N CA sing N N 281 PRO N CD sing N N 282 PRO N H sing N N 283 PRO CA C sing N N 284 PRO CA CB sing N N 285 PRO CA HA sing N N 286 PRO C O doub N N 287 PRO C OXT sing N N 288 PRO CB CG sing N N 289 PRO CB HB2 sing N N 290 PRO CB HB3 sing N N 291 PRO CG CD sing N N 292 PRO CG HG2 sing N N 293 PRO CG HG3 sing N N 294 PRO CD HD2 sing N N 295 PRO CD HD3 sing N N 296 PRO OXT HXT sing N N 297 SER N CA sing N N 298 SER N H sing N N 299 SER N H2 sing N N 300 SER CA C sing N N 301 SER CA CB sing N N 302 SER CA HA sing N N 303 SER C O doub N N 304 SER C OXT sing N N 305 SER CB OG sing N N 306 SER CB HB2 sing N N 307 SER CB HB3 sing N N 308 SER OG HG sing N N 309 SER OXT HXT sing N N 310 THR N CA sing N N 311 THR N H sing N N 312 THR N H2 sing N N 313 THR CA C sing N N 314 THR CA CB sing N N 315 THR CA HA sing N N 316 THR C O doub N N 317 THR C OXT sing N N 318 THR CB OG1 sing N N 319 THR CB CG2 sing N N 320 THR CB HB sing N N 321 THR OG1 HG1 sing N N 322 THR CG2 HG21 sing N N 323 THR CG2 HG22 sing N N 324 THR CG2 HG23 sing N N 325 THR OXT HXT sing N N 326 TYR N CA sing N N 327 TYR N H sing N N 328 TYR N H2 sing N N 329 TYR CA C sing N N 330 TYR CA CB sing N N 331 TYR CA HA sing N N 332 TYR C O doub N N 333 TYR C OXT sing N N 334 TYR CB CG sing N N 335 TYR CB HB2 sing N N 336 TYR CB HB3 sing N N 337 TYR CG CD1 doub Y N 338 TYR CG CD2 sing Y N 339 TYR CD1 CE1 sing Y N 340 TYR CD1 HD1 sing N N 341 TYR CD2 CE2 doub Y N 342 TYR CD2 HD2 sing N N 343 TYR CE1 CZ doub Y N 344 TYR CE1 HE1 sing N N 345 TYR CE2 CZ sing Y N 346 TYR CE2 HE2 sing N N 347 TYR CZ OH sing N N 348 TYR OH HH sing N N 349 TYR OXT HXT sing N N 350 VAL N CA sing N N 351 VAL N H sing N N 352 VAL N H2 sing N N 353 VAL CA C sing N N 354 VAL CA CB sing N N 355 VAL CA HA sing N N 356 VAL C O doub N N 357 VAL C OXT sing N N 358 VAL CB CG1 sing N N 359 VAL CB CG2 sing N N 360 VAL CB HB sing N N 361 VAL CG1 HG11 sing N N 362 VAL CG1 HG12 sing N N 363 VAL CG1 HG13 sing N N 364 VAL CG2 HG21 sing N N 365 VAL CG2 HG22 sing N N 366 VAL CG2 HG23 sing N N 367 VAL OXT HXT sing N N 368 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/W003449/1 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9SY9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012305 _atom_sites.fract_transf_matrix[1][2] 0.007104 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014208 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016402 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL ? ? ? ? ? ? ? ? ? ? ? FE 26 26 11.7738 4.7611 7.3600 0.3072 3.5235 15.3535 2.3054 76.8805 1.2939 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0421 # loop_ #