data_9T28 # _entry.id 9T28 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.408 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9T28 pdb_00009t28 10.2210/pdb9t28/pdb WWPDB D_1292150820 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-12-10 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9T28 _pdbx_database_status.recvd_initial_deposition_date 2025-10-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 5 _pdbx_contact_author.email frank.vondelft@cmd.ox.ac.uk _pdbx_contact_author.name_first Frank _pdbx_contact_author.name_last 'von Delft' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0378-0017 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fairhead, M.' 1 0000-0001-5361-3933 'Wiggers, H.' 2 0000-0001-9531-6566 'Strain-Damerell, C.' 3 ? 'Ye, M.' 4 0000-0001-6324-4238 'Mackinnon, S.R.' 5 0000-0002-6816-244X 'Pinkas, D.' 6 ? 'MacLean, E.M.' 7 0000-0003-1680-4292 'Koekemoer, L.' 8 0000-0001-9226-9127 'Bowesman-Jones, H.' 9 ? 'Damerell, D.' 10 ? 'Krojer, T.' 11 0000-0003-0661-0814 'Arrowsmith, C.H.' 12 ? 'Edwards, A.' 13 ? 'Bountra, C.' 14 ? 'Yue, W.' 15 ? 'Burgess-Brown, N.' 16 ? 'Marsden, B.' 17 0000-0002-1937-4091 'von Delft, F.' 18 0000-0003-0378-0017 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'WspR response regulator with crystallization epitope mutations G306D:G308D' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fairhead, M.' 1 0000-0001-5361-3933 primary 'Wiggers, H.' 2 0000-0001-9531-6566 primary 'Strain-Damerell, C.' 3 ? primary 'Ye, M.' 4 0000-0001-6324-4238 primary 'Mackinnon, S.R.' 5 0000-0002-6816-244X primary 'Pinkas, D.' 6 ? primary 'MacLean, E.M.' 7 0000-0003-1680-4292 primary 'Koekemoer, L.' 8 0000-0001-9226-9127 primary 'Bowesman-Jones, H.' 9 ? primary 'Damerell, D.' 10 ? primary 'Krojer, T.' 11 0000-0003-0661-0814 primary 'Arrowsmith, C.H.' 12 ? primary 'Edwards, A.' 13 ? primary 'Bountra, C.' 14 ? primary 'Yue, W.' 15 ? primary 'Burgess-Brown, N.' 16 ? primary 'Marsden, B.' 17 0000-0002-1937-4091 primary 'von Delft, F.' 18 0000-0003-0378-0017 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'diguanylate cyclase' 18621.812 1 2.7.7.65 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 74 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAAR YGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPDGDGQTFRVLIEMADQALYQAKNN GRNQVGLM ; _entity_poly.pdbx_seq_one_letter_code_can ;HMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAAR YGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPDGDGQTFRVLIEMADQALYQAKNN GRNQVGLM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 ASN n 1 4 SER n 1 5 ASP n 1 6 GLY n 1 7 LEU n 1 8 THR n 1 9 GLY n 1 10 LEU n 1 11 SER n 1 12 ASN n 1 13 ARG n 1 14 ARG n 1 15 HIS n 1 16 PHE n 1 17 ASP n 1 18 GLU n 1 19 TYR n 1 20 LEU n 1 21 GLU n 1 22 MET n 1 23 GLU n 1 24 TRP n 1 25 ARG n 1 26 ARG n 1 27 SER n 1 28 LEU n 1 29 ARG n 1 30 GLU n 1 31 GLN n 1 32 SER n 1 33 GLN n 1 34 LEU n 1 35 SER n 1 36 LEU n 1 37 LEU n 1 38 MET n 1 39 ILE n 1 40 ASP n 1 41 VAL n 1 42 ASP n 1 43 TYR n 1 44 PHE n 1 45 LYS n 1 46 SER n 1 47 TYR n 1 48 ASN n 1 49 ASP n 1 50 THR n 1 51 PHE n 1 52 GLY n 1 53 HIS n 1 54 VAL n 1 55 ALA n 1 56 GLY n 1 57 ASP n 1 58 GLU n 1 59 ALA n 1 60 LEU n 1 61 ARG n 1 62 GLN n 1 63 VAL n 1 64 ALA n 1 65 GLY n 1 66 ALA n 1 67 ILE n 1 68 ARG n 1 69 GLU n 1 70 GLY n 1 71 CYS n 1 72 SER n 1 73 ARG n 1 74 SER n 1 75 SER n 1 76 ASP n 1 77 LEU n 1 78 ALA n 1 79 ALA n 1 80 ARG n 1 81 TYR n 1 82 GLY n 1 83 GLY n 1 84 GLU n 1 85 GLU n 1 86 PHE n 1 87 ALA n 1 88 MET n 1 89 VAL n 1 90 LEU n 1 91 PRO n 1 92 GLY n 1 93 THR n 1 94 SER n 1 95 PRO n 1 96 GLY n 1 97 GLY n 1 98 ALA n 1 99 ARG n 1 100 LEU n 1 101 LEU n 1 102 ALA n 1 103 GLU n 1 104 LYS n 1 105 VAL n 1 106 ARG n 1 107 ARG n 1 108 THR n 1 109 VAL n 1 110 GLU n 1 111 SER n 1 112 LEU n 1 113 GLN n 1 114 ILE n 1 115 SER n 1 116 HIS n 1 117 ASP n 1 118 GLN n 1 119 PRO n 1 120 ARG n 1 121 PRO n 1 122 GLY n 1 123 SER n 1 124 HIS n 1 125 LEU n 1 126 THR n 1 127 VAL n 1 128 SER n 1 129 ILE n 1 130 GLY n 1 131 VAL n 1 132 SER n 1 133 THR n 1 134 LEU n 1 135 VAL n 1 136 PRO n 1 137 ASP n 1 138 GLY n 1 139 ASP n 1 140 GLY n 1 141 GLN n 1 142 THR n 1 143 PHE n 1 144 ARG n 1 145 VAL n 1 146 LEU n 1 147 ILE n 1 148 GLU n 1 149 MET n 1 150 ALA n 1 151 ASP n 1 152 GLN n 1 153 ALA n 1 154 LEU n 1 155 TYR n 1 156 GLN n 1 157 ALA n 1 158 LYS n 1 159 ASN n 1 160 ASN n 1 161 GLY n 1 162 ARG n 1 163 ASN n 1 164 GLN n 1 165 VAL n 1 166 GLY n 1 167 LEU n 1 168 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 168 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'wspR, PA3702' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 170 170 HIS HIS A . n A 1 2 MET 2 171 171 MET MET A . n A 1 3 ASN 3 172 172 ASN ASN A . n A 1 4 SER 4 173 173 SER SER A . n A 1 5 ASP 5 174 174 ASP ASP A . n A 1 6 GLY 6 175 175 GLY GLY A . n A 1 7 LEU 7 176 176 LEU LEU A . n A 1 8 THR 8 177 177 THR THR A . n A 1 9 GLY 9 178 178 GLY GLY A . n A 1 10 LEU 10 179 179 LEU LEU A . n A 1 11 SER 11 180 180 SER SER A . n A 1 12 ASN 12 181 181 ASN ASN A . n A 1 13 ARG 13 182 182 ARG ARG A . n A 1 14 ARG 14 183 183 ARG ARG A . n A 1 15 HIS 15 184 184 HIS HIS A . n A 1 16 PHE 16 185 185 PHE PHE A . n A 1 17 ASP 17 186 186 ASP ASP A . n A 1 18 GLU 18 187 187 GLU GLU A . n A 1 19 TYR 19 188 188 TYR TYR A . n A 1 20 LEU 20 189 189 LEU LEU A . n A 1 21 GLU 21 190 190 GLU GLU A . n A 1 22 MET 22 191 191 MET MET A . n A 1 23 GLU 23 192 192 GLU GLU A . n A 1 24 TRP 24 193 193 TRP TRP A . n A 1 25 ARG 25 194 194 ARG ARG A . n A 1 26 ARG 26 195 195 ARG ARG A . n A 1 27 SER 27 196 196 SER SER A . n A 1 28 LEU 28 197 197 LEU LEU A . n A 1 29 ARG 29 198 198 ARG ARG A . n A 1 30 GLU 30 199 199 GLU GLU A . n A 1 31 GLN 31 200 200 GLN GLN A . n A 1 32 SER 32 201 201 SER SER A . n A 1 33 GLN 33 202 202 GLN GLN A . n A 1 34 LEU 34 203 203 LEU LEU A . n A 1 35 SER 35 204 204 SER SER A . n A 1 36 LEU 36 205 205 LEU LEU A . n A 1 37 LEU 37 206 206 LEU LEU A . n A 1 38 MET 38 207 207 MET MET A . n A 1 39 ILE 39 208 208 ILE ILE A . n A 1 40 ASP 40 209 209 ASP ASP A . n A 1 41 VAL 41 210 210 VAL VAL A . n A 1 42 ASP 42 211 211 ASP ASP A . n A 1 43 TYR 43 212 212 TYR TYR A . n A 1 44 PHE 44 213 213 PHE PHE A . n A 1 45 LYS 45 214 214 LYS LYS A . n A 1 46 SER 46 215 215 SER SER A . n A 1 47 TYR 47 216 216 TYR TYR A . n A 1 48 ASN 48 217 217 ASN ASN A . n A 1 49 ASP 49 218 218 ASP ASP A . n A 1 50 THR 50 219 219 THR THR A . n A 1 51 PHE 51 220 220 PHE PHE A . n A 1 52 GLY 52 221 221 GLY GLY A . n A 1 53 HIS 53 222 222 HIS HIS A . n A 1 54 VAL 54 223 223 VAL VAL A . n A 1 55 ALA 55 224 224 ALA ALA A . n A 1 56 GLY 56 225 225 GLY GLY A . n A 1 57 ASP 57 226 226 ASP ASP A . n A 1 58 GLU 58 227 227 GLU GLU A . n A 1 59 ALA 59 228 228 ALA ALA A . n A 1 60 LEU 60 229 229 LEU LEU A . n A 1 61 ARG 61 230 230 ARG ARG A . n A 1 62 GLN 62 231 231 GLN GLN A . n A 1 63 VAL 63 232 232 VAL VAL A . n A 1 64 ALA 64 233 233 ALA ALA A . n A 1 65 GLY 65 234 234 GLY GLY A . n A 1 66 ALA 66 235 235 ALA ALA A . n A 1 67 ILE 67 236 236 ILE ILE A . n A 1 68 ARG 68 237 237 ARG ARG A . n A 1 69 GLU 69 238 238 GLU GLU A . n A 1 70 GLY 70 239 239 GLY GLY A . n A 1 71 CYS 71 240 240 CYS CYS A . n A 1 72 SER 72 241 241 SER SER A . n A 1 73 ARG 73 242 242 ARG ARG A . n A 1 74 SER 74 243 243 SER SER A . n A 1 75 SER 75 244 244 SER SER A . n A 1 76 ASP 76 245 245 ASP ASP A . n A 1 77 LEU 77 246 246 LEU LEU A . n A 1 78 ALA 78 247 247 ALA ALA A . n A 1 79 ALA 79 248 248 ALA ALA A . n A 1 80 ARG 80 249 249 ARG ARG A . n A 1 81 TYR 81 250 250 TYR TYR A . n A 1 82 GLY 82 251 251 GLY GLY A . n A 1 83 GLY 83 252 252 GLY GLY A . n A 1 84 GLU 84 253 253 GLU GLU A . n A 1 85 GLU 85 254 254 GLU GLU A . n A 1 86 PHE 86 255 255 PHE PHE A . n A 1 87 ALA 87 256 256 ALA ALA A . n A 1 88 MET 88 257 257 MET MET A . n A 1 89 VAL 89 258 258 VAL VAL A . n A 1 90 LEU 90 259 259 LEU LEU A . n A 1 91 PRO 91 260 260 PRO PRO A . n A 1 92 GLY 92 261 261 GLY GLY A . n A 1 93 THR 93 262 262 THR THR A . n A 1 94 SER 94 263 263 SER SER A . n A 1 95 PRO 95 264 264 PRO PRO A . n A 1 96 GLY 96 265 265 GLY GLY A . n A 1 97 GLY 97 266 266 GLY GLY A . n A 1 98 ALA 98 267 267 ALA ALA A . n A 1 99 ARG 99 268 268 ARG ARG A . n A 1 100 LEU 100 269 269 LEU LEU A . n A 1 101 LEU 101 270 270 LEU LEU A . n A 1 102 ALA 102 271 271 ALA ALA A . n A 1 103 GLU 103 272 272 GLU GLU A . n A 1 104 LYS 104 273 273 LYS LYS A . n A 1 105 VAL 105 274 274 VAL VAL A . n A 1 106 ARG 106 275 275 ARG ARG A . n A 1 107 ARG 107 276 276 ARG ARG A . n A 1 108 THR 108 277 277 THR THR A . n A 1 109 VAL 109 278 278 VAL VAL A . n A 1 110 GLU 110 279 279 GLU GLU A . n A 1 111 SER 111 280 280 SER SER A . n A 1 112 LEU 112 281 281 LEU LEU A . n A 1 113 GLN 113 282 282 GLN GLN A . n A 1 114 ILE 114 283 283 ILE ILE A . n A 1 115 SER 115 284 284 SER SER A . n A 1 116 HIS 116 285 285 HIS HIS A . n A 1 117 ASP 117 286 286 ASP ASP A . n A 1 118 GLN 118 287 287 GLN GLN A . n A 1 119 PRO 119 288 288 PRO PRO A . n A 1 120 ARG 120 289 289 ARG ARG A . n A 1 121 PRO 121 290 290 PRO PRO A . n A 1 122 GLY 122 291 291 GLY GLY A . n A 1 123 SER 123 292 292 SER SER A . n A 1 124 HIS 124 293 293 HIS HIS A . n A 1 125 LEU 125 294 294 LEU LEU A . n A 1 126 THR 126 295 295 THR THR A . n A 1 127 VAL 127 296 296 VAL VAL A . n A 1 128 SER 128 297 297 SER SER A . n A 1 129 ILE 129 298 298 ILE ILE A . n A 1 130 GLY 130 299 299 GLY GLY A . n A 1 131 VAL 131 300 300 VAL VAL A . n A 1 132 SER 132 301 301 SER SER A . n A 1 133 THR 133 302 302 THR THR A . n A 1 134 LEU 134 303 303 LEU LEU A . n A 1 135 VAL 135 304 304 VAL VAL A . n A 1 136 PRO 136 305 305 PRO PRO A . n A 1 137 ASP 137 306 306 ASP ASP A . n A 1 138 GLY 138 307 307 GLY GLY A . n A 1 139 ASP 139 308 308 ASP ASP A . n A 1 140 GLY 140 309 309 GLY GLY A . n A 1 141 GLN 141 310 310 GLN GLN A . n A 1 142 THR 142 311 311 THR THR A . n A 1 143 PHE 143 312 312 PHE PHE A . n A 1 144 ARG 144 313 313 ARG ARG A . n A 1 145 VAL 145 314 314 VAL VAL A . n A 1 146 LEU 146 315 315 LEU LEU A . n A 1 147 ILE 147 316 316 ILE ILE A . n A 1 148 GLU 148 317 317 GLU GLU A . n A 1 149 MET 149 318 318 MET MET A . n A 1 150 ALA 150 319 319 ALA ALA A . n A 1 151 ASP 151 320 320 ASP ASP A . n A 1 152 GLN 152 321 321 GLN GLN A . n A 1 153 ALA 153 322 322 ALA ALA A . n A 1 154 LEU 154 323 323 LEU LEU A . n A 1 155 TYR 155 324 324 TYR TYR A . n A 1 156 GLN 156 325 325 GLN GLN A . n A 1 157 ALA 157 326 326 ALA ALA A . n A 1 158 LYS 158 327 327 LYS LYS A . n A 1 159 ASN 159 328 328 ASN ASN A . n A 1 160 ASN 160 329 329 ASN ASN A . n A 1 161 GLY 161 330 330 GLY GLY A . n A 1 162 ARG 162 331 331 ARG ARG A . n A 1 163 ASN 163 332 332 ASN ASN A . n A 1 164 GLN 164 333 333 GLN GLN A . n A 1 165 VAL 165 334 334 VAL VAL A . n A 1 166 GLY 166 335 335 GLY GLY A . n A 1 167 LEU 167 336 336 LEU LEU A . n A 1 168 MET 168 337 337 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 3 HOH 1 501 138 HOH HOH A . C 3 HOH 2 502 91 HOH HOH A . C 3 HOH 3 503 15 HOH HOH A . C 3 HOH 4 504 81 HOH HOH A . C 3 HOH 5 505 79 HOH HOH A . C 3 HOH 6 506 59 HOH HOH A . C 3 HOH 7 507 61 HOH HOH A . C 3 HOH 8 508 49 HOH HOH A . C 3 HOH 9 509 5 HOH HOH A . C 3 HOH 10 510 26 HOH HOH A . C 3 HOH 11 511 4 HOH HOH A . C 3 HOH 12 512 51 HOH HOH A . C 3 HOH 13 513 6 HOH HOH A . C 3 HOH 14 514 112 HOH HOH A . C 3 HOH 15 515 97 HOH HOH A . C 3 HOH 16 516 120 HOH HOH A . C 3 HOH 17 517 96 HOH HOH A . C 3 HOH 18 518 40 HOH HOH A . C 3 HOH 19 519 13 HOH HOH A . C 3 HOH 20 520 7 HOH HOH A . C 3 HOH 21 521 100 HOH HOH A . C 3 HOH 22 522 28 HOH HOH A . C 3 HOH 23 523 32 HOH HOH A . C 3 HOH 24 524 119 HOH HOH A . C 3 HOH 25 525 2 HOH HOH A . C 3 HOH 26 526 39 HOH HOH A . C 3 HOH 27 527 104 HOH HOH A . C 3 HOH 28 528 10 HOH HOH A . C 3 HOH 29 529 121 HOH HOH A . C 3 HOH 30 530 14 HOH HOH A . C 3 HOH 31 531 27 HOH HOH A . C 3 HOH 32 532 101 HOH HOH A . C 3 HOH 33 533 74 HOH HOH A . C 3 HOH 34 534 128 HOH HOH A . C 3 HOH 35 535 3 HOH HOH A . C 3 HOH 36 536 22 HOH HOH A . C 3 HOH 37 537 37 HOH HOH A . C 3 HOH 38 538 44 HOH HOH A . C 3 HOH 39 539 35 HOH HOH A . C 3 HOH 40 540 65 HOH HOH A . C 3 HOH 41 541 58 HOH HOH A . C 3 HOH 42 542 69 HOH HOH A . C 3 HOH 43 543 54 HOH HOH A . C 3 HOH 44 544 16 HOH HOH A . C 3 HOH 45 545 106 HOH HOH A . C 3 HOH 46 546 66 HOH HOH A . C 3 HOH 47 547 76 HOH HOH A . C 3 HOH 48 548 141 HOH HOH A . C 3 HOH 49 549 34 HOH HOH A . C 3 HOH 50 550 56 HOH HOH A . C 3 HOH 51 551 1 HOH HOH A . C 3 HOH 52 552 11 HOH HOH A . C 3 HOH 53 553 150 HOH HOH A . C 3 HOH 54 554 75 HOH HOH A . C 3 HOH 55 555 98 HOH HOH A . C 3 HOH 56 556 43 HOH HOH A . C 3 HOH 57 557 84 HOH HOH A . C 3 HOH 58 558 169 HOH HOH A . C 3 HOH 59 559 17 HOH HOH A . C 3 HOH 60 560 12 HOH HOH A . C 3 HOH 61 561 23 HOH HOH A . C 3 HOH 62 562 90 HOH HOH A . C 3 HOH 63 563 129 HOH HOH A . C 3 HOH 64 564 126 HOH HOH A . C 3 HOH 65 565 167 HOH HOH A . C 3 HOH 66 566 33 HOH HOH A . C 3 HOH 67 567 122 HOH HOH A . C 3 HOH 68 568 86 HOH HOH A . C 3 HOH 69 569 144 HOH HOH A . C 3 HOH 70 570 143 HOH HOH A . C 3 HOH 71 571 109 HOH HOH A . C 3 HOH 72 572 57 HOH HOH A . C 3 HOH 73 573 38 HOH HOH A . C 3 HOH 74 574 72 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0430 (refmacat 0.4.105)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9T28 _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.12 _cell.length_a_esd ? _cell.length_b 45.4 _cell.length_b_esd ? _cell.length_c 85.23 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9T28 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9T28 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 30.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2M lithium sulfate 25% PEG3350 0.1M bis-tris pH 6.5 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91739 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91739 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9T28 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.2 _reflns.d_resolution_low 42.615 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 37725 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 89.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.021 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.20 _reflns_shell.d_res_low 1.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1400 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.829 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.410 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.035 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.445 _refine.B_iso_max ? _refine.B_iso_mean 17.801 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.954 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9T28 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.330 _refine.ls_d_res_low 42.615 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30751 _refine.ls_number_reflns_R_free 1504 _refine.ls_number_reflns_R_work 29247 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.605 _refine.ls_percent_reflns_R_free 4.891 _refine.ls_R_factor_all 0.166 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2133 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1639 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.067 _refine.pdbx_overall_ESU_R_Free 0.065 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.371 _refine.overall_SU_ML 0.043 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.330 _refine_hist.d_res_low 42.615 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 1383 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1304 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 1412 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.003 0.016 1302 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.801 1.820 1918 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.771 1.762 2983 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.133 5.000 185 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.751 5.000 15 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 11.558 10.000 239 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 16.453 10.000 72 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.098 0.200 203 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1789 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 357 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.234 0.200 295 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.172 0.200 1191 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 722 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 790 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.133 0.200 71 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.157 0.200 23 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 56 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.128 0.200 11 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 4.661 1.535 716 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 4.628 1.536 716 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 6.543 2.761 909 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 6.549 2.764 910 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 7.019 1.926 696 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 7.015 1.934 693 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 9.886 3.373 1009 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 9.886 3.382 1004 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 13.309 19.358 1649 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 12.931 19.127 1636 ? r_lrange_other ? ? ? 'X-RAY DIFFRACTION' ? 3.778 3.000 2714 ? r_rigid_bond_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.330 1.365 2264 . 104 1978 91.9611 . 0.270 . . 0.269 . . . . . 0.254 . . . . . 20 . 0.955 0.937 0.293 'X-RAY DIFFRACTION' 1.365 1.402 2194 . 117 2058 99.1340 . 0.224 . . 0.223 . . . . . 0.200 . . . . . 20 . 0.971 0.960 0.252 'X-RAY DIFFRACTION' 1.402 1.442 2148 . 112 2002 98.4171 . 0.200 . . 0.198 . . . . . 0.174 . . . . . 20 . 0.976 0.964 0.231 'X-RAY DIFFRACTION' 1.442 1.487 2101 . 124 1964 99.3812 . 0.169 . . 0.165 . . . . . 0.139 . . . . . 20 . 0.983 0.958 0.242 'X-RAY DIFFRACTION' 1.487 1.536 2039 . 104 1918 99.1663 . 0.148 . . 0.144 . . . . . 0.122 . . . . . 20 . 0.987 0.971 0.212 'X-RAY DIFFRACTION' 1.536 1.589 1935 . 88 1826 98.9147 . 0.143 . . 0.138 . . . . . 0.117 . . . . . 20 . 0.988 0.964 0.236 'X-RAY DIFFRACTION' 1.589 1.649 1906 . 91 1806 99.5278 . 0.134 . . 0.130 . . . . . 0.111 . . . . . 20 . 0.989 0.974 0.210 'X-RAY DIFFRACTION' 1.649 1.716 1844 . 87 1728 98.4273 . 0.136 . . 0.132 . . . . . 0.115 . . . . . 20 . 0.989 0.967 0.228 'X-RAY DIFFRACTION' 1.716 1.793 1759 . 80 1675 99.7726 . 0.135 . . 0.131 . . . . . 0.116 . . . . . 20 . 0.989 0.964 0.223 'X-RAY DIFFRACTION' 1.793 1.880 1685 . 68 1613 99.7626 . 0.141 . . 0.139 . . . . . 0.125 . . . . . 20 . 0.988 0.976 0.193 'X-RAY DIFFRACTION' 1.880 1.981 1621 . 78 1534 99.4448 . 0.147 . . 0.144 . . . . . 0.131 . . . . . 20 . 0.988 0.972 0.204 'X-RAY DIFFRACTION' 1.981 2.101 1521 . 81 1437 99.8028 . 0.150 . . 0.148 . . . . . 0.139 . . . . . 20 . 0.987 0.979 0.187 'X-RAY DIFFRACTION' 2.101 2.246 1437 . 75 1347 98.9562 . 0.157 . . 0.154 . . . . . 0.149 . . . . . 20 . 0.986 0.974 0.198 'X-RAY DIFFRACTION' 2.246 2.425 1358 . 59 1271 97.9381 . 0.158 . . 0.157 . . . . . 0.152 . . . . . 20 . 0.984 0.980 0.191 'X-RAY DIFFRACTION' 2.425 2.656 1232 . 58 1171 99.7565 . 0.167 . . 0.165 . . . . . 0.168 . . . . . 20 . 0.983 0.972 0.211 'X-RAY DIFFRACTION' 2.656 2.968 1135 . 52 1083 100.0000 . 0.175 . . 0.172 . . . . . 0.178 . . . . . 20 . 0.981 0.968 0.235 'X-RAY DIFFRACTION' 2.968 3.425 1025 . 38 983 99.6098 . 0.177 . . 0.177 . . . . . 0.188 . . . . . 20 . 0.980 0.981 0.176 'X-RAY DIFFRACTION' 3.425 4.188 862 . 38 810 98.3759 . 0.168 . . 0.165 . . . . . 0.182 . . . . . 20 . 0.983 0.972 0.213 'X-RAY DIFFRACTION' 4.188 5.894 692 . 30 638 96.5318 . 0.189 . . 0.188 . . . . . 0.217 . . . . . 20 . 0.983 0.973 0.221 'X-RAY DIFFRACTION' 5.894 42.615 428 . 20 405 99.2991 . 0.190 . . 0.187 . . . . . 0.219 . . . . . 20 . 0.968 0.937 0.268 # _struct.entry_id 9T28 _struct.title 'WspR response regulator with crystallization epitope mutations G306D:G308D' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9T28 _struct_keywords.text 'crystal epitopes, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9HXT9_PSEAE _struct_ref.pdbx_db_accession Q9HXT9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARY GGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNG RNQVGLM ; _struct_ref.pdbx_align_begin 171 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9T28 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 168 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HXT9 _struct_ref_seq.db_align_beg 171 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 337 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 171 _struct_ref_seq.pdbx_auth_seq_align_end 337 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9T28 HIS A 1 ? UNP Q9HXT9 ? ? 'expression tag' 170 1 1 9T28 ASP A 137 ? UNP Q9HXT9 GLY 306 'engineered mutation' 306 2 1 9T28 ASP A 139 ? UNP Q9HXT9 GLY 308 'engineered mutation' 308 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 170 ? 1 MORE -12 ? 1 'SSA (A^2)' 8290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 12 ? GLN A 31 ? ASN A 181 GLN A 200 1 ? 20 HELX_P HELX_P2 AA2 TYR A 43 ? GLY A 52 ? TYR A 212 GLY A 221 1 ? 10 HELX_P HELX_P3 AA3 GLY A 52 ? GLU A 69 ? GLY A 221 GLU A 238 1 ? 18 HELX_P HELX_P4 AA4 SER A 94 ? LEU A 112 ? SER A 263 LEU A 281 1 ? 19 HELX_P HELX_P5 AA5 ASP A 139 ? THR A 142 ? ASP A 308 THR A 311 5 ? 4 HELX_P HELX_P6 AA6 PHE A 143 ? ASN A 160 ? PHE A 312 ASN A 329 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 118 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 287 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 119 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 288 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 77 ? ARG A 80 ? LEU A 246 ARG A 249 AA1 2 GLU A 85 ? PRO A 91 ? GLU A 254 PRO A 260 AA1 3 LEU A 34 ? VAL A 41 ? LEU A 203 VAL A 210 AA1 4 VAL A 127 ? LEU A 134 ? VAL A 296 LEU A 303 AA1 5 VAL A 165 ? GLY A 166 ? VAL A 334 GLY A 335 AA2 1 SER A 115 ? HIS A 116 ? SER A 284 HIS A 285 AA2 2 SER A 123 ? HIS A 124 ? SER A 292 HIS A 293 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 79 ? N ALA A 248 O ALA A 87 ? O ALA A 256 AA1 2 3 O LEU A 90 ? O LEU A 259 N SER A 35 ? N SER A 204 AA1 3 4 N MET A 38 ? N MET A 207 O GLY A 130 ? O GLY A 299 AA1 4 5 N ILE A 129 ? N ILE A 298 O GLY A 166 ? O GLY A 335 AA2 1 2 N HIS A 116 ? N HIS A 285 O SER A 123 ? O SER A 292 # _pdbx_entry_details.entry_id 9T28 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 241 ? A -147.21 -27.93 2 1 SER A 241 ? B -148.95 -48.17 3 1 ARG A 331 ? ? 66.83 -179.73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'The Structural Genomics Consortium (SGC)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3I5B _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9T28 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.029308 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022026 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011733 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0555 # loop_ # loop_ #