data_9TB1 # _entry.id 9TB1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.411 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9TB1 pdb_00009tb1 10.2210/pdb9tb1/pdb WWPDB D_1292152284 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-03-25 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9TB1 _pdbx_database_status.recvd_initial_deposition_date 2025-11-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email jerry.heng@imperial.ac.uk _pdbx_contact_author.name_first Jerry _pdbx_contact_author.name_last Heng _pdbx_contact_author.name_mi 'Y. Y.' _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2659-5500 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mitchell, H.M.' 1 0000-0001-6715-0116 'Nocek, B.' 2 0000-0001-8257-0792 'Guinn, E.J.' 3 0000-0002-9974-3458 'Heng, J.Y.Y.' 4 0000-0003-2659-5500 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystallization and 1.6 angstrom resolution crystal structure of an acylated GLP-1/GIP analogue peptide.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X26001937 _citation.pdbx_database_id_PubMed 41841205 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mitchell, H.M.' 1 0000-0001-6715-0116 primary 'Nocek, B.' 2 0000-0001-8257-0792 primary 'Guinn, E.J.' 3 0000-0002-9974-3458 primary 'Heng, J.Y.Y.' 4 0000-0003-2659-5500 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn GG-353 4211.586 1 ? ? ? ? 2 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 2 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'Y(AIB)EGT(9DT)TSDYSI(2ML)LD(ORN)KAQ(AIB)EFI(DGL)YLIEGGPSSGAPPPS' _entity_poly.pdbx_seq_one_letter_code_can YAEGTFTSDYSILLDAKAQAEFIEYLIEGGPSSGAPPPS _entity_poly.pdbx_strand_id B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TRIETHYLENE GLYCOL' PGE 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 AIB n 1 3 GLU n 1 4 GLY n 1 5 THR n 1 6 9DT n 1 7 THR n 1 8 SER n 1 9 ASP n 1 10 TYR n 1 11 SER n 1 12 ILE n 1 13 2ML n 1 14 LEU n 1 15 ASP n 1 16 ORN n 1 17 LYS n 1 18 ALA n 1 19 GLN n 1 20 AIB n 1 21 GLU n 1 22 PHE n 1 23 ILE n 1 24 DGL n 1 25 TYR n 1 26 LEU n 1 27 ILE n 1 28 GLU n 1 29 GLY n 1 30 GLY n 1 31 PRO n 1 32 SER n 1 33 SER n 1 34 GLY n 1 35 ALA n 1 36 PRO n 1 37 PRO n 1 38 PRO n 1 39 SER n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 5 'Heloderma suspectum cinctum' ? 537493 ? 1 2 sample 6 39 'Heloderma suspectum cinctum' ? 537493 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2ML 'L-peptide linking' n 2-METHYLLEUCINE ? 'C7 H15 N O2' 145.199 9DT 'L-peptide linking' n '(2~{S})-2-azanyl-3-(2-fluorophenyl)-2-methyl-propanoic acid' ? 'C10 H12 F N O2' 197.206 AIB 'L-peptide linking' n 'ALPHA-AMINOISOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DGL 'D-peptide linking' . 'D-GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 ORN 'L-peptide linking' n L-ornithine ? 'C5 H12 N2 O2' 132.161 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR B . n A 1 2 AIB 2 2 2 AIB AIB B . n A 1 3 GLU 3 3 3 GLU GLU B . n A 1 4 GLY 4 4 4 GLY GLY B . n A 1 5 THR 5 5 5 THR THR B . n A 1 6 9DT 6 6 6 9DT DRG B . n A 1 7 THR 7 7 7 THR THR B . n A 1 8 SER 8 8 8 SER SER B . n A 1 9 ASP 9 9 9 ASP ASP B . n A 1 10 TYR 10 10 10 TYR TYR B . n A 1 11 SER 11 11 11 SER SER B . n A 1 12 ILE 12 12 12 ILE ILE B . n A 1 13 2ML 13 13 13 2ML 2ML B . n A 1 14 LEU 14 14 14 LEU LEU B . n A 1 15 ASP 15 15 15 ASP ASP B . n A 1 16 ORN 16 16 16 ORN ORN B . n A 1 17 LYS 17 17 17 LYS LYS B . n A 1 18 ALA 18 18 18 ALA ALA B . n A 1 19 GLN 19 19 19 GLN GLN B . n A 1 20 AIB 20 20 20 AIB AIB B . n A 1 21 GLU 21 21 21 GLU GLU B . n A 1 22 PHE 22 22 22 PHE PHE B . n A 1 23 ILE 23 23 23 ILE ILE B . n A 1 24 DGL 24 24 24 DGL DGL B . n A 1 25 TYR 25 25 25 TYR TYR B . n A 1 26 LEU 26 26 26 LEU LEU B . n A 1 27 ILE 27 27 27 ILE ILE B . n A 1 28 GLU 28 28 28 GLU GLU B . n A 1 29 GLY 29 29 29 GLY GLY B . n A 1 30 GLY 30 30 30 GLY GLY B . n A 1 31 PRO 31 31 31 PRO PRO B . n A 1 32 SER 32 32 32 SER SER B . n A 1 33 SER 33 33 ? ? ? B . n A 1 34 GLY 34 34 ? ? ? B . n A 1 35 ALA 35 35 ? ? ? B . n A 1 36 PRO 36 36 ? ? ? B . n A 1 37 PRO 37 37 ? ? ? B . n A 1 38 PRO 38 38 ? ? ? B . n A 1 39 SER 39 39 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PGE 1 101 103 PGE PGE B . C 2 PGE 1 102 104 PGE PGE B . D 3 HOH 1 201 14 HOH HOH B . D 3 HOH 2 202 5 HOH HOH B . D 3 HOH 3 203 6 HOH HOH B . D 3 HOH 4 204 2 HOH HOH B . D 3 HOH 5 205 1 HOH HOH B . D 3 HOH 6 206 7 HOH HOH B . D 3 HOH 7 207 3 HOH HOH B . D 3 HOH 8 208 11 HOH HOH B . D 3 HOH 9 209 17 HOH HOH B . D 3 HOH 10 210 8 HOH HOH B . D 3 HOH 11 211 4 HOH HOH B . D 3 HOH 12 212 18 HOH HOH B . D 3 HOH 13 213 9 HOH HOH B . D 3 HOH 14 214 13 HOH HOH B . D 3 HOH 15 215 16 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MrBUMP ? ? ? . ? 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? BUCCANEER ? ? ? . ? 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . ? 6 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0430 (refmacat 0.4.105)' ? 7 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9TB1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.66 _cell.length_a_esd ? _cell.length_b 64.66 _cell.length_b_esd ? _cell.length_c 11.417 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9TB1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9TB1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49 _exptl_crystal.description 'Acicular clusters, approximately 500 microns in length' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M sodium citrate pH 4.5, 0.2M ammonium phosphate monobasic, 0.1M ammonium sulfate, 32% v/v PEG 400' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-02-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.62 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.62 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9TB1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.59 _reflns.d_resolution_low 64.66 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6855 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.77 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.318 _reflns.pdbx_Rpim_I_all 0.169 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.269 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 8.71 64.66 ? 9.8 ? ? ? ? 62 ? ? ? ? ? ? ? ? ? ? ? 4.0 0.96 ? ? 0.098 0.054 ? 1 ? 0.997 ? ? 99.4 ? 0.081 ? ? ? ? ? ? ? ? ? 1.59 1.62 ? 0.7 ? ? ? ? 353 ? ? ? ? ? ? ? ? ? ? ? 6.3 0.73 ? ? 3.480 1.850 ? 2 ? 0.173 ? ? 100.0 ? 2.936 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -1.187 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -1.187 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 2.373 _refine.B_iso_max ? _refine.B_iso_mean 24.604 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.955 _refine.correlation_coeff_Fo_to_Fc_free 0.940 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9TB1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.590 _refine.ls_d_res_low 64.660 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6852 _refine.ls_number_reflns_R_free 674 _refine.ls_number_reflns_R_work 6178 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.767 _refine.ls_percent_reflns_R_free 9.837 _refine.ls_R_factor_all 0.212 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2450 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2083 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.101 _refine.pdbx_overall_ESU_R_Free 0.089 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.704 _refine.overall_SU_ML 0.093 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.590 _refine_hist.d_res_low 64.660 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 290 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 255 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.012 291 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.003 0.016 278 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 2.050 1.851 394 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.776 1.724 647 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.681 5.000 35 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.141 10.000 44 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.807 10.000 11 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.105 0.200 40 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 298 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 52 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.218 0.200 67 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.155 0.200 224 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.197 0.200 153 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.095 0.200 139 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.156 0.200 13 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.234 0.200 10 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.160 0.200 41 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.148 0.200 9 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 6.069 2.187 131 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 5.903 2.180 131 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 9.279 3.884 163 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 9.335 3.927 164 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 7.351 2.618 160 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 7.329 2.637 161 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 10.577 4.581 229 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 10.554 4.599 230 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 20.065 33.097 360 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 17.740 29.871 353 ? r_lrange_other ? ? ? 'X-RAY DIFFRACTION' ? 6.172 3.000 569 ? r_rigid_bond_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.590 1.631 527 . 51 468 98.4820 . 0.432 . . 0.428 . . . . . 0.431 . . . . . 20 . 0.886 0.707 0.471 'X-RAY DIFFRACTION' 1.631 1.676 454 . 49 405 100.0000 . 0.391 . . 0.395 . . . . . 0.393 . . . . . 20 . 0.909 0.890 0.357 'X-RAY DIFFRACTION' 1.676 1.725 449 . 47 402 100.0000 . 0.336 . . 0.334 . . . . . 0.332 . . . . . 20 . 0.937 0.907 0.358 'X-RAY DIFFRACTION' 1.725 1.778 455 . 33 422 100.0000 . 0.311 . . 0.305 . . . . . 0.293 . . . . . 20 . 0.960 0.911 0.385 'X-RAY DIFFRACTION' 1.778 1.836 458 . 35 423 100.0000 . 0.294 . . 0.290 . . . . . 0.275 . . . . . 20 . 0.959 0.909 0.362 'X-RAY DIFFRACTION' 1.836 1.900 448 . 49 399 100.0000 . 0.239 . . 0.238 . . . . . 0.225 . . . . . 20 . 0.977 0.975 0.244 'X-RAY DIFFRACTION' 1.900 1.972 395 . 36 357 99.4937 . 0.246 . . 0.239 . . . . . 0.233 . . . . . 20 . 0.961 0.920 0.320 'X-RAY DIFFRACTION' 1.972 2.052 400 . 33 367 100.0000 . 0.215 . . 0.210 . . . . . 0.194 . . . . . 20 . 0.971 0.951 0.274 'X-RAY DIFFRACTION' 2.052 2.143 384 . 29 355 100.0000 . 0.182 . . 0.176 . . . . . 0.156 . . . . . 20 . 0.981 0.938 0.266 'X-RAY DIFFRACTION' 2.143 2.248 382 . 50 332 100.0000 . 0.162 . . 0.156 . . . . . 0.138 . . . . . 20 . 0.987 0.982 0.198 'X-RAY DIFFRACTION' 2.248 2.369 349 . 41 308 100.0000 . 0.186 . . 0.180 . . . . . 0.161 . . . . . 20 . 0.976 0.958 0.234 'X-RAY DIFFRACTION' 2.369 2.513 312 . 24 288 100.0000 . 0.141 . . 0.137 . . . . . 0.122 . . . . . 20 . 0.988 0.974 0.200 'X-RAY DIFFRACTION' 2.513 2.686 332 . 34 298 100.0000 . 0.163 . . 0.157 . . . . . 0.142 . . . . . 20 . 0.986 0.969 0.209 'X-RAY DIFFRACTION' 2.686 2.901 312 . 42 266 98.7179 . 0.162 . . 0.155 . . . . . 0.148 . . . . . 20 . 0.987 0.983 0.202 'X-RAY DIFFRACTION' 2.901 3.177 264 . 20 242 99.2424 . 0.174 . . 0.170 . . . . . 0.156 . . . . . 20 . 0.985 0.966 0.238 'X-RAY DIFFRACTION' 3.177 3.551 256 . 32 224 100.0000 . 0.174 . . 0.170 . . . . . 0.167 . . . . . 20 . 0.982 0.978 0.205 'X-RAY DIFFRACTION' 3.551 4.098 236 . 26 210 100.0000 . 0.154 . . 0.151 . . . . . 0.159 . . . . . 20 . 0.985 0.986 0.178 'X-RAY DIFFRACTION' 4.098 5.014 191 . 26 165 100.0000 . 0.180 . . 0.176 . . . . . 0.187 . . . . . 20 . 0.982 0.976 0.207 'X-RAY DIFFRACTION' 5.014 7.070 159 . 8 151 100.0000 . 0.226 . . 0.224 . . . . . 0.238 . . . . . 20 . 0.965 0.969 0.247 'X-RAY DIFFRACTION' 7.070 64.660 105 . 9 96 100.0000 . 0.275 . . 0.267 . . . . . 0.380 . . . . . 20 . 0.950 0.902 0.386 # _struct.entry_id 9TB1 _struct.title 'Crystal structure of an acylated GLP-1/GIP analogue peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9TB1 _struct_keywords.text 'GLP-1, GIP, agonist, analogue, HORMONE' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 9TB1 9TB1 ? 1 ? 1 2 PDB 9TB1 9TB1 ? 1 ? 6 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9TB1 B 1 ? 5 ? 9TB1 1 ? 5 ? 1 5 2 2 9TB1 B 6 ? 39 ? 9TB1 6 ? 39 ? 6 39 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 490 ? 1 MORE 6 ? 1 'SSA (A^2)' 3340 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id AIB _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id AIB _struct_conf.beg_auth_asym_id B _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id B _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TYR 1 C ? ? ? 1_555 A AIB 2 N ? ? B TYR 1 B AIB 2 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A AIB 2 C ? ? ? 1_555 A GLU 3 N ? ? B AIB 2 B GLU 3 1_555 ? ? ? ? ? ? ? 1.353 ? ? covale3 covale both ? A THR 5 C ? ? ? 1_555 A 9DT 6 N ? ? B THR 5 B 9DT 6 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale4 covale both ? A 9DT 6 C ? ? ? 1_555 A THR 7 N ? ? B 9DT 6 B THR 7 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale5 covale both ? A ILE 12 C ? ? ? 1_555 A 2ML 13 N ? ? B ILE 12 B 2ML 13 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale6 covale both ? A 2ML 13 C ? ? ? 1_555 A LEU 14 N ? ? B 2ML 13 B LEU 14 1_555 ? ? ? ? ? ? ? 1.352 ? ? covale7 covale both ? A ASP 15 C ? ? ? 1_555 A ORN 16 N ? ? B ASP 15 B ORN 16 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale8 covale both ? A ORN 16 C ? ? ? 1_555 A LYS 17 N ? ? B ORN 16 B LYS 17 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale9 covale both ? A GLN 19 C ? ? ? 1_555 A AIB 20 N ? ? B GLN 19 B AIB 20 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale10 covale both ? A AIB 20 C ? ? ? 1_555 A GLU 21 N ? ? B AIB 20 B GLU 21 1_555 ? ? ? ? ? ? ? 1.369 ? ? covale11 covale both ? A ILE 23 C ? ? ? 1_555 A DGL 24 N ? ? B ILE 23 B DGL 24 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale12 covale both ? A DGL 24 C ? ? ? 1_555 A TYR 25 N ? ? B DGL 24 B TYR 25 1_555 ? ? ? ? ? ? ? 1.363 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 AIB A 2 ? . . . . AIB B 2 ? 1_555 . . . . . . . ALA 1 AIB Methylation 'Named protein modification' 2 9DT A 6 ? . . . . 9DT B 6 ? 1_555 . . . . . . . PHE 1 9DT Fluorination 'Named protein modification' 3 9DT A 6 ? . . . . 9DT B 6 ? 1_555 . . . . . . . PHE 2 9DT Methylation 'Named protein modification' 4 2ML A 13 ? . . . . 2ML B 13 ? 1_555 . . . . . . . LEU 1 2ML Methylation 'Named protein modification' 5 ORN A 16 ? . . . . ORN B 16 ? 1_555 . . . . . . . ? 1 ORN Ornithine 'Named protein modification' 6 AIB A 20 ? . . . . AIB B 20 ? 1_555 . . . . . . . ALA 1 AIB Methylation 'Named protein modification' # _pdbx_entry_details.entry_id 9TB1 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B SER 33 ? A SER 33 2 1 Y 1 B GLY 34 ? A GLY 34 3 1 Y 1 B ALA 35 ? A ALA 35 4 1 Y 1 B PRO 36 ? A PRO 36 5 1 Y 1 B PRO 37 ? A PRO 37 6 1 Y 1 B PRO 38 ? A PRO 38 7 1 Y 1 B SER 39 ? A SER 39 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2ML N N N N 1 2ML CA C N S 2 2ML CB1 C N N 3 2ML CB2 C N N 4 2ML CG C N N 5 2ML CD1 C N N 6 2ML CD2 C N N 7 2ML C C N N 8 2ML O O N N 9 2ML OXT O N N 10 2ML H2 H N N 11 2ML H H N N 12 2ML HB11 H N N 13 2ML HB12 H N N 14 2ML HB21 H N N 15 2ML HB22 H N N 16 2ML HB23 H N N 17 2ML HG H N N 18 2ML HD11 H N N 19 2ML HD12 H N N 20 2ML HD13 H N N 21 2ML HD21 H N N 22 2ML HD22 H N N 23 2ML HD23 H N N 24 2ML HXT H N N 25 9DT C C N N 26 9DT CA C N S 27 9DT C39 C N N 28 9DT C40 C N N 29 9DT C41 C Y N 30 9DT C42 C Y N 31 9DT C43 C Y N 32 9DT C44 C Y N 33 9DT C45 C Y N 34 9DT C46 C Y N 35 9DT F47 F N N 36 9DT N N N N 37 9DT O O N N 38 9DT H1 H N N 39 9DT H3 H N N 40 9DT H4 H N N 41 9DT H5 H N N 42 9DT H6 H N N 43 9DT H7 H N N 44 9DT H8 H N N 45 9DT H9 H N N 46 9DT H10 H N N 47 9DT H H N N 48 9DT H2 H N N 49 9DT OXT O N N 50 9DT HXT H N N 51 AIB N N N N 52 AIB CA C N N 53 AIB C C N N 54 AIB O O N N 55 AIB OXT O N N 56 AIB CB1 C N N 57 AIB CB2 C N N 58 AIB H H N N 59 AIB H2 H N N 60 AIB HXT H N N 61 AIB HB11 H N N 62 AIB HB12 H N N 63 AIB HB13 H N N 64 AIB HB21 H N N 65 AIB HB22 H N N 66 AIB HB23 H N N 67 ALA N N N N 68 ALA CA C N S 69 ALA C C N N 70 ALA O O N N 71 ALA CB C N N 72 ALA OXT O N N 73 ALA H H N N 74 ALA H2 H N N 75 ALA HA H N N 76 ALA HB1 H N N 77 ALA HB2 H N N 78 ALA HB3 H N N 79 ALA HXT H N N 80 ASP N N N N 81 ASP CA C N S 82 ASP C C N N 83 ASP O O N N 84 ASP CB C N N 85 ASP CG C N N 86 ASP OD1 O N N 87 ASP OD2 O N N 88 ASP OXT O N N 89 ASP H H N N 90 ASP H2 H N N 91 ASP HA H N N 92 ASP HB2 H N N 93 ASP HB3 H N N 94 ASP HD2 H N N 95 ASP HXT H N N 96 DGL N N N N 97 DGL CA C N R 98 DGL C C N N 99 DGL O O N N 100 DGL CB C N N 101 DGL CG C N N 102 DGL CD C N N 103 DGL OE1 O N N 104 DGL OE2 O N N 105 DGL OXT O N N 106 DGL H H N N 107 DGL H2 H N N 108 DGL HA H N N 109 DGL HB2 H N N 110 DGL HB3 H N N 111 DGL HG2 H N N 112 DGL HG3 H N N 113 DGL HE2 H N N 114 DGL HXT H N N 115 GLN N N N N 116 GLN CA C N S 117 GLN C C N N 118 GLN O O N N 119 GLN CB C N N 120 GLN CG C N N 121 GLN CD C N N 122 GLN OE1 O N N 123 GLN NE2 N N N 124 GLN OXT O N N 125 GLN H H N N 126 GLN H2 H N N 127 GLN HA H N N 128 GLN HB2 H N N 129 GLN HB3 H N N 130 GLN HG2 H N N 131 GLN HG3 H N N 132 GLN HE21 H N N 133 GLN HE22 H N N 134 GLN HXT H N N 135 GLU N N N N 136 GLU CA C N S 137 GLU C C N N 138 GLU O O N N 139 GLU CB C N N 140 GLU CG C N N 141 GLU CD C N N 142 GLU OE1 O N N 143 GLU OE2 O N N 144 GLU OXT O N N 145 GLU H H N N 146 GLU H2 H N N 147 GLU HA H N N 148 GLU HB2 H N N 149 GLU HB3 H N N 150 GLU HG2 H N N 151 GLU HG3 H N N 152 GLU HE2 H N N 153 GLU HXT H N N 154 GLY N N N N 155 GLY CA C N N 156 GLY C C N N 157 GLY O O N N 158 GLY OXT O N N 159 GLY H H N N 160 GLY H2 H N N 161 GLY HA2 H N N 162 GLY HA3 H N N 163 GLY HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 ORN N N N N 237 ORN CA C N S 238 ORN CB C N N 239 ORN CG C N N 240 ORN CD C N N 241 ORN NE N N N 242 ORN C C N N 243 ORN O O N N 244 ORN OXT O N N 245 ORN H H N N 246 ORN H2 H N N 247 ORN HA H N N 248 ORN HB2 H N N 249 ORN HB3 H N N 250 ORN HG2 H N N 251 ORN HG3 H N N 252 ORN HD2 H N N 253 ORN HD3 H N N 254 ORN HE1 H N N 255 ORN HE2 H N N 256 ORN HXT H N N 257 PGE C1 C N N 258 PGE O1 O N N 259 PGE C2 C N N 260 PGE O2 O N N 261 PGE C3 C N N 262 PGE C4 C N N 263 PGE O4 O N N 264 PGE C6 C N N 265 PGE C5 C N N 266 PGE O3 O N N 267 PGE H1 H N N 268 PGE H12 H N N 269 PGE HO1 H N N 270 PGE H2 H N N 271 PGE H22 H N N 272 PGE H3 H N N 273 PGE H32 H N N 274 PGE H4 H N N 275 PGE H42 H N N 276 PGE HO4 H N N 277 PGE H6 H N N 278 PGE H62 H N N 279 PGE H5 H N N 280 PGE H52 H N N 281 PHE N N N N 282 PHE CA C N S 283 PHE C C N N 284 PHE O O N N 285 PHE CB C N N 286 PHE CG C Y N 287 PHE CD1 C Y N 288 PHE CD2 C Y N 289 PHE CE1 C Y N 290 PHE CE2 C Y N 291 PHE CZ C Y N 292 PHE OXT O N N 293 PHE H H N N 294 PHE H2 H N N 295 PHE HA H N N 296 PHE HB2 H N N 297 PHE HB3 H N N 298 PHE HD1 H N N 299 PHE HD2 H N N 300 PHE HE1 H N N 301 PHE HE2 H N N 302 PHE HZ H N N 303 PHE HXT H N N 304 PRO N N N N 305 PRO CA C N S 306 PRO C C N N 307 PRO O O N N 308 PRO CB C N N 309 PRO CG C N N 310 PRO CD C N N 311 PRO OXT O N N 312 PRO H H N N 313 PRO HA H N N 314 PRO HB2 H N N 315 PRO HB3 H N N 316 PRO HG2 H N N 317 PRO HG3 H N N 318 PRO HD2 H N N 319 PRO HD3 H N N 320 PRO HXT H N N 321 SER N N N N 322 SER CA C N S 323 SER C C N N 324 SER O O N N 325 SER CB C N N 326 SER OG O N N 327 SER OXT O N N 328 SER H H N N 329 SER H2 H N N 330 SER HA H N N 331 SER HB2 H N N 332 SER HB3 H N N 333 SER HG H N N 334 SER HXT H N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2ML N CA sing N N 1 2ML N H2 sing N N 2 2ML N H sing N N 3 2ML CA CB1 sing N N 4 2ML CA CB2 sing N N 5 2ML CA C sing N N 6 2ML CB1 CG sing N N 7 2ML CB1 HB11 sing N N 8 2ML CB1 HB12 sing N N 9 2ML CB2 HB21 sing N N 10 2ML CB2 HB22 sing N N 11 2ML CB2 HB23 sing N N 12 2ML CG CD1 sing N N 13 2ML CG CD2 sing N N 14 2ML CG HG sing N N 15 2ML CD1 HD11 sing N N 16 2ML CD1 HD12 sing N N 17 2ML CD1 HD13 sing N N 18 2ML CD2 HD21 sing N N 19 2ML CD2 HD22 sing N N 20 2ML CD2 HD23 sing N N 21 2ML C O doub N N 22 2ML C OXT sing N N 23 2ML OXT HXT sing N N 24 9DT O C doub N N 25 9DT C CA sing N N 26 9DT N CA sing N N 27 9DT CA C39 sing N N 28 9DT CA C40 sing N N 29 9DT C43 C42 doub Y N 30 9DT C43 C44 sing Y N 31 9DT C42 C41 sing Y N 32 9DT C44 C45 doub Y N 33 9DT C41 C40 sing N N 34 9DT C41 C46 doub Y N 35 9DT C45 C46 sing Y N 36 9DT C46 F47 sing N N 37 9DT C39 H1 sing N N 38 9DT C39 H3 sing N N 39 9DT C39 H4 sing N N 40 9DT C40 H5 sing N N 41 9DT C40 H6 sing N N 42 9DT C42 H7 sing N N 43 9DT C43 H8 sing N N 44 9DT C44 H9 sing N N 45 9DT C45 H10 sing N N 46 9DT N H sing N N 47 9DT N H2 sing N N 48 9DT C OXT sing N N 49 9DT OXT HXT sing N N 50 AIB N CA sing N N 51 AIB N H sing N N 52 AIB N H2 sing N N 53 AIB CA C sing N N 54 AIB CA CB1 sing N N 55 AIB CA CB2 sing N N 56 AIB C O doub N N 57 AIB C OXT sing N N 58 AIB OXT HXT sing N N 59 AIB CB1 HB11 sing N N 60 AIB CB1 HB12 sing N N 61 AIB CB1 HB13 sing N N 62 AIB CB2 HB21 sing N N 63 AIB CB2 HB22 sing N N 64 AIB CB2 HB23 sing N N 65 ALA N CA sing N N 66 ALA N H sing N N 67 ALA N H2 sing N N 68 ALA CA C sing N N 69 ALA CA CB sing N N 70 ALA CA HA sing N N 71 ALA C O doub N N 72 ALA C OXT sing N N 73 ALA CB HB1 sing N N 74 ALA CB HB2 sing N N 75 ALA CB HB3 sing N N 76 ALA OXT HXT sing N N 77 ASP N CA sing N N 78 ASP N H sing N N 79 ASP N H2 sing N N 80 ASP CA C sing N N 81 ASP CA CB sing N N 82 ASP CA HA sing N N 83 ASP C O doub N N 84 ASP C OXT sing N N 85 ASP CB CG sing N N 86 ASP CB HB2 sing N N 87 ASP CB HB3 sing N N 88 ASP CG OD1 doub N N 89 ASP CG OD2 sing N N 90 ASP OD2 HD2 sing N N 91 ASP OXT HXT sing N N 92 DGL N CA sing N N 93 DGL N H sing N N 94 DGL N H2 sing N N 95 DGL CA C sing N N 96 DGL CA CB sing N N 97 DGL CA HA sing N N 98 DGL C O doub N N 99 DGL C OXT sing N N 100 DGL CB CG sing N N 101 DGL CB HB2 sing N N 102 DGL CB HB3 sing N N 103 DGL CG CD sing N N 104 DGL CG HG2 sing N N 105 DGL CG HG3 sing N N 106 DGL CD OE1 doub N N 107 DGL CD OE2 sing N N 108 DGL OE2 HE2 sing N N 109 DGL OXT HXT sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 HOH O H1 sing N N 157 HOH O H2 sing N N 158 ILE N CA sing N N 159 ILE N H sing N N 160 ILE N H2 sing N N 161 ILE CA C sing N N 162 ILE CA CB sing N N 163 ILE CA HA sing N N 164 ILE C O doub N N 165 ILE C OXT sing N N 166 ILE CB CG1 sing N N 167 ILE CB CG2 sing N N 168 ILE CB HB sing N N 169 ILE CG1 CD1 sing N N 170 ILE CG1 HG12 sing N N 171 ILE CG1 HG13 sing N N 172 ILE CG2 HG21 sing N N 173 ILE CG2 HG22 sing N N 174 ILE CG2 HG23 sing N N 175 ILE CD1 HD11 sing N N 176 ILE CD1 HD12 sing N N 177 ILE CD1 HD13 sing N N 178 ILE OXT HXT sing N N 179 LEU N CA sing N N 180 LEU N H sing N N 181 LEU N H2 sing N N 182 LEU CA C sing N N 183 LEU CA CB sing N N 184 LEU CA HA sing N N 185 LEU C O doub N N 186 LEU C OXT sing N N 187 LEU CB CG sing N N 188 LEU CB HB2 sing N N 189 LEU CB HB3 sing N N 190 LEU CG CD1 sing N N 191 LEU CG CD2 sing N N 192 LEU CG HG sing N N 193 LEU CD1 HD11 sing N N 194 LEU CD1 HD12 sing N N 195 LEU CD1 HD13 sing N N 196 LEU CD2 HD21 sing N N 197 LEU CD2 HD22 sing N N 198 LEU CD2 HD23 sing N N 199 LEU OXT HXT sing N N 200 LYS N CA sing N N 201 LYS N H sing N N 202 LYS N H2 sing N N 203 LYS CA C sing N N 204 LYS CA CB sing N N 205 LYS CA HA sing N N 206 LYS C O doub N N 207 LYS C OXT sing N N 208 LYS CB CG sing N N 209 LYS CB HB2 sing N N 210 LYS CB HB3 sing N N 211 LYS CG CD sing N N 212 LYS CG HG2 sing N N 213 LYS CG HG3 sing N N 214 LYS CD CE sing N N 215 LYS CD HD2 sing N N 216 LYS CD HD3 sing N N 217 LYS CE NZ sing N N 218 LYS CE HE2 sing N N 219 LYS CE HE3 sing N N 220 LYS NZ HZ1 sing N N 221 LYS NZ HZ2 sing N N 222 LYS NZ HZ3 sing N N 223 LYS OXT HXT sing N N 224 ORN N CA sing N N 225 ORN N H sing N N 226 ORN N H2 sing N N 227 ORN CA CB sing N N 228 ORN CA C sing N N 229 ORN CA HA sing N N 230 ORN CB CG sing N N 231 ORN CB HB2 sing N N 232 ORN CB HB3 sing N N 233 ORN CG CD sing N N 234 ORN CG HG2 sing N N 235 ORN CG HG3 sing N N 236 ORN CD NE sing N N 237 ORN CD HD2 sing N N 238 ORN CD HD3 sing N N 239 ORN NE HE1 sing N N 240 ORN NE HE2 sing N N 241 ORN C O doub N N 242 ORN C OXT sing N N 243 ORN OXT HXT sing N N 244 PGE C1 O1 sing N N 245 PGE C1 C2 sing N N 246 PGE C1 H1 sing N N 247 PGE C1 H12 sing N N 248 PGE O1 HO1 sing N N 249 PGE C2 O2 sing N N 250 PGE C2 H2 sing N N 251 PGE C2 H22 sing N N 252 PGE O2 C3 sing N N 253 PGE C3 C4 sing N N 254 PGE C3 H3 sing N N 255 PGE C3 H32 sing N N 256 PGE C4 O3 sing N N 257 PGE C4 H4 sing N N 258 PGE C4 H42 sing N N 259 PGE O4 C6 sing N N 260 PGE O4 HO4 sing N N 261 PGE C6 C5 sing N N 262 PGE C6 H6 sing N N 263 PGE C6 H62 sing N N 264 PGE C5 O3 sing N N 265 PGE C5 H5 sing N N 266 PGE C5 H52 sing N N 267 PHE N CA sing N N 268 PHE N H sing N N 269 PHE N H2 sing N N 270 PHE CA C sing N N 271 PHE CA CB sing N N 272 PHE CA HA sing N N 273 PHE C O doub N N 274 PHE C OXT sing N N 275 PHE CB CG sing N N 276 PHE CB HB2 sing N N 277 PHE CB HB3 sing N N 278 PHE CG CD1 doub Y N 279 PHE CG CD2 sing Y N 280 PHE CD1 CE1 sing Y N 281 PHE CD1 HD1 sing N N 282 PHE CD2 CE2 doub Y N 283 PHE CD2 HD2 sing N N 284 PHE CE1 CZ doub Y N 285 PHE CE1 HE1 sing N N 286 PHE CE2 CZ sing Y N 287 PHE CE2 HE2 sing N N 288 PHE CZ HZ sing N N 289 PHE OXT HXT sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TYR N CA sing N N 337 TYR N H sing N N 338 TYR N H2 sing N N 339 TYR CA C sing N N 340 TYR CA CB sing N N 341 TYR CA HA sing N N 342 TYR C O doub N N 343 TYR C OXT sing N N 344 TYR CB CG sing N N 345 TYR CB HB2 sing N N 346 TYR CB HB3 sing N N 347 TYR CG CD1 doub Y N 348 TYR CG CD2 sing Y N 349 TYR CD1 CE1 sing Y N 350 TYR CD1 HD1 sing N N 351 TYR CD2 CE2 doub Y N 352 TYR CD2 HD2 sing N N 353 TYR CE1 CZ doub Y N 354 TYR CE1 HE1 sing N N 355 TYR CE2 CZ sing Y N 356 TYR CE2 HE2 sing N N 357 TYR CZ OH sing N N 358 TYR OH HH sing N N 359 TYR OXT HXT sing N N 360 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Engineering and Physical Sciences Research Council' 'United Kingdom' EP/T005556/1 1 'Engineering and Physical Sciences Research Council' 'United Kingdom' EP/T518207/1 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2QKH _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9TB1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015466 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015466 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.087589 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 F 9 9 3.5395 10.2825 2.6414 4.2944 1.5171 0.2615 1.0244 26.1476 0.2796 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 # loop_ # loop_ #