data_9TMQ # _entry.id 9TMQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9TMQ pdb_00009tmq 10.2210/pdb9tmq/pdb WWPDB D_1292152636 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-29 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9TMQ _pdbx_database_status.recvd_initial_deposition_date 2025-12-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email teemu.haikarainen@tuni.fi _pdbx_contact_author.name_first Teemu _pdbx_contact_author.name_last Haikarainen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8441-2517 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pollaniemi, A.' 1 ? 'Haikarainen, T.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Microbiol Spectr' ? ? 2165-0497 ? ? ? ? e0004926 e0004926 'Structural insights into multitargeting Mycobacterium tuberculosis Pkn kinases.' 2026 ? 10.1128/spectrum.00049-26 42446239 ? ? ? ? ? ? ? ? ? ? ? ? 1 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Towards automated crystallographic structure refinement with phenix.refine.' ? ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pollaniemi, A.' 1 0009-0001-5949-6122 primary 'Miao, Y.' 2 ? primary 'Laitila, L.' 3 ? primary 'Piippo, H.' 4 ? primary 'Hammaren, M.' 5 0000-0001-9076-8782 primary 'Parikka, M.' 6 ? primary 'Haikarainen, T.' 7 0000-0002-8441-2517 1 'Pollaniemi, A.' 8 ? 1 'Haikarainen, T.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase PknA' 30536.102 1 2.7.11.1 ? ? ? 2 non-polymer syn Lestaurtinib 439.463 1 ? ? ? ? 3 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDY GESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITD FGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPP DLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRP ; _entity_poly.pdbx_seq_one_letter_code_can ;SMSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDY GESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITD FGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPP DLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 Lestaurtinib 2V9 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 SER n 1 4 PRO n 1 5 ARG n 1 6 VAL n 1 7 GLY n 1 8 VAL n 1 9 THR n 1 10 LEU n 1 11 SER n 1 12 GLY n 1 13 ARG n 1 14 TYR n 1 15 ARG n 1 16 LEU n 1 17 GLN n 1 18 ARG n 1 19 LEU n 1 20 ILE n 1 21 ALA n 1 22 THR n 1 23 GLY n 1 24 GLY n 1 25 MET n 1 26 GLY n 1 27 GLN n 1 28 VAL n 1 29 TRP n 1 30 GLU n 1 31 ALA n 1 32 VAL n 1 33 ASP n 1 34 ASN n 1 35 ARG n 1 36 LEU n 1 37 GLY n 1 38 ARG n 1 39 ARG n 1 40 VAL n 1 41 ALA n 1 42 VAL n 1 43 LYS n 1 44 VAL n 1 45 LEU n 1 46 LYS n 1 47 SER n 1 48 GLU n 1 49 PHE n 1 50 SER n 1 51 SER n 1 52 ASP n 1 53 PRO n 1 54 GLU n 1 55 PHE n 1 56 ILE n 1 57 GLU n 1 58 ARG n 1 59 PHE n 1 60 ARG n 1 61 ALA n 1 62 GLU n 1 63 ALA n 1 64 ARG n 1 65 THR n 1 66 THR n 1 67 ALA n 1 68 MET n 1 69 LEU n 1 70 ASN n 1 71 HIS n 1 72 PRO n 1 73 GLY n 1 74 ILE n 1 75 ALA n 1 76 SER n 1 77 VAL n 1 78 HIS n 1 79 ASP n 1 80 TYR n 1 81 GLY n 1 82 GLU n 1 83 SER n 1 84 GLN n 1 85 MET n 1 86 ASN n 1 87 GLY n 1 88 GLU n 1 89 GLY n 1 90 ARG n 1 91 THR n 1 92 ALA n 1 93 TYR n 1 94 LEU n 1 95 VAL n 1 96 MET n 1 97 GLU n 1 98 LEU n 1 99 VAL n 1 100 ASN n 1 101 GLY n 1 102 GLU n 1 103 PRO n 1 104 LEU n 1 105 ASN n 1 106 SER n 1 107 VAL n 1 108 LEU n 1 109 LYS n 1 110 ARG n 1 111 THR n 1 112 GLY n 1 113 ARG n 1 114 LEU n 1 115 SER n 1 116 LEU n 1 117 ARG n 1 118 HIS n 1 119 ALA n 1 120 LEU n 1 121 ASP n 1 122 MET n 1 123 LEU n 1 124 GLU n 1 125 GLN n 1 126 THR n 1 127 GLY n 1 128 ARG n 1 129 ALA n 1 130 LEU n 1 131 GLN n 1 132 ILE n 1 133 ALA n 1 134 HIS n 1 135 ALA n 1 136 ALA n 1 137 GLY n 1 138 LEU n 1 139 VAL n 1 140 HIS n 1 141 ARG n 1 142 ASP n 1 143 VAL n 1 144 LYS n 1 145 PRO n 1 146 GLY n 1 147 ASN n 1 148 ILE n 1 149 LEU n 1 150 ILE n 1 151 THR n 1 152 PRO n 1 153 THR n 1 154 GLY n 1 155 GLN n 1 156 VAL n 1 157 LYS n 1 158 ILE n 1 159 THR n 1 160 ASP n 1 161 PHE n 1 162 GLY n 1 163 ILE n 1 164 ALA n 1 165 LYS n 1 166 ALA n 1 167 VAL n 1 168 ASP n 1 169 ALA n 1 170 ALA n 1 171 PRO n 1 172 VAL n 1 173 THR n 1 174 GLN n 1 175 THR n 1 176 GLY n 1 177 MET n 1 178 VAL n 1 179 MET n 1 180 GLY n 1 181 THR n 1 182 ALA n 1 183 GLN n 1 184 TYR n 1 185 ILE n 1 186 ALA n 1 187 PRO n 1 188 GLU n 1 189 GLN n 1 190 ALA n 1 191 LEU n 1 192 GLY n 1 193 HIS n 1 194 ASP n 1 195 ALA n 1 196 SER n 1 197 PRO n 1 198 ALA n 1 199 SER n 1 200 ASP n 1 201 VAL n 1 202 TYR n 1 203 SER n 1 204 LEU n 1 205 GLY n 1 206 VAL n 1 207 VAL n 1 208 GLY n 1 209 TYR n 1 210 GLU n 1 211 ALA n 1 212 VAL n 1 213 SER n 1 214 GLY n 1 215 LYS n 1 216 ARG n 1 217 PRO n 1 218 PHE n 1 219 ALA n 1 220 GLY n 1 221 ASP n 1 222 GLY n 1 223 ALA n 1 224 LEU n 1 225 THR n 1 226 VAL n 1 227 ALA n 1 228 MET n 1 229 LYS n 1 230 HIS n 1 231 ILE n 1 232 LYS n 1 233 GLU n 1 234 PRO n 1 235 PRO n 1 236 PRO n 1 237 PRO n 1 238 LEU n 1 239 PRO n 1 240 PRO n 1 241 ASP n 1 242 LEU n 1 243 PRO n 1 244 PRO n 1 245 ASN n 1 246 VAL n 1 247 ARG n 1 248 GLU n 1 249 LEU n 1 250 ILE n 1 251 GLU n 1 252 ILE n 1 253 THR n 1 254 LEU n 1 255 VAL n 1 256 LYS n 1 257 ASN n 1 258 PRO n 1 259 ALA n 1 260 MET n 1 261 ARG n 1 262 TYR n 1 263 ARG n 1 264 SER n 1 265 GLY n 1 266 GLY n 1 267 PRO n 1 268 PHE n 1 269 ALA n 1 270 ASP n 1 271 ALA n 1 272 VAL n 1 273 ALA n 1 274 ALA n 1 275 VAL n 1 276 ARG n 1 277 ALA n 1 278 GLY n 1 279 ARG n 1 280 ARG n 1 281 PRO n 1 282 PRO n 1 283 ARG n 1 284 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 284 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pknA, Rv0015c, MTCY10H4.15c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2V9 non-polymer . Lestaurtinib ;(5S,6S,8R)-6-hydroxy-6-(hydroxymethyl)-5-methyl-5,6,7,8-tetrahydro-13H-5,8-epoxy-4b,8a,14-triazadibenzo[b,h]cycloocta[1,2,3,4-jkl]cyclopenta[e]-as-indacen-13-one ; 'C26 H21 N3 O4' 439.463 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 SER 3 2 ? ? ? A . n A 1 4 PRO 4 3 3 PRO PRO A . n A 1 5 ARG 5 4 4 ARG ARG A . n A 1 6 VAL 6 5 5 VAL VAL A . n A 1 7 GLY 7 6 6 GLY GLY A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 THR 9 8 8 THR THR A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 SER 11 10 10 SER SER A . n A 1 12 GLY 12 11 11 GLY GLY A . n A 1 13 ARG 13 12 12 ARG ARG A . n A 1 14 TYR 14 13 13 TYR TYR A . n A 1 15 ARG 15 14 14 ARG ARG A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 ILE 20 19 19 ILE ILE A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 THR 22 21 21 THR THR A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 MET 25 24 24 MET MET A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 VAL 28 27 27 VAL VAL A . n A 1 29 TRP 29 28 28 TRP TRP A . n A 1 30 GLU 30 29 29 GLU GLU A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 VAL 32 31 31 VAL VAL A . n A 1 33 ASP 33 32 32 ASP ASP A . n A 1 34 ASN 34 33 33 ASN ASN A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 GLY 37 36 36 GLY GLY A . n A 1 38 ARG 38 37 37 ARG ARG A . n A 1 39 ARG 39 38 38 ARG ARG A . n A 1 40 VAL 40 39 39 VAL VAL A . n A 1 41 ALA 41 40 40 ALA ALA A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 PHE 49 48 48 PHE PHE A . n A 1 50 SER 50 49 49 SER SER A . n A 1 51 SER 51 50 50 SER SER A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 PHE 55 54 54 PHE PHE A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 GLU 57 56 56 GLU GLU A . n A 1 58 ARG 58 57 57 ARG ARG A . n A 1 59 PHE 59 58 58 PHE PHE A . n A 1 60 ARG 60 59 59 ARG ARG A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 ALA 63 62 62 ALA ALA A . n A 1 64 ARG 64 63 63 ARG ARG A . n A 1 65 THR 65 64 64 THR THR A . n A 1 66 THR 66 65 65 THR THR A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 MET 68 67 67 MET MET A . n A 1 69 LEU 69 68 68 LEU LEU A . n A 1 70 ASN 70 69 69 ASN ASN A . n A 1 71 HIS 71 70 70 HIS HIS A . n A 1 72 PRO 72 71 71 PRO PRO A . n A 1 73 GLY 73 72 72 GLY GLY A . n A 1 74 ILE 74 73 73 ILE ILE A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 VAL 77 76 76 VAL VAL A . n A 1 78 HIS 78 77 77 HIS HIS A . n A 1 79 ASP 79 78 78 ASP ASP A . n A 1 80 TYR 80 79 79 TYR TYR A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 GLU 82 81 81 GLU GLU A . n A 1 83 SER 83 82 82 SER SER A . n A 1 84 GLN 84 83 83 GLN GLN A . n A 1 85 MET 85 84 ? ? ? A . n A 1 86 ASN 86 85 ? ? ? A . n A 1 87 GLY 87 86 ? ? ? A . n A 1 88 GLU 88 87 ? ? ? A . n A 1 89 GLY 89 88 ? ? ? A . n A 1 90 ARG 90 89 89 ARG ARG A . n A 1 91 THR 91 90 90 THR THR A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 TYR 93 92 92 TYR TYR A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 VAL 95 94 94 VAL VAL A . n A 1 96 MET 96 95 95 MET MET A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 VAL 99 98 98 VAL VAL A . n A 1 100 ASN 100 99 99 ASN ASN A . n A 1 101 GLY 101 100 100 GLY GLY A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 PRO 103 102 102 PRO PRO A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 ASN 105 104 104 ASN ASN A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 ARG 110 109 109 ARG ARG A . n A 1 111 THR 111 110 110 THR THR A . n A 1 112 GLY 112 111 111 GLY GLY A . n A 1 113 ARG 113 112 112 ARG ARG A . n A 1 114 LEU 114 113 113 LEU LEU A . n A 1 115 SER 115 114 114 SER SER A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 ARG 117 116 116 ARG ARG A . n A 1 118 HIS 118 117 117 HIS HIS A . n A 1 119 ALA 119 118 118 ALA ALA A . n A 1 120 LEU 120 119 119 LEU LEU A . n A 1 121 ASP 121 120 120 ASP ASP A . n A 1 122 MET 122 121 121 MET MET A . n A 1 123 LEU 123 122 122 LEU LEU A . n A 1 124 GLU 124 123 123 GLU GLU A . n A 1 125 GLN 125 124 124 GLN GLN A . n A 1 126 THR 126 125 125 THR THR A . n A 1 127 GLY 127 126 126 GLY GLY A . n A 1 128 ARG 128 127 127 ARG ARG A . n A 1 129 ALA 129 128 128 ALA ALA A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 GLN 131 130 130 GLN GLN A . n A 1 132 ILE 132 131 131 ILE ILE A . n A 1 133 ALA 133 132 132 ALA ALA A . n A 1 134 HIS 134 133 133 HIS HIS A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 ALA 136 135 135 ALA ALA A . n A 1 137 GLY 137 136 136 GLY GLY A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 HIS 140 139 139 HIS HIS A . n A 1 141 ARG 141 140 140 ARG ARG A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 PRO 145 144 144 PRO PRO A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 ASN 147 146 146 ASN ASN A . n A 1 148 ILE 148 147 147 ILE ILE A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 ILE 150 149 149 ILE ILE A . n A 1 151 THR 151 150 150 THR THR A . n A 1 152 PRO 152 151 151 PRO PRO A . n A 1 153 THR 153 152 152 THR THR A . n A 1 154 GLY 154 153 153 GLY GLY A . n A 1 155 GLN 155 154 154 GLN GLN A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 LYS 157 156 156 LYS LYS A . n A 1 158 ILE 158 157 157 ILE ILE A . n A 1 159 THR 159 158 158 THR THR A . n A 1 160 ASP 160 159 159 ASP ASP A . n A 1 161 PHE 161 160 160 PHE PHE A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 ILE 163 162 ? ? ? A . n A 1 164 ALA 164 163 ? ? ? A . n A 1 165 LYS 165 164 ? ? ? A . n A 1 166 ALA 166 165 ? ? ? A . n A 1 167 VAL 167 166 ? ? ? A . n A 1 168 ASP 168 167 ? ? ? A . n A 1 169 ALA 169 168 ? ? ? A . n A 1 170 ALA 170 169 ? ? ? A . n A 1 171 PRO 171 170 ? ? ? A . n A 1 172 VAL 172 171 ? ? ? A . n A 1 173 THR 173 172 ? ? ? A . n A 1 174 GLN 174 173 ? ? ? A . n A 1 175 THR 175 174 ? ? ? A . n A 1 176 GLY 176 175 ? ? ? A . n A 1 177 MET 177 176 ? ? ? A . n A 1 178 VAL 178 177 ? ? ? A . n A 1 179 MET 179 178 ? ? ? A . n A 1 180 GLY 180 179 ? ? ? A . n A 1 181 THR 181 180 ? ? ? A . n A 1 182 ALA 182 181 181 ALA ALA A . n A 1 183 GLN 183 182 182 GLN GLN A . n A 1 184 TYR 184 183 183 TYR TYR A . n A 1 185 ILE 185 184 184 ILE ILE A . n A 1 186 ALA 186 185 185 ALA ALA A . n A 1 187 PRO 187 186 186 PRO PRO A . n A 1 188 GLU 188 187 187 GLU GLU A . n A 1 189 GLN 189 188 188 GLN GLN A . n A 1 190 ALA 190 189 189 ALA ALA A . n A 1 191 LEU 191 190 190 LEU LEU A . n A 1 192 GLY 192 191 191 GLY GLY A . n A 1 193 HIS 193 192 192 HIS HIS A . n A 1 194 ASP 194 193 193 ASP ASP A . n A 1 195 ALA 195 194 194 ALA ALA A . n A 1 196 SER 196 195 195 SER SER A . n A 1 197 PRO 197 196 196 PRO PRO A . n A 1 198 ALA 198 197 197 ALA ALA A . n A 1 199 SER 199 198 198 SER SER A . n A 1 200 ASP 200 199 199 ASP ASP A . n A 1 201 VAL 201 200 200 VAL VAL A . n A 1 202 TYR 202 201 201 TYR TYR A . n A 1 203 SER 203 202 202 SER SER A . n A 1 204 LEU 204 203 203 LEU LEU A . n A 1 205 GLY 205 204 204 GLY GLY A . n A 1 206 VAL 206 205 205 VAL VAL A . n A 1 207 VAL 207 206 206 VAL VAL A . n A 1 208 GLY 208 207 207 GLY GLY A . n A 1 209 TYR 209 208 208 TYR TYR A . n A 1 210 GLU 210 209 209 GLU GLU A . n A 1 211 ALA 211 210 210 ALA ALA A . n A 1 212 VAL 212 211 211 VAL VAL A . n A 1 213 SER 213 212 212 SER SER A . n A 1 214 GLY 214 213 213 GLY GLY A . n A 1 215 LYS 215 214 214 LYS LYS A . n A 1 216 ARG 216 215 215 ARG ARG A . n A 1 217 PRO 217 216 216 PRO PRO A . n A 1 218 PHE 218 217 217 PHE PHE A . n A 1 219 ALA 219 218 218 ALA ALA A . n A 1 220 GLY 220 219 219 GLY GLY A . n A 1 221 ASP 221 220 220 ASP ASP A . n A 1 222 GLY 222 221 221 GLY GLY A . n A 1 223 ALA 223 222 222 ALA ALA A . n A 1 224 LEU 224 223 223 LEU LEU A . n A 1 225 THR 225 224 224 THR THR A . n A 1 226 VAL 226 225 225 VAL VAL A . n A 1 227 ALA 227 226 226 ALA ALA A . n A 1 228 MET 228 227 227 MET MET A . n A 1 229 LYS 229 228 228 LYS LYS A . n A 1 230 HIS 230 229 229 HIS HIS A . n A 1 231 ILE 231 230 230 ILE ILE A . n A 1 232 LYS 232 231 231 LYS LYS A . n A 1 233 GLU 233 232 232 GLU GLU A . n A 1 234 PRO 234 233 233 PRO PRO A . n A 1 235 PRO 235 234 234 PRO PRO A . n A 1 236 PRO 236 235 235 PRO PRO A . n A 1 237 PRO 237 236 236 PRO PRO A . n A 1 238 LEU 238 237 237 LEU LEU A . n A 1 239 PRO 239 238 238 PRO PRO A . n A 1 240 PRO 240 239 239 PRO PRO A . n A 1 241 ASP 241 240 240 ASP ASP A . n A 1 242 LEU 242 241 241 LEU LEU A . n A 1 243 PRO 243 242 242 PRO PRO A . n A 1 244 PRO 244 243 243 PRO PRO A . n A 1 245 ASN 245 244 244 ASN ASN A . n A 1 246 VAL 246 245 245 VAL VAL A . n A 1 247 ARG 247 246 246 ARG ARG A . n A 1 248 GLU 248 247 247 GLU GLU A . n A 1 249 LEU 249 248 248 LEU LEU A . n A 1 250 ILE 250 249 249 ILE ILE A . n A 1 251 GLU 251 250 250 GLU GLU A . n A 1 252 ILE 252 251 251 ILE ILE A . n A 1 253 THR 253 252 252 THR THR A . n A 1 254 LEU 254 253 253 LEU LEU A . n A 1 255 VAL 255 254 254 VAL VAL A . n A 1 256 LYS 256 255 255 LYS LYS A . n A 1 257 ASN 257 256 256 ASN ASN A . n A 1 258 PRO 258 257 257 PRO PRO A . n A 1 259 ALA 259 258 258 ALA ALA A . n A 1 260 MET 260 259 259 MET MET A . n A 1 261 ARG 261 260 260 ARG ARG A . n A 1 262 TYR 262 261 261 TYR TYR A . n A 1 263 ARG 263 262 262 ARG ARG A . n A 1 264 SER 264 263 263 SER SER A . n A 1 265 GLY 265 264 264 GLY GLY A . n A 1 266 GLY 266 265 265 GLY GLY A . n A 1 267 PRO 267 266 266 PRO PRO A . n A 1 268 PHE 268 267 267 PHE PHE A . n A 1 269 ALA 269 268 268 ALA ALA A . n A 1 270 ASP 270 269 269 ASP ASP A . n A 1 271 ALA 271 270 270 ALA ALA A . n A 1 272 VAL 272 271 271 VAL VAL A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 ALA 274 273 273 ALA ALA A . n A 1 275 VAL 275 274 274 VAL VAL A . n A 1 276 ARG 276 275 275 ARG ARG A . n A 1 277 ALA 277 276 276 ALA ALA A . n A 1 278 GLY 278 277 277 GLY GLY A . n A 1 279 ARG 279 278 278 ARG ARG A . n A 1 280 ARG 280 279 279 ARG ARG A . n A 1 281 PRO 281 280 280 PRO PRO A . n A 1 282 PRO 282 281 281 PRO PRO A . n A 1 283 ARG 283 282 282 ARG ARG A . n A 1 284 PRO 284 283 283 PRO PRO A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 2V9 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 2V9 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 2V9 1 301 301 2V9 LIG A . C 3 HOH 1 401 16 HOH HOH A . C 3 HOH 2 402 9 HOH HOH A . C 3 HOH 3 403 4 HOH HOH A . C 3 HOH 4 404 5 HOH HOH A . C 3 HOH 5 405 28 HOH HOH A . C 3 HOH 6 406 3 HOH HOH A . C 3 HOH 7 407 26 HOH HOH A . C 3 HOH 8 408 13 HOH HOH A . C 3 HOH 9 409 20 HOH HOH A . C 3 HOH 10 410 12 HOH HOH A . C 3 HOH 11 411 32 HOH HOH A . C 3 HOH 12 412 35 HOH HOH A . C 3 HOH 13 413 22 HOH HOH A . C 3 HOH 14 414 6 HOH HOH A . C 3 HOH 15 415 27 HOH HOH A . C 3 HOH 16 416 11 HOH HOH A . C 3 HOH 17 417 18 HOH HOH A . C 3 HOH 18 418 24 HOH HOH A . C 3 HOH 19 419 2 HOH HOH A . C 3 HOH 20 420 10 HOH HOH A . C 3 HOH 21 421 34 HOH HOH A . C 3 HOH 22 422 25 HOH HOH A . C 3 HOH 23 423 31 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 4 ? CG ? A ARG 5 CG 2 1 Y 1 A ARG 4 ? CD ? A ARG 5 CD 3 1 Y 1 A ARG 4 ? NE ? A ARG 5 NE 4 1 Y 1 A ARG 4 ? CZ ? A ARG 5 CZ 5 1 Y 1 A ARG 4 ? NH1 ? A ARG 5 NH1 6 1 Y 1 A ARG 4 ? NH2 ? A ARG 5 NH2 7 1 Y 1 A ARG 17 ? CG ? A ARG 18 CG 8 1 Y 1 A ARG 17 ? CD ? A ARG 18 CD 9 1 Y 1 A ARG 17 ? NE ? A ARG 18 NE 10 1 Y 1 A ARG 17 ? CZ ? A ARG 18 CZ 11 1 Y 1 A ARG 17 ? NH1 ? A ARG 18 NH1 12 1 Y 1 A ARG 17 ? NH2 ? A ARG 18 NH2 13 1 Y 1 A MET 24 ? CG ? A MET 25 CG 14 1 Y 1 A MET 24 ? SD ? A MET 25 SD 15 1 Y 1 A MET 24 ? CE ? A MET 25 CE 16 1 Y 1 A ARG 37 ? CG ? A ARG 38 CG 17 1 Y 1 A ARG 37 ? CD ? A ARG 38 CD 18 1 Y 1 A ARG 37 ? NE ? A ARG 38 NE 19 1 Y 1 A ARG 37 ? CZ ? A ARG 38 CZ 20 1 Y 1 A ARG 37 ? NH1 ? A ARG 38 NH1 21 1 Y 1 A ARG 37 ? NH2 ? A ARG 38 NH2 22 1 Y 1 A ARG 38 ? CG ? A ARG 39 CG 23 1 Y 1 A ARG 38 ? CD ? A ARG 39 CD 24 1 Y 1 A ARG 38 ? NE ? A ARG 39 NE 25 1 Y 1 A ARG 38 ? CZ ? A ARG 39 CZ 26 1 Y 1 A ARG 38 ? NH1 ? A ARG 39 NH1 27 1 Y 1 A ARG 38 ? NH2 ? A ARG 39 NH2 28 1 Y 1 A ILE 55 ? CG1 ? A ILE 56 CG1 29 1 Y 1 A ILE 55 ? CG2 ? A ILE 56 CG2 30 1 Y 1 A ILE 55 ? CD1 ? A ILE 56 CD1 31 1 Y 1 A ARG 57 ? CG ? A ARG 58 CG 32 1 Y 1 A ARG 57 ? CD ? A ARG 58 CD 33 1 Y 1 A ARG 57 ? NE ? A ARG 58 NE 34 1 Y 1 A ARG 57 ? CZ ? A ARG 58 CZ 35 1 Y 1 A ARG 57 ? NH1 ? A ARG 58 NH1 36 1 Y 1 A ARG 57 ? NH2 ? A ARG 58 NH2 37 1 Y 1 A ARG 59 ? CG ? A ARG 60 CG 38 1 Y 1 A ARG 59 ? CD ? A ARG 60 CD 39 1 Y 1 A ARG 59 ? NE ? A ARG 60 NE 40 1 Y 1 A ARG 59 ? CZ ? A ARG 60 CZ 41 1 Y 1 A ARG 59 ? NH1 ? A ARG 60 NH1 42 1 Y 1 A ARG 59 ? NH2 ? A ARG 60 NH2 43 1 Y 1 A GLN 83 ? CG ? A GLN 84 CG 44 1 Y 1 A GLN 83 ? CD ? A GLN 84 CD 45 1 Y 1 A GLN 83 ? OE1 ? A GLN 84 OE1 46 1 Y 1 A GLN 83 ? NE2 ? A GLN 84 NE2 47 1 Y 1 A ARG 89 ? CG ? A ARG 90 CG 48 1 Y 1 A ARG 89 ? CD ? A ARG 90 CD 49 1 Y 1 A ARG 89 ? NE ? A ARG 90 NE 50 1 Y 1 A ARG 89 ? CZ ? A ARG 90 CZ 51 1 Y 1 A ARG 89 ? NH1 ? A ARG 90 NH1 52 1 Y 1 A ARG 89 ? NH2 ? A ARG 90 NH2 53 1 Y 1 A THR 90 ? OG1 ? A THR 91 OG1 54 1 Y 1 A THR 90 ? CG2 ? A THR 91 CG2 55 1 Y 1 A ARG 116 ? CG ? A ARG 117 CG 56 1 Y 1 A ARG 116 ? CD ? A ARG 117 CD 57 1 Y 1 A ARG 116 ? NE ? A ARG 117 NE 58 1 Y 1 A ARG 116 ? CZ ? A ARG 117 CZ 59 1 Y 1 A ARG 116 ? NH1 ? A ARG 117 NH1 60 1 Y 1 A ARG 116 ? NH2 ? A ARG 117 NH2 61 1 Y 1 A ARG 140 ? CG ? A ARG 141 CG 62 1 Y 1 A ARG 140 ? CD ? A ARG 141 CD 63 1 Y 1 A ARG 140 ? NE ? A ARG 141 NE 64 1 Y 1 A ARG 140 ? CZ ? A ARG 141 CZ 65 1 Y 1 A ARG 140 ? NH1 ? A ARG 141 NH1 66 1 Y 1 A ARG 140 ? NH2 ? A ARG 141 NH2 67 1 Y 1 A LEU 148 ? CG ? A LEU 149 CG 68 1 Y 1 A LEU 148 ? CD1 ? A LEU 149 CD1 69 1 Y 1 A LEU 148 ? CD2 ? A LEU 149 CD2 70 1 Y 1 A ASP 220 ? CG ? A ASP 221 CG 71 1 Y 1 A ASP 220 ? OD1 ? A ASP 221 OD1 72 1 Y 1 A ASP 220 ? OD2 ? A ASP 221 OD2 73 1 Y 1 A LEU 223 ? CG ? A LEU 224 CG 74 1 Y 1 A LEU 223 ? CD1 ? A LEU 224 CD1 75 1 Y 1 A LEU 223 ? CD2 ? A LEU 224 CD2 76 1 Y 1 A THR 224 ? OG1 ? A THR 225 OG1 77 1 Y 1 A THR 224 ? CG2 ? A THR 225 CG2 78 1 Y 1 A LYS 228 ? CG ? A LYS 229 CG 79 1 Y 1 A LYS 228 ? CD ? A LYS 229 CD 80 1 Y 1 A LYS 228 ? CE ? A LYS 229 CE 81 1 Y 1 A LYS 228 ? NZ ? A LYS 229 NZ 82 1 Y 1 A ILE 230 ? CG1 ? A ILE 231 CG1 83 1 Y 1 A ILE 230 ? CG2 ? A ILE 231 CG2 84 1 Y 1 A ILE 230 ? CD1 ? A ILE 231 CD1 85 1 Y 1 A LYS 231 ? CG ? A LYS 232 CG 86 1 Y 1 A LYS 231 ? CD ? A LYS 232 CD 87 1 Y 1 A LYS 231 ? CE ? A LYS 232 CE 88 1 Y 1 A LYS 231 ? NZ ? A LYS 232 NZ 89 1 Y 1 A ARG 279 ? CG ? A ARG 280 CG 90 1 Y 1 A ARG 279 ? CD ? A ARG 280 CD 91 1 Y 1 A ARG 279 ? NE ? A ARG 280 NE 92 1 Y 1 A ARG 279 ? CZ ? A ARG 280 CZ 93 1 Y 1 A ARG 279 ? NH1 ? A ARG 280 NH1 94 1 Y 1 A ARG 279 ? NH2 ? A ARG 280 NH2 95 1 Y 1 A ARG 282 ? CG ? A ARG 283 CG 96 1 Y 1 A ARG 282 ? CD ? A ARG 283 CD 97 1 Y 1 A ARG 282 ? NE ? A ARG 283 NE 98 1 Y 1 A ARG 282 ? CZ ? A ARG 283 CZ 99 1 Y 1 A ARG 282 ? NH1 ? A ARG 283 NH1 100 1 Y 1 A ARG 282 ? NH2 ? A ARG 283 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.320 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9TMQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.983 _cell.length_a_esd ? _cell.length_b 58.281 _cell.length_b_esd ? _cell.length_c 72.657 _cell.length_c_esd ? _cell.volume 243529.260 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9TMQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y (x,y,-x+z)' _symmetry.space_group_name_H-M 'I 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9TMQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2 M ammonium sulphate, 0.2 M NaCl and 0.1 M Bis-Tris pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 295 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-11-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976250 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976250 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 31.41 _reflns.entry_id 9TMQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.05 _reflns.d_resolution_low 48.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15139 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.10 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1131 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.105 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 39.06 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9TMQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.13 _refine.ls_d_res_low 48.03 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13502 _refine.ls_number_reflns_R_free 678 _refine.ls_number_reflns_R_work 12824 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.45 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2908 _refine.ls_R_factor_R_free 0.3456 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2880 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 44.8552 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4371 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.13 _refine_hist.d_res_low 48.03 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1919 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1863 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0045 ? 1962 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.6638 ? 2696 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0424 ? 304 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0035 ? 354 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 12.8818 ? 695 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.13 2.29 . . 129 2563 99.81 . . . . 0.3903 . . . . . . . . . . . . . . . 0.4408 'X-RAY DIFFRACTION' 2.29 2.53 . . 148 2540 99.70 . . . . 0.3571 . . . . . . . . . . . . . . . 0.4114 'X-RAY DIFFRACTION' 2.53 2.89 . . 128 2551 98.89 . . . . 0.3278 . . . . . . . . . . . . . . . 0.3697 'X-RAY DIFFRACTION' 2.89 3.64 . . 134 2567 99.59 . . . . 0.2911 . . . . . . . . . . . . . . . 0.3367 'X-RAY DIFFRACTION' 3.64 48.03 . . 139 2603 99.31 . . . . 0.2338 . . . . . . . . . . . . . . . 0.3009 # _struct.entry_id 9TMQ _struct.title 'Crystal structure of M. tuberculosis PknA in complex with Lestaurtinib' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9TMQ _struct_keywords.text 'Protein kinase A, PknA, MTb, inhibitor complex, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PKNA_MYCTU _struct_ref.pdbx_db_accession P9WI83 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYG ESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDF GIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9TMQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 284 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WI83 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 283 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 283 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9TMQ _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P9WI83 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11360 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 46 ? SER A 51 ? LYS A 45 SER A 50 1 ? 6 HELX_P HELX_P2 AA2 ASP A 52 ? LEU A 69 ? ASP A 51 LEU A 68 1 ? 18 HELX_P HELX_P3 AA3 LEU A 104 ? GLY A 112 ? LEU A 103 GLY A 111 1 ? 9 HELX_P HELX_P4 AA4 SER A 115 ? ALA A 136 ? SER A 114 ALA A 135 1 ? 22 HELX_P HELX_P5 AA5 LYS A 144 ? GLY A 146 ? LYS A 143 GLY A 145 5 ? 3 HELX_P HELX_P6 AA6 ALA A 186 ? LEU A 191 ? ALA A 185 LEU A 190 1 ? 6 HELX_P HELX_P7 AA7 SER A 196 ? GLY A 214 ? SER A 195 GLY A 213 1 ? 19 HELX_P HELX_P8 AA8 ALA A 223 ? LYS A 232 ? ALA A 222 LYS A 231 1 ? 10 HELX_P HELX_P9 AA9 PRO A 243 ? LEU A 254 ? PRO A 242 LEU A 253 1 ? 12 HELX_P HELX_P10 AB1 SER A 264 ? ALA A 277 ? SER A 263 ALA A 276 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 9 ? LEU A 10 ? THR A 8 LEU A 9 AA1 2 TYR A 14 ? GLY A 23 ? TYR A 13 GLY A 22 AA1 3 GLY A 26 ? ASP A 33 ? GLY A 25 ASP A 32 AA1 4 ARG A 38 ? LEU A 45 ? ARG A 37 LEU A 44 AA1 5 THR A 91 ? MET A 96 ? THR A 90 MET A 95 AA1 6 VAL A 77 ? SER A 83 ? VAL A 76 SER A 82 AA2 1 GLU A 102 ? PRO A 103 ? GLU A 101 PRO A 102 AA2 2 ILE A 148 ? ILE A 150 ? ILE A 147 ILE A 149 AA2 3 VAL A 156 ? ILE A 158 ? VAL A 155 ILE A 157 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 10 ? N LEU A 9 O TYR A 14 ? O TYR A 13 AA1 2 3 N ARG A 18 ? N ARG A 17 O GLU A 30 ? O GLU A 29 AA1 3 4 N GLN A 27 ? N GLN A 26 O VAL A 44 ? O VAL A 43 AA1 4 5 N ALA A 41 ? N ALA A 40 O MET A 96 ? O MET A 95 AA1 5 6 O THR A 91 ? O THR A 90 N SER A 83 ? N SER A 82 AA2 1 2 N GLU A 102 ? N GLU A 101 O ILE A 150 ? O ILE A 149 AA2 2 3 N LEU A 149 ? N LEU A 148 O LYS A 157 ? O LYS A 156 # _pdbx_entry_details.entry_id 9TMQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 272 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 12 ? ? -151.57 -35.56 2 1 ARG A 17 ? ? -172.64 126.30 3 1 THR A 21 ? ? -170.68 147.16 4 1 PHE A 48 ? ? -132.61 -31.30 5 1 HIS A 70 ? ? -174.18 135.85 6 1 ARG A 140 ? ? 84.01 -17.09 7 1 ASP A 159 ? ? 63.72 63.29 8 1 LYS A 231 ? ? -137.33 -58.09 9 1 SER A 263 ? ? -155.64 -157.71 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 415 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z+1/2 4 -x+1/2,y+1/2,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A SER 2 ? A SER 3 4 1 Y 1 A MET 84 ? A MET 85 5 1 Y 1 A ASN 85 ? A ASN 86 6 1 Y 1 A GLY 86 ? A GLY 87 7 1 Y 1 A GLU 87 ? A GLU 88 8 1 Y 1 A GLY 88 ? A GLY 89 9 1 Y 1 A ILE 162 ? A ILE 163 10 1 Y 1 A ALA 163 ? A ALA 164 11 1 Y 1 A LYS 164 ? A LYS 165 12 1 Y 1 A ALA 165 ? A ALA 166 13 1 Y 1 A VAL 166 ? A VAL 167 14 1 Y 1 A ASP 167 ? A ASP 168 15 1 Y 1 A ALA 168 ? A ALA 169 16 1 Y 1 A ALA 169 ? A ALA 170 17 1 Y 1 A PRO 170 ? A PRO 171 18 1 Y 1 A VAL 171 ? A VAL 172 19 1 Y 1 A THR 172 ? A THR 173 20 1 Y 1 A GLN 173 ? A GLN 174 21 1 Y 1 A THR 174 ? A THR 175 22 1 Y 1 A GLY 175 ? A GLY 176 23 1 Y 1 A MET 176 ? A MET 177 24 1 Y 1 A VAL 177 ? A VAL 178 25 1 Y 1 A MET 178 ? A MET 179 26 1 Y 1 A GLY 179 ? A GLY 180 27 1 Y 1 A THR 180 ? A THR 181 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2V9 O2 O N N 1 2V9 C25 C N N 2 2V9 N3 N N N 3 2V9 C24 C N N 4 2V9 C14 C Y N 5 2V9 C13 C Y N 6 2V9 C12 C Y N 7 2V9 C11 C Y N 8 2V9 C10 C Y N 9 2V9 C9 C Y N 10 2V9 C8 C Y N 11 2V9 C7 C Y N 12 2V9 C6 C Y N 13 2V9 N1 N Y N 14 2V9 C23 C Y N 15 2V9 C22 C Y N 16 2V9 C15 C Y N 17 2V9 C16 C Y N 18 2V9 C17 C Y N 19 2V9 C18 C Y N 20 2V9 C19 C Y N 21 2V9 C20 C Y N 22 2V9 C21 C Y N 23 2V9 N2 N Y N 24 2V9 C2 C N S 25 2V9 C1 C N N 26 2V9 O1 O N N 27 2V9 C5 C N R 28 2V9 C4 C N N 29 2V9 C3 C N S 30 2V9 O4 O N N 31 2V9 C26 C N N 32 2V9 O3 O N N 33 2V9 H1 H N N 34 2V9 H2 H N N 35 2V9 H3 H N N 36 2V9 H4 H N N 37 2V9 H5 H N N 38 2V9 H6 H N N 39 2V9 H7 H N N 40 2V9 H8 H N N 41 2V9 H9 H N N 42 2V9 H10 H N N 43 2V9 H11 H N N 44 2V9 H12 H N N 45 2V9 H13 H N N 46 2V9 H14 H N N 47 2V9 H15 H N N 48 2V9 H16 H N N 49 2V9 H17 H N N 50 2V9 H18 H N N 51 2V9 H19 H N N 52 2V9 H20 H N N 53 2V9 H21 H N N 54 ALA N N N N 55 ALA CA C N S 56 ALA C C N N 57 ALA O O N N 58 ALA CB C N N 59 ALA OXT O N N 60 ALA H H N N 61 ALA H2 H N N 62 ALA HA H N N 63 ALA HB1 H N N 64 ALA HB2 H N N 65 ALA HB3 H N N 66 ALA HXT H N N 67 ARG N N N N 68 ARG CA C N S 69 ARG C C N N 70 ARG O O N N 71 ARG CB C N N 72 ARG CG C N N 73 ARG CD C N N 74 ARG NE N N N 75 ARG CZ C N N 76 ARG NH1 N N N 77 ARG NH2 N N N 78 ARG OXT O N N 79 ARG H H N N 80 ARG H2 H N N 81 ARG HA H N N 82 ARG HB2 H N N 83 ARG HB3 H N N 84 ARG HG2 H N N 85 ARG HG3 H N N 86 ARG HD2 H N N 87 ARG HD3 H N N 88 ARG HE H N N 89 ARG HH11 H N N 90 ARG HH12 H N N 91 ARG HH21 H N N 92 ARG HH22 H N N 93 ARG HXT H N N 94 ASN N N N N 95 ASN CA C N S 96 ASN C C N N 97 ASN O O N N 98 ASN CB C N N 99 ASN CG C N N 100 ASN OD1 O N N 101 ASN ND2 N N N 102 ASN OXT O N N 103 ASN H H N N 104 ASN H2 H N N 105 ASN HA H N N 106 ASN HB2 H N N 107 ASN HB3 H N N 108 ASN HD21 H N N 109 ASN HD22 H N N 110 ASN HXT H N N 111 ASP N N N N 112 ASP CA C N S 113 ASP C C N N 114 ASP O O N N 115 ASP CB C N N 116 ASP CG C N N 117 ASP OD1 O N N 118 ASP OD2 O N N 119 ASP OXT O N N 120 ASP H H N N 121 ASP H2 H N N 122 ASP HA H N N 123 ASP HB2 H N N 124 ASP HB3 H N N 125 ASP HD2 H N N 126 ASP HXT H N N 127 GLN N N N N 128 GLN CA C N S 129 GLN C C N N 130 GLN O O N N 131 GLN CB C N N 132 GLN CG C N N 133 GLN CD C N N 134 GLN OE1 O N N 135 GLN NE2 N N N 136 GLN OXT O N N 137 GLN H H N N 138 GLN H2 H N N 139 GLN HA H N N 140 GLN HB2 H N N 141 GLN HB3 H N N 142 GLN HG2 H N N 143 GLN HG3 H N N 144 GLN HE21 H N N 145 GLN HE22 H N N 146 GLN HXT H N N 147 GLU N N N N 148 GLU CA C N S 149 GLU C C N N 150 GLU O O N N 151 GLU CB C N N 152 GLU CG C N N 153 GLU CD C N N 154 GLU OE1 O N N 155 GLU OE2 O N N 156 GLU OXT O N N 157 GLU H H N N 158 GLU H2 H N N 159 GLU HA H N N 160 GLU HB2 H N N 161 GLU HB3 H N N 162 GLU HG2 H N N 163 GLU HG3 H N N 164 GLU HE2 H N N 165 GLU HXT H N N 166 GLY N N N N 167 GLY CA C N N 168 GLY C C N N 169 GLY O O N N 170 GLY OXT O N N 171 GLY H H N N 172 GLY H2 H N N 173 GLY HA2 H N N 174 GLY HA3 H N N 175 GLY HXT H N N 176 HIS N N N N 177 HIS CA C N S 178 HIS C C N N 179 HIS O O N N 180 HIS CB C N N 181 HIS CG C Y N 182 HIS ND1 N Y N 183 HIS CD2 C Y N 184 HIS CE1 C Y N 185 HIS NE2 N Y N 186 HIS OXT O N N 187 HIS H H N N 188 HIS H2 H N N 189 HIS HA H N N 190 HIS HB2 H N N 191 HIS HB3 H N N 192 HIS HD1 H N N 193 HIS HD2 H N N 194 HIS HE1 H N N 195 HIS HE2 H N N 196 HIS HXT H N N 197 HOH O O N N 198 HOH H1 H N N 199 HOH H2 H N N 200 ILE N N N N 201 ILE CA C N S 202 ILE C C N N 203 ILE O O N N 204 ILE CB C N S 205 ILE CG1 C N N 206 ILE CG2 C N N 207 ILE CD1 C N N 208 ILE OXT O N N 209 ILE H H N N 210 ILE H2 H N N 211 ILE HA H N N 212 ILE HB H N N 213 ILE HG12 H N N 214 ILE HG13 H N N 215 ILE HG21 H N N 216 ILE HG22 H N N 217 ILE HG23 H N N 218 ILE HD11 H N N 219 ILE HD12 H N N 220 ILE HD13 H N N 221 ILE HXT H N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2V9 C8 C9 sing Y N 1 2V9 C8 C7 doub Y N 2 2V9 C9 C10 doub Y N 3 2V9 C7 C6 sing Y N 4 2V9 C10 C11 sing Y N 5 2V9 C6 C11 doub Y N 6 2V9 C6 N1 sing Y N 7 2V9 C4 C5 sing N N 8 2V9 C4 C3 sing N N 9 2V9 C11 C12 sing Y N 10 2V9 C5 N1 sing N N 11 2V9 C5 O1 sing N N 12 2V9 N1 C23 sing Y N 13 2V9 O3 C26 sing N N 14 2V9 C26 C3 sing N N 15 2V9 C3 O4 sing N N 16 2V9 C3 C2 sing N N 17 2V9 C12 C23 sing Y N 18 2V9 C12 C13 doub Y N 19 2V9 C23 C22 doub Y N 20 2V9 O1 C2 sing N N 21 2V9 O2 C25 doub N N 22 2V9 C2 N2 sing N N 23 2V9 C2 C1 sing N N 24 2V9 C13 C25 sing N N 25 2V9 C13 C14 sing Y N 26 2V9 C22 N2 sing Y N 27 2V9 C22 C15 sing Y N 28 2V9 C25 N3 sing N N 29 2V9 N2 C21 sing Y N 30 2V9 C14 C15 doub Y N 31 2V9 C14 C24 sing N N 32 2V9 C15 C16 sing Y N 33 2V9 N3 C24 sing N N 34 2V9 C21 C16 doub Y N 35 2V9 C21 C20 sing Y N 36 2V9 C16 C17 sing Y N 37 2V9 C20 C19 doub Y N 38 2V9 C17 C18 doub Y N 39 2V9 C19 C18 sing Y N 40 2V9 C24 H1 sing N N 41 2V9 C10 H2 sing N N 42 2V9 C9 H3 sing N N 43 2V9 C8 H4 sing N N 44 2V9 C7 H5 sing N N 45 2V9 C17 H6 sing N N 46 2V9 C18 H7 sing N N 47 2V9 C19 H8 sing N N 48 2V9 C20 H9 sing N N 49 2V9 C1 H10 sing N N 50 2V9 C1 H11 sing N N 51 2V9 C1 H12 sing N N 52 2V9 C5 H13 sing N N 53 2V9 C4 H14 sing N N 54 2V9 C4 H15 sing N N 55 2V9 O4 H16 sing N N 56 2V9 C26 H17 sing N N 57 2V9 C26 H18 sing N N 58 2V9 O3 H19 sing N N 59 2V9 N3 H20 sing N N 60 2V9 C24 H21 sing N N 61 ALA N CA sing N N 62 ALA N H sing N N 63 ALA N H2 sing N N 64 ALA CA C sing N N 65 ALA CA CB sing N N 66 ALA CA HA sing N N 67 ALA C O doub N N 68 ALA C OXT sing N N 69 ALA CB HB1 sing N N 70 ALA CB HB2 sing N N 71 ALA CB HB3 sing N N 72 ALA OXT HXT sing N N 73 ARG N CA sing N N 74 ARG N H sing N N 75 ARG N H2 sing N N 76 ARG CA C sing N N 77 ARG CA CB sing N N 78 ARG CA HA sing N N 79 ARG C O doub N N 80 ARG C OXT sing N N 81 ARG CB CG sing N N 82 ARG CB HB2 sing N N 83 ARG CB HB3 sing N N 84 ARG CG CD sing N N 85 ARG CG HG2 sing N N 86 ARG CG HG3 sing N N 87 ARG CD NE sing N N 88 ARG CD HD2 sing N N 89 ARG CD HD3 sing N N 90 ARG NE CZ sing N N 91 ARG NE HE sing N N 92 ARG CZ NH1 sing N N 93 ARG CZ NH2 doub N N 94 ARG NH1 HH11 sing N N 95 ARG NH1 HH12 sing N N 96 ARG NH2 HH21 sing N N 97 ARG NH2 HH22 sing N N 98 ARG OXT HXT sing N N 99 ASN N CA sing N N 100 ASN N H sing N N 101 ASN N H2 sing N N 102 ASN CA C sing N N 103 ASN CA CB sing N N 104 ASN CA HA sing N N 105 ASN C O doub N N 106 ASN C OXT sing N N 107 ASN CB CG sing N N 108 ASN CB HB2 sing N N 109 ASN CB HB3 sing N N 110 ASN CG OD1 doub N N 111 ASN CG ND2 sing N N 112 ASN ND2 HD21 sing N N 113 ASN ND2 HD22 sing N N 114 ASN OXT HXT sing N N 115 ASP N CA sing N N 116 ASP N H sing N N 117 ASP N H2 sing N N 118 ASP CA C sing N N 119 ASP CA CB sing N N 120 ASP CA HA sing N N 121 ASP C O doub N N 122 ASP C OXT sing N N 123 ASP CB CG sing N N 124 ASP CB HB2 sing N N 125 ASP CB HB3 sing N N 126 ASP CG OD1 doub N N 127 ASP CG OD2 sing N N 128 ASP OD2 HD2 sing N N 129 ASP OXT HXT sing N N 130 GLN N CA sing N N 131 GLN N H sing N N 132 GLN N H2 sing N N 133 GLN CA C sing N N 134 GLN CA CB sing N N 135 GLN CA HA sing N N 136 GLN C O doub N N 137 GLN C OXT sing N N 138 GLN CB CG sing N N 139 GLN CB HB2 sing N N 140 GLN CB HB3 sing N N 141 GLN CG CD sing N N 142 GLN CG HG2 sing N N 143 GLN CG HG3 sing N N 144 GLN CD OE1 doub N N 145 GLN CD NE2 sing N N 146 GLN NE2 HE21 sing N N 147 GLN NE2 HE22 sing N N 148 GLN OXT HXT sing N N 149 GLU N CA sing N N 150 GLU N H sing N N 151 GLU N H2 sing N N 152 GLU CA C sing N N 153 GLU CA CB sing N N 154 GLU CA HA sing N N 155 GLU C O doub N N 156 GLU C OXT sing N N 157 GLU CB CG sing N N 158 GLU CB HB2 sing N N 159 GLU CB HB3 sing N N 160 GLU CG CD sing N N 161 GLU CG HG2 sing N N 162 GLU CG HG3 sing N N 163 GLU CD OE1 doub N N 164 GLU CD OE2 sing N N 165 GLU OE2 HE2 sing N N 166 GLU OXT HXT sing N N 167 GLY N CA sing N N 168 GLY N H sing N N 169 GLY N H2 sing N N 170 GLY CA C sing N N 171 GLY CA HA2 sing N N 172 GLY CA HA3 sing N N 173 GLY C O doub N N 174 GLY C OXT sing N N 175 GLY OXT HXT sing N N 176 HIS N CA sing N N 177 HIS N H sing N N 178 HIS N H2 sing N N 179 HIS CA C sing N N 180 HIS CA CB sing N N 181 HIS CA HA sing N N 182 HIS C O doub N N 183 HIS C OXT sing N N 184 HIS CB CG sing N N 185 HIS CB HB2 sing N N 186 HIS CB HB3 sing N N 187 HIS CG ND1 sing Y N 188 HIS CG CD2 doub Y N 189 HIS ND1 CE1 doub Y N 190 HIS ND1 HD1 sing N N 191 HIS CD2 NE2 sing Y N 192 HIS CD2 HD2 sing N N 193 HIS CE1 NE2 sing Y N 194 HIS CE1 HE1 sing N N 195 HIS NE2 HE2 sing N N 196 HIS OXT HXT sing N N 197 HOH O H1 sing N N 198 HOH O H2 sing N N 199 ILE N CA sing N N 200 ILE N H sing N N 201 ILE N H2 sing N N 202 ILE CA C sing N N 203 ILE CA CB sing N N 204 ILE CA HA sing N N 205 ILE C O doub N N 206 ILE C OXT sing N N 207 ILE CB CG1 sing N N 208 ILE CB CG2 sing N N 209 ILE CB HB sing N N 210 ILE CG1 CD1 sing N N 211 ILE CG1 HG12 sing N N 212 ILE CG1 HG13 sing N N 213 ILE CG2 HG21 sing N N 214 ILE CG2 HG22 sing N N 215 ILE CG2 HG23 sing N N 216 ILE CD1 HD11 sing N N 217 ILE CD1 HD12 sing N N 218 ILE CD1 HD13 sing N N 219 ILE OXT HXT sing N N 220 LEU N CA sing N N 221 LEU N H sing N N 222 LEU N H2 sing N N 223 LEU CA C sing N N 224 LEU CA CB sing N N 225 LEU CA HA sing N N 226 LEU C O doub N N 227 LEU C OXT sing N N 228 LEU CB CG sing N N 229 LEU CB HB2 sing N N 230 LEU CB HB3 sing N N 231 LEU CG CD1 sing N N 232 LEU CG CD2 sing N N 233 LEU CG HG sing N N 234 LEU CD1 HD11 sing N N 235 LEU CD1 HD12 sing N N 236 LEU CD1 HD13 sing N N 237 LEU CD2 HD21 sing N N 238 LEU CD2 HD22 sing N N 239 LEU CD2 HD23 sing N N 240 LEU OXT HXT sing N N 241 LYS N CA sing N N 242 LYS N H sing N N 243 LYS N H2 sing N N 244 LYS CA C sing N N 245 LYS CA CB sing N N 246 LYS CA HA sing N N 247 LYS C O doub N N 248 LYS C OXT sing N N 249 LYS CB CG sing N N 250 LYS CB HB2 sing N N 251 LYS CB HB3 sing N N 252 LYS CG CD sing N N 253 LYS CG HG2 sing N N 254 LYS CG HG3 sing N N 255 LYS CD CE sing N N 256 LYS CD HD2 sing N N 257 LYS CD HD3 sing N N 258 LYS CE NZ sing N N 259 LYS CE HE2 sing N N 260 LYS CE HE3 sing N N 261 LYS NZ HZ1 sing N N 262 LYS NZ HZ2 sing N N 263 LYS NZ HZ3 sing N N 264 LYS OXT HXT sing N N 265 MET N CA sing N N 266 MET N H sing N N 267 MET N H2 sing N N 268 MET CA C sing N N 269 MET CA CB sing N N 270 MET CA HA sing N N 271 MET C O doub N N 272 MET C OXT sing N N 273 MET CB CG sing N N 274 MET CB HB2 sing N N 275 MET CB HB3 sing N N 276 MET CG SD sing N N 277 MET CG HG2 sing N N 278 MET CG HG3 sing N N 279 MET SD CE sing N N 280 MET CE HE1 sing N N 281 MET CE HE2 sing N N 282 MET CE HE3 sing N N 283 MET OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # _pdbx_audit_support.funding_organization 'Academy of Finland' _pdbx_audit_support.country Finland _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4OW8 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 1 2 1' _space_group.name_Hall 'C 2y (x,y,-x+z)' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9TMQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017246 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002215 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017158 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013876 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #