data_9TNG # _entry.id 9TNG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9TNG pdb_00009tng 10.2210/pdb9tng/pdb WWPDB D_1292153016 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-13 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9TNG _pdbx_database_status.recvd_initial_deposition_date 2025-12-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email acamara@ual.es _pdbx_contact_author.name_first Ana _pdbx_contact_author.name_last Camara-Artigas _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2197-726X # _audit_author.name 'Camara-Artigas, A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-2197-726X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 218 _citation.language ? _citation.page_first 108322 _citation.page_last 108322 _citation.title 'Conformational changes on the third PDZ domain of PSD95 upon phosphorylation of Tyr397.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2026.108322 _citation.pdbx_database_id_PubMed 42067080 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Salinas-Garcia, M.C.' 1 ? primary 'Murciano-Calles, J.' 2 ? primary 'Andujar-Sanchez, M.' 3 ? primary 'Ortiz-Salmeron, E.' 4 ? primary 'Martinez, J.C.' 5 ? primary 'Camara-Artigas, A.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Disks large homolog 4' 11176.568 1 ? E401R ? 'PDZ DOMAIN' 2 non-polymer syn 'ACETATE ION' 59.044 2 ? ? ? ? 3 water nat water 18.015 120 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Postsynaptic density protein 95,PSD-95,Synapse-associated protein 90,SAP-90,SAP90' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIAL KNAGQTVTIIAQYKPEEYSRFRAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIAL KNAGQTVTIIAQYKPEEYSRFRAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LEU n 1 4 GLY n 1 5 GLU n 1 6 GLU n 1 7 ASP n 1 8 ILE n 1 9 PRO n 1 10 ARG n 1 11 GLU n 1 12 PRO n 1 13 ARG n 1 14 ARG n 1 15 ILE n 1 16 VAL n 1 17 ILE n 1 18 HIS n 1 19 ARG n 1 20 GLY n 1 21 SER n 1 22 THR n 1 23 GLY n 1 24 LEU n 1 25 GLY n 1 26 PHE n 1 27 ASN n 1 28 ILE n 1 29 VAL n 1 30 GLY n 1 31 GLY n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ILE n 1 38 PHE n 1 39 ILE n 1 40 SER n 1 41 PHE n 1 42 ILE n 1 43 LEU n 1 44 ALA n 1 45 GLY n 1 46 GLY n 1 47 PRO n 1 48 ALA n 1 49 ASP n 1 50 LEU n 1 51 SER n 1 52 GLY n 1 53 GLU n 1 54 LEU n 1 55 ARG n 1 56 LYS n 1 57 GLY n 1 58 ASP n 1 59 GLN n 1 60 ILE n 1 61 LEU n 1 62 SER n 1 63 VAL n 1 64 ASN n 1 65 GLY n 1 66 VAL n 1 67 ASP n 1 68 LEU n 1 69 ARG n 1 70 ASN n 1 71 ALA n 1 72 SER n 1 73 HIS n 1 74 GLU n 1 75 GLN n 1 76 ALA n 1 77 ALA n 1 78 ILE n 1 79 ALA n 1 80 LEU n 1 81 LYS n 1 82 ASN n 1 83 ALA n 1 84 GLY n 1 85 GLN n 1 86 THR n 1 87 VAL n 1 88 THR n 1 89 ILE n 1 90 ILE n 1 91 ALA n 1 92 GLN n 1 93 TYR n 1 94 LYS n 1 95 PRO n 1 96 GLU n 1 97 GLU n 1 98 TYR n 1 99 SER n 1 100 ARG n 1 101 PHE n 1 102 ARG n 1 103 ALA n 1 104 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DLG4, PSD95' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PBAT4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 300 ? ? ? A . n A 1 2 GLY 2 301 301 GLY GLY A . n A 1 3 LEU 3 302 302 LEU LEU A . n A 1 4 GLY 4 303 303 GLY GLY A . n A 1 5 GLU 5 304 304 GLU GLU A . n A 1 6 GLU 6 305 305 GLU GLU A . n A 1 7 ASP 7 306 306 ASP ASP A . n A 1 8 ILE 8 307 307 ILE ILE A . n A 1 9 PRO 9 308 308 PRO PRO A . n A 1 10 ARG 10 309 309 ARG ARG A . n A 1 11 GLU 11 310 310 GLU GLU A . n A 1 12 PRO 12 311 311 PRO PRO A . n A 1 13 ARG 13 312 312 ARG ARG A . n A 1 14 ARG 14 313 313 ARG ARG A . n A 1 15 ILE 15 314 314 ILE ILE A . n A 1 16 VAL 16 315 315 VAL VAL A . n A 1 17 ILE 17 316 316 ILE ILE A . n A 1 18 HIS 18 317 317 HIS HIS A . n A 1 19 ARG 19 318 318 ARG ARG A . n A 1 20 GLY 20 319 319 GLY GLY A . n A 1 21 SER 21 320 320 SER SER A . n A 1 22 THR 22 321 321 THR THR A . n A 1 23 GLY 23 322 322 GLY GLY A . n A 1 24 LEU 24 323 323 LEU LEU A . n A 1 25 GLY 25 324 324 GLY GLY A . n A 1 26 PHE 26 325 325 PHE PHE A . n A 1 27 ASN 27 326 326 ASN ASN A . n A 1 28 ILE 28 327 327 ILE ILE A . n A 1 29 VAL 29 328 328 VAL VAL A . n A 1 30 GLY 30 329 329 GLY GLY A . n A 1 31 GLY 31 330 330 GLY GLY A . n A 1 32 GLU 32 331 331 GLU GLU A . n A 1 33 ASP 33 332 332 ASP ASP A . n A 1 34 GLY 34 333 333 GLY GLY A . n A 1 35 GLU 35 334 334 GLU GLU A . n A 1 36 GLY 36 335 335 GLY GLY A . n A 1 37 ILE 37 336 336 ILE ILE A . n A 1 38 PHE 38 337 337 PHE PHE A . n A 1 39 ILE 39 338 338 ILE ILE A . n A 1 40 SER 40 339 339 SER SER A . n A 1 41 PHE 41 340 340 PHE PHE A . n A 1 42 ILE 42 341 341 ILE ILE A . n A 1 43 LEU 43 342 342 LEU LEU A . n A 1 44 ALA 44 343 343 ALA ALA A . n A 1 45 GLY 45 344 344 GLY GLY A . n A 1 46 GLY 46 345 345 GLY GLY A . n A 1 47 PRO 47 346 346 PRO PRO A . n A 1 48 ALA 48 347 347 ALA ALA A . n A 1 49 ASP 49 348 348 ASP ASP A . n A 1 50 LEU 50 349 349 LEU LEU A . n A 1 51 SER 51 350 350 SER SER A . n A 1 52 GLY 52 351 351 GLY GLY A . n A 1 53 GLU 53 352 352 GLU GLU A . n A 1 54 LEU 54 353 353 LEU LEU A . n A 1 55 ARG 55 354 354 ARG ARG A . n A 1 56 LYS 56 355 355 LYS LYS A . n A 1 57 GLY 57 356 356 GLY GLY A . n A 1 58 ASP 58 357 357 ASP ASP A . n A 1 59 GLN 59 358 358 GLN GLN A . n A 1 60 ILE 60 359 359 ILE ILE A . n A 1 61 LEU 61 360 360 LEU LEU A . n A 1 62 SER 62 361 361 SER SER A . n A 1 63 VAL 63 362 362 VAL VAL A . n A 1 64 ASN 64 363 363 ASN ASN A . n A 1 65 GLY 65 364 364 GLY GLY A . n A 1 66 VAL 66 365 365 VAL VAL A . n A 1 67 ASP 67 366 366 ASP ASP A . n A 1 68 LEU 68 367 367 LEU LEU A . n A 1 69 ARG 69 368 368 ARG ARG A . n A 1 70 ASN 70 369 369 ASN ASN A . n A 1 71 ALA 71 370 370 ALA ALA A . n A 1 72 SER 72 371 371 SER SER A . n A 1 73 HIS 73 372 372 HIS HIS A . n A 1 74 GLU 74 373 373 GLU GLU A . n A 1 75 GLN 75 374 374 GLN GLN A . n A 1 76 ALA 76 375 375 ALA ALA A . n A 1 77 ALA 77 376 376 ALA ALA A . n A 1 78 ILE 78 377 377 ILE ILE A . n A 1 79 ALA 79 378 378 ALA ALA A . n A 1 80 LEU 80 379 379 LEU LEU A . n A 1 81 LYS 81 380 380 LYS LYS A . n A 1 82 ASN 82 381 381 ASN ASN A . n A 1 83 ALA 83 382 382 ALA ALA A . n A 1 84 GLY 84 383 383 GLY GLY A . n A 1 85 GLN 85 384 384 GLN GLN A . n A 1 86 THR 86 385 385 THR THR A . n A 1 87 VAL 87 386 386 VAL VAL A . n A 1 88 THR 88 387 387 THR THR A . n A 1 89 ILE 89 388 388 ILE ILE A . n A 1 90 ILE 90 389 389 ILE ILE A . n A 1 91 ALA 91 390 390 ALA ALA A . n A 1 92 GLN 92 391 391 GLN GLN A . n A 1 93 TYR 93 392 392 TYR TYR A . n A 1 94 LYS 94 393 393 LYS LYS A . n A 1 95 PRO 95 394 394 PRO PRO A . n A 1 96 GLU 96 395 395 GLU GLU A . n A 1 97 GLU 97 396 396 GLU GLU A . n A 1 98 TYR 98 397 397 TYR TYR A . n A 1 99 SER 99 398 398 SER SER A . n A 1 100 ARG 100 399 399 ARG ARG A . n A 1 101 PHE 101 400 400 PHE PHE A . n A 1 102 ARG 102 401 401 ARG ARG A . n A 1 103 ALA 103 402 402 ALA ALA A . n A 1 104 LYS 104 403 403 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 501 501 ACT ACT A . C 2 ACT 1 502 502 ACT ACT A . D 3 HOH 1 601 58 HOH HOH A . D 3 HOH 2 602 102 HOH HOH A . D 3 HOH 3 603 55 HOH HOH A . D 3 HOH 4 604 94 HOH HOH A . D 3 HOH 5 605 50 HOH HOH A . D 3 HOH 6 606 92 HOH HOH A . D 3 HOH 7 607 85 HOH HOH A . D 3 HOH 8 608 46 HOH HOH A . D 3 HOH 9 609 48 HOH HOH A . D 3 HOH 10 610 40 HOH HOH A . D 3 HOH 11 611 95 HOH HOH A . D 3 HOH 12 612 93 HOH HOH A . D 3 HOH 13 613 17 HOH HOH A . D 3 HOH 14 614 37 HOH HOH A . D 3 HOH 15 615 19 HOH HOH A . D 3 HOH 16 616 80 HOH HOH A . D 3 HOH 17 617 33 HOH HOH A . D 3 HOH 18 618 56 HOH HOH A . D 3 HOH 19 619 22 HOH HOH A . D 3 HOH 20 620 116 HOH HOH A . D 3 HOH 21 621 24 HOH HOH A . D 3 HOH 22 622 9 HOH HOH A . D 3 HOH 23 623 35 HOH HOH A . D 3 HOH 24 624 3 HOH HOH A . D 3 HOH 25 625 65 HOH HOH A . D 3 HOH 26 626 8 HOH HOH A . D 3 HOH 27 627 105 HOH HOH A . D 3 HOH 28 628 61 HOH HOH A . D 3 HOH 29 629 90 HOH HOH A . D 3 HOH 30 630 18 HOH HOH A . D 3 HOH 31 631 39 HOH HOH A . D 3 HOH 32 632 70 HOH HOH A . D 3 HOH 33 633 62 HOH HOH A . D 3 HOH 34 634 60 HOH HOH A . D 3 HOH 35 635 14 HOH HOH A . D 3 HOH 36 636 5 HOH HOH A . D 3 HOH 37 637 112 HOH HOH A . D 3 HOH 38 638 52 HOH HOH A . D 3 HOH 39 639 31 HOH HOH A . D 3 HOH 40 640 12 HOH HOH A . D 3 HOH 41 641 110 HOH HOH A . D 3 HOH 42 642 81 HOH HOH A . D 3 HOH 43 643 1 HOH HOH A . D 3 HOH 44 644 120 HOH HOH A . D 3 HOH 45 645 2 HOH HOH A . D 3 HOH 46 646 45 HOH HOH A . D 3 HOH 47 647 69 HOH HOH A . D 3 HOH 48 648 75 HOH HOH A . D 3 HOH 49 649 25 HOH HOH A . D 3 HOH 50 650 79 HOH HOH A . D 3 HOH 51 651 29 HOH HOH A . D 3 HOH 52 652 54 HOH HOH A . D 3 HOH 53 653 114 HOH HOH A . D 3 HOH 54 654 4 HOH HOH A . D 3 HOH 55 655 91 HOH HOH A . D 3 HOH 56 656 73 HOH HOH A . D 3 HOH 57 657 38 HOH HOH A . D 3 HOH 58 658 59 HOH HOH A . D 3 HOH 59 659 20 HOH HOH A . D 3 HOH 60 660 6 HOH HOH A . D 3 HOH 61 661 30 HOH HOH A . D 3 HOH 62 662 49 HOH HOH A . D 3 HOH 63 663 68 HOH HOH A . D 3 HOH 64 664 43 HOH HOH A . D 3 HOH 65 665 64 HOH HOH A . D 3 HOH 66 666 51 HOH HOH A . D 3 HOH 67 667 16 HOH HOH A . D 3 HOH 68 668 42 HOH HOH A . D 3 HOH 69 669 32 HOH HOH A . D 3 HOH 70 670 84 HOH HOH A . D 3 HOH 71 671 77 HOH HOH A . D 3 HOH 72 672 36 HOH HOH A . D 3 HOH 73 673 103 HOH HOH A . D 3 HOH 74 674 89 HOH HOH A . D 3 HOH 75 675 28 HOH HOH A . D 3 HOH 76 676 86 HOH HOH A . D 3 HOH 77 677 23 HOH HOH A . D 3 HOH 78 678 10 HOH HOH A . D 3 HOH 79 679 26 HOH HOH A . D 3 HOH 80 680 106 HOH HOH A . D 3 HOH 81 681 13 HOH HOH A . D 3 HOH 82 682 15 HOH HOH A . D 3 HOH 83 683 21 HOH HOH A . D 3 HOH 84 684 87 HOH HOH A . D 3 HOH 85 685 44 HOH HOH A . D 3 HOH 86 686 57 HOH HOH A . D 3 HOH 87 687 108 HOH HOH A . D 3 HOH 88 688 34 HOH HOH A . D 3 HOH 89 689 11 HOH HOH A . D 3 HOH 90 690 74 HOH HOH A . D 3 HOH 91 691 63 HOH HOH A . D 3 HOH 92 692 7 HOH HOH A . D 3 HOH 93 693 83 HOH HOH A . D 3 HOH 94 694 72 HOH HOH A . D 3 HOH 95 695 121 HOH HOH A . D 3 HOH 96 696 47 HOH HOH A . D 3 HOH 97 697 123 HOH HOH A . D 3 HOH 98 698 53 HOH HOH A . D 3 HOH 99 699 96 HOH HOH A . D 3 HOH 100 700 88 HOH HOH A . D 3 HOH 101 701 122 HOH HOH A . D 3 HOH 102 702 100 HOH HOH A . D 3 HOH 103 703 118 HOH HOH A . D 3 HOH 104 704 104 HOH HOH A . D 3 HOH 105 705 41 HOH HOH A . D 3 HOH 106 706 119 HOH HOH A . D 3 HOH 107 707 97 HOH HOH A . D 3 HOH 108 708 82 HOH HOH A . D 3 HOH 109 709 27 HOH HOH A . D 3 HOH 110 710 67 HOH HOH A . D 3 HOH 111 711 107 HOH HOH A . D 3 HOH 112 712 71 HOH HOH A . D 3 HOH 113 713 99 HOH HOH A . D 3 HOH 114 714 113 HOH HOH A . D 3 HOH 115 715 109 HOH HOH A . D 3 HOH 116 716 101 HOH HOH A . D 3 HOH 117 717 117 HOH HOH A . D 3 HOH 118 718 111 HOH HOH A . D 3 HOH 119 719 66 HOH HOH A . D 3 HOH 120 720 98 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9TNG _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.905 _cell.length_a_esd ? _cell.length_b 36.707 _cell.length_b_esd ? _cell.length_c 62.833 _cell.length_c_esd ? _cell.volume 75892.452 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9TNG _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9TNG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 27.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulphate, 25% w/v PEG 4000, 0.1 M sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-03-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate 11.36 _reflns.entry_id 9TNG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.95 _reflns.d_resolution_low 19.32 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 45187 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.95 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.031 _reflns.pdbx_Rpim_I_all 0.015 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 175060 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.027 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 0.95 _reflns_shell.d_res_low 0.97 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 2233 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1114 _reflns_shell.percent_possible_obs 46.2 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_chi_squared 0.89 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 0.9 _reflns_shell.pdbx_Rrim_I_all 1.164 _reflns_shell.pdbx_Rpim_I_all 0.735 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.437 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.896 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 16.96 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9TNG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 0.95 _refine.ls_d_res_low 19.32 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 45131 _refine.ls_number_reflns_R_free 2351 _refine.ls_number_reflns_R_work 42780 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.63 _refine.ls_percent_reflns_R_free 5.21 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1421 _refine.ls_R_factor_R_free 0.1679 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1407 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.18 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.5672 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0881 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 0.95 _refine_hist.d_res_low 19.32 _refine_hist.number_atoms_solvent 120 _refine_hist.number_atoms_total 907 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 779 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0152 ? 856 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.2786 ? 1157 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.1046 ? 122 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0229 ? 162 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 11.4885 ? 330 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 0.95 0.97 . . 70 1246 46.42 . . . . 0.3114 . . . . . . . . . . . . . . . 0.3741 'X-RAY DIFFRACTION' 0.97 0.99 . . 102 1735 65.21 . . . . 0.2871 . . . . . . . . . . . . . . . 0.3020 'X-RAY DIFFRACTION' 0.99 1.01 . . 134 2216 83.78 . . . . 0.2366 . . . . . . . . . . . . . . . 0.2861 'X-RAY DIFFRACTION' 1.01 1.04 . . 141 2529 94.82 . . . . 0.1871 . . . . . . . . . . . . . . . 0.2140 'X-RAY DIFFRACTION' 1.04 1.07 . . 141 2644 97.65 . . . . 0.1654 . . . . . . . . . . . . . . . 0.1768 'X-RAY DIFFRACTION' 1.07 1.10 . . 153 2615 97.98 . . . . 0.1563 . . . . . . . . . . . . . . . 0.1903 'X-RAY DIFFRACTION' 1.10 1.13 . . 133 2650 98.13 . . . . 0.1399 . . . . . . . . . . . . . . . 0.1776 'X-RAY DIFFRACTION' 1.13 1.17 . . 145 2690 99.02 . . . . 0.1297 . . . . . . . . . . . . . . . 0.1850 'X-RAY DIFFRACTION' 1.17 1.22 . . 148 2650 98.90 . . . . 0.1247 . . . . . . . . . . . . . . . 0.1357 'X-RAY DIFFRACTION' 1.22 1.28 . . 139 2680 98.77 . . . . 0.1256 . . . . . . . . . . . . . . . 0.1507 'X-RAY DIFFRACTION' 1.28 1.34 . . 145 2689 99.72 . . . . 0.1268 . . . . . . . . . . . . . . . 0.1520 'X-RAY DIFFRACTION' 1.34 1.43 . . 144 2712 99.27 . . . . 0.1281 . . . . . . . . . . . . . . . 0.1674 'X-RAY DIFFRACTION' 1.43 1.54 . . 151 2696 99.34 . . . . 0.1264 . . . . . . . . . . . . . . . 0.1491 'X-RAY DIFFRACTION' 1.54 1.69 . . 145 2725 99.51 . . . . 0.1257 . . . . . . . . . . . . . . . 0.1833 'X-RAY DIFFRACTION' 1.69 1.94 . . 142 2730 99.14 . . . . 0.1314 . . . . . . . . . . . . . . . 0.1532 'X-RAY DIFFRACTION' 1.94 2.44 . . 157 2751 98.58 . . . . 0.1319 . . . . . . . . . . . . . . . 0.1404 'X-RAY DIFFRACTION' 2.44 19.32 . . 161 2822 97.20 . . . . 0.1498 . . . . . . . . . . . . . . . 0.1797 # _struct.entry_id 9TNG _struct.title 'Crystal Structure of the third PDZ domain of PSD-95 protein E401R mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9TNG _struct_keywords.text 'PDZ DOMAIN, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DLG4_HUMAN _struct_ref.pdbx_db_accession P78352 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKN AGQTVTIIAQYKPEEYSRFEAK ; _struct_ref.pdbx_align_begin 302 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9TNG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P78352 _struct_ref_seq.db_align_beg 302 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 403 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 302 _struct_ref_seq.pdbx_auth_seq_align_end 403 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9TNG MET A 1 ? UNP P78352 ? ? 'initiating methionine' 300 1 1 9TNG GLY A 2 ? UNP P78352 ? ? 'expression tag' 301 2 1 9TNG ARG A 102 ? UNP P78352 GLU 401 'engineered mutation' 401 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 46 ? GLY A 52 ? GLY A 345 GLY A 351 1 ? 7 HELX_P HELX_P2 AA2 SER A 72 ? ALA A 83 ? SER A 371 ALA A 382 1 ? 12 HELX_P HELX_P3 AA3 LYS A 94 ? ALA A 103 ? LYS A 393 ALA A 402 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 13 ? HIS A 18 ? ARG A 312 HIS A 317 AA1 2 THR A 86 ? TYR A 93 ? THR A 385 TYR A 392 AA1 3 ASP A 58 ? VAL A 63 ? ASP A 357 VAL A 362 AA1 4 VAL A 66 ? ASP A 67 ? VAL A 365 ASP A 366 AA2 1 PHE A 26 ? GLU A 32 ? PHE A 325 GLU A 331 AA2 2 GLU A 35 ? ILE A 42 ? GLU A 334 ILE A 341 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 15 ? N ILE A 314 O ILE A 89 ? O ILE A 388 AA1 2 3 O GLN A 92 ? O GLN A 391 N GLN A 59 ? N GLN A 358 AA1 3 4 N VAL A 63 ? N VAL A 362 O VAL A 66 ? O VAL A 365 AA2 1 2 N VAL A 29 ? N VAL A 328 O PHE A 38 ? O PHE A 337 # _pdbx_entry_details.entry_id 9TNG _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 399 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.118 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 300 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 GLN N N N N 81 GLN CA C N S 82 GLN C C N N 83 GLN O O N N 84 GLN CB C N N 85 GLN CG C N N 86 GLN CD C N N 87 GLN OE1 O N N 88 GLN NE2 N N N 89 GLN OXT O N N 90 GLN H H N N 91 GLN H2 H N N 92 GLN HA H N N 93 GLN HB2 H N N 94 GLN HB3 H N N 95 GLN HG2 H N N 96 GLN HG3 H N N 97 GLN HE21 H N N 98 GLN HE22 H N N 99 GLN HXT H N N 100 GLU N N N N 101 GLU CA C N S 102 GLU C C N N 103 GLU O O N N 104 GLU CB C N N 105 GLU CG C N N 106 GLU CD C N N 107 GLU OE1 O N N 108 GLU OE2 O N N 109 GLU OXT O N N 110 GLU H H N N 111 GLU H2 H N N 112 GLU HA H N N 113 GLU HB2 H N N 114 GLU HB3 H N N 115 GLU HG2 H N N 116 GLU HG3 H N N 117 GLU HE2 H N N 118 GLU HXT H N N 119 GLY N N N N 120 GLY CA C N N 121 GLY C C N N 122 GLY O O N N 123 GLY OXT O N N 124 GLY H H N N 125 GLY H2 H N N 126 GLY HA2 H N N 127 GLY HA3 H N N 128 GLY HXT H N N 129 HIS N N N N 130 HIS CA C N S 131 HIS C C N N 132 HIS O O N N 133 HIS CB C N N 134 HIS CG C Y N 135 HIS ND1 N Y N 136 HIS CD2 C Y N 137 HIS CE1 C Y N 138 HIS NE2 N Y N 139 HIS OXT O N N 140 HIS H H N N 141 HIS H2 H N N 142 HIS HA H N N 143 HIS HB2 H N N 144 HIS HB3 H N N 145 HIS HD1 H N N 146 HIS HD2 H N N 147 HIS HE1 H N N 148 HIS HE2 H N N 149 HIS HXT H N N 150 HOH O O N N 151 HOH H1 H N N 152 HOH H2 H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 PHE N N N N 243 PHE CA C N S 244 PHE C C N N 245 PHE O O N N 246 PHE CB C N N 247 PHE CG C Y N 248 PHE CD1 C Y N 249 PHE CD2 C Y N 250 PHE CE1 C Y N 251 PHE CE2 C Y N 252 PHE CZ C Y N 253 PHE OXT O N N 254 PHE H H N N 255 PHE H2 H N N 256 PHE HA H N N 257 PHE HB2 H N N 258 PHE HB3 H N N 259 PHE HD1 H N N 260 PHE HD2 H N N 261 PHE HE1 H N N 262 PHE HE2 H N N 263 PHE HZ H N N 264 PHE HXT H N N 265 PRO N N N N 266 PRO CA C N S 267 PRO C C N N 268 PRO O O N N 269 PRO CB C N N 270 PRO CG C N N 271 PRO CD C N N 272 PRO OXT O N N 273 PRO H H N N 274 PRO HA H N N 275 PRO HB2 H N N 276 PRO HB3 H N N 277 PRO HG2 H N N 278 PRO HG3 H N N 279 PRO HD2 H N N 280 PRO HD3 H N N 281 PRO HXT H N N 282 SER N N N N 283 SER CA C N S 284 SER C C N N 285 SER O O N N 286 SER CB C N N 287 SER OG O N N 288 SER OXT O N N 289 SER H H N N 290 SER H2 H N N 291 SER HA H N N 292 SER HB2 H N N 293 SER HB3 H N N 294 SER HG H N N 295 SER HXT H N N 296 THR N N N N 297 THR CA C N S 298 THR C C N N 299 THR O O N N 300 THR CB C N R 301 THR OG1 O N N 302 THR CG2 C N N 303 THR OXT O N N 304 THR H H N N 305 THR H2 H N N 306 THR HA H N N 307 THR HB H N N 308 THR HG1 H N N 309 THR HG21 H N N 310 THR HG22 H N N 311 THR HG23 H N N 312 THR HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 HOH O H1 sing N N 143 HOH O H2 sing N N 144 ILE N CA sing N N 145 ILE N H sing N N 146 ILE N H2 sing N N 147 ILE CA C sing N N 148 ILE CA CB sing N N 149 ILE CA HA sing N N 150 ILE C O doub N N 151 ILE C OXT sing N N 152 ILE CB CG1 sing N N 153 ILE CB CG2 sing N N 154 ILE CB HB sing N N 155 ILE CG1 CD1 sing N N 156 ILE CG1 HG12 sing N N 157 ILE CG1 HG13 sing N N 158 ILE CG2 HG21 sing N N 159 ILE CG2 HG22 sing N N 160 ILE CG2 HG23 sing N N 161 ILE CD1 HD11 sing N N 162 ILE CD1 HD12 sing N N 163 ILE CD1 HD13 sing N N 164 ILE OXT HXT sing N N 165 LEU N CA sing N N 166 LEU N H sing N N 167 LEU N H2 sing N N 168 LEU CA C sing N N 169 LEU CA CB sing N N 170 LEU CA HA sing N N 171 LEU C O doub N N 172 LEU C OXT sing N N 173 LEU CB CG sing N N 174 LEU CB HB2 sing N N 175 LEU CB HB3 sing N N 176 LEU CG CD1 sing N N 177 LEU CG CD2 sing N N 178 LEU CG HG sing N N 179 LEU CD1 HD11 sing N N 180 LEU CD1 HD12 sing N N 181 LEU CD1 HD13 sing N N 182 LEU CD2 HD21 sing N N 183 LEU CD2 HD22 sing N N 184 LEU CD2 HD23 sing N N 185 LEU OXT HXT sing N N 186 LYS N CA sing N N 187 LYS N H sing N N 188 LYS N H2 sing N N 189 LYS CA C sing N N 190 LYS CA CB sing N N 191 LYS CA HA sing N N 192 LYS C O doub N N 193 LYS C OXT sing N N 194 LYS CB CG sing N N 195 LYS CB HB2 sing N N 196 LYS CB HB3 sing N N 197 LYS CG CD sing N N 198 LYS CG HG2 sing N N 199 LYS CG HG3 sing N N 200 LYS CD CE sing N N 201 LYS CD HD2 sing N N 202 LYS CD HD3 sing N N 203 LYS CE NZ sing N N 204 LYS CE HE2 sing N N 205 LYS CE HE3 sing N N 206 LYS NZ HZ1 sing N N 207 LYS NZ HZ2 sing N N 208 LYS NZ HZ3 sing N N 209 LYS OXT HXT sing N N 210 MET N CA sing N N 211 MET N H sing N N 212 MET N H2 sing N N 213 MET CA C sing N N 214 MET CA CB sing N N 215 MET CA HA sing N N 216 MET C O doub N N 217 MET C OXT sing N N 218 MET CB CG sing N N 219 MET CB HB2 sing N N 220 MET CB HB3 sing N N 221 MET CG SD sing N N 222 MET CG HG2 sing N N 223 MET CG HG3 sing N N 224 MET SD CE sing N N 225 MET CE HE1 sing N N 226 MET CE HE2 sing N N 227 MET CE HE3 sing N N 228 MET OXT HXT sing N N 229 PHE N CA sing N N 230 PHE N H sing N N 231 PHE N H2 sing N N 232 PHE CA C sing N N 233 PHE CA CB sing N N 234 PHE CA HA sing N N 235 PHE C O doub N N 236 PHE C OXT sing N N 237 PHE CB CG sing N N 238 PHE CB HB2 sing N N 239 PHE CB HB3 sing N N 240 PHE CG CD1 doub Y N 241 PHE CG CD2 sing Y N 242 PHE CD1 CE1 sing Y N 243 PHE CD1 HD1 sing N N 244 PHE CD2 CE2 doub Y N 245 PHE CD2 HD2 sing N N 246 PHE CE1 CZ doub Y N 247 PHE CE1 HE1 sing N N 248 PHE CE2 CZ sing Y N 249 PHE CE2 HE2 sing N N 250 PHE CZ HZ sing N N 251 PHE OXT HXT sing N N 252 PRO N CA sing N N 253 PRO N CD sing N N 254 PRO N H sing N N 255 PRO CA C sing N N 256 PRO CA CB sing N N 257 PRO CA HA sing N N 258 PRO C O doub N N 259 PRO C OXT sing N N 260 PRO CB CG sing N N 261 PRO CB HB2 sing N N 262 PRO CB HB3 sing N N 263 PRO CG CD sing N N 264 PRO CG HG2 sing N N 265 PRO CG HG3 sing N N 266 PRO CD HD2 sing N N 267 PRO CD HD3 sing N N 268 PRO OXT HXT sing N N 269 SER N CA sing N N 270 SER N H sing N N 271 SER N H2 sing N N 272 SER CA C sing N N 273 SER CA CB sing N N 274 SER CA HA sing N N 275 SER C O doub N N 276 SER C OXT sing N N 277 SER CB OG sing N N 278 SER CB HB2 sing N N 279 SER CB HB3 sing N N 280 SER OG HG sing N N 281 SER OXT HXT sing N N 282 THR N CA sing N N 283 THR N H sing N N 284 THR N H2 sing N N 285 THR CA C sing N N 286 THR CA CB sing N N 287 THR CA HA sing N N 288 THR C O doub N N 289 THR C OXT sing N N 290 THR CB OG1 sing N N 291 THR CB CG2 sing N N 292 THR CB HB sing N N 293 THR OG1 HG1 sing N N 294 THR CG2 HG21 sing N N 295 THR CG2 HG22 sing N N 296 THR CG2 HG23 sing N N 297 THR OXT HXT sing N N 298 TYR N CA sing N N 299 TYR N H sing N N 300 TYR N H2 sing N N 301 TYR CA C sing N N 302 TYR CA CB sing N N 303 TYR CA HA sing N N 304 TYR C O doub N N 305 TYR C OXT sing N N 306 TYR CB CG sing N N 307 TYR CB HB2 sing N N 308 TYR CB HB3 sing N N 309 TYR CG CD1 doub Y N 310 TYR CG CD2 sing Y N 311 TYR CD1 CE1 sing Y N 312 TYR CD1 HD1 sing N N 313 TYR CD2 CE2 doub Y N 314 TYR CD2 HD2 sing N N 315 TYR CE1 CZ doub Y N 316 TYR CE1 HE1 sing N N 317 TYR CE2 CZ sing Y N 318 TYR CE2 HE2 sing N N 319 TYR CZ OH sing N N 320 TYR OH HH sing N N 321 TYR OXT HXT sing N N 322 VAL N CA sing N N 323 VAL N H sing N N 324 VAL N H2 sing N N 325 VAL CA C sing N N 326 VAL CA CB sing N N 327 VAL CA HA sing N N 328 VAL C O doub N N 329 VAL C OXT sing N N 330 VAL CB CG1 sing N N 331 VAL CB CG2 sing N N 332 VAL CB HB sing N N 333 VAL CG1 HG11 sing N N 334 VAL CG1 HG12 sing N N 335 VAL CG1 HG13 sing N N 336 VAL CG2 HG21 sing N N 337 VAL CG2 HG22 sing N N 338 VAL CG2 HG23 sing N N 339 VAL OXT HXT sing N N 340 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number UAL18-BIO-B005-B _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3K82 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9TNG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.030391 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027243 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015915 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 2.51340 1.74867 1.72398 ? 31.80534 0.44561 10.58317 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.53795 0.34799 0.11320 ? 10.08003 29.74760 2.57510 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 2.99955 2.25584 1.72788 ? 23.27268 7.45433 0.31622 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #