data_9UUL # _entry.id 9UUL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9UUL pdb_00009uul 10.2210/pdb9uul/pdb WWPDB D_1300057074 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-09-10 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9UUL _pdbx_database_status.recvd_initial_deposition_date 2025-05-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 9UUJ unspecified PDB . 9UUK unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email bku@kribb.re.kr _pdbx_contact_author.name_first Bonsu _pdbx_contact_author.name_last Ku _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1784-8975 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ku, B.' 1 ? 'Jung, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country KR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Microbiol _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1976-3794 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first e2505003 _citation.page_last e2505003 _citation.title ;Crystal structures of the mu 2 subunit of clathrin-adaptor protein 2 in complex with peptides derived from human papillomavirus 16 E7. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.71150/jm.2505003 _citation.pdbx_database_id_PubMed 40878558 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jung, S.' 1 ? primary 'Lim, D.' 2 ? primary 'Choi, J.S.' 3 ? primary 'Shin, H.C.' 4 ? primary 'Kim, S.J.' 5 ? primary 'Ku, B.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'AP-2 complex subunit mu' 32124.682 1 ? ? ? ? 2 polymer man 'Protein E7' 2278.271 1 ? 'S31E, S32E' ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;AP-2 mu chain,Adaptor protein complex AP-2 subunit mu,Adaptor-related protein complex 2 subunit mu,Clathrin assembly protein complex 2 mu medium chain,Clathrin coat assembly protein AP50,Clathrin coat-associated protein AP50,Mu2-adaptin,Plasma membrane adaptor AP-2 50 kDa protein ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GHMQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETS KSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPS LLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPF APSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC ; ;GHMQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETS KSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPS LLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPF APSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC ; A ? 2 'polypeptide(L)' no no LYCYEQLNDEEEEEDEID LYCYEQLNDEEEEEDEID B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 GLN n 1 5 ILE n 1 6 GLY n 1 7 TRP n 1 8 ARG n 1 9 ARG n 1 10 GLU n 1 11 GLY n 1 12 ILE n 1 13 LYS n 1 14 TYR n 1 15 ARG n 1 16 ARG n 1 17 ASN n 1 18 GLU n 1 19 LEU n 1 20 PHE n 1 21 LEU n 1 22 ASP n 1 23 VAL n 1 24 LEU n 1 25 GLU n 1 26 SER n 1 27 VAL n 1 28 ASN n 1 29 LEU n 1 30 LEU n 1 31 MET n 1 32 SER n 1 33 PRO n 1 34 GLN n 1 35 GLY n 1 36 GLN n 1 37 VAL n 1 38 LEU n 1 39 SER n 1 40 ALA n 1 41 HIS n 1 42 VAL n 1 43 SER n 1 44 GLY n 1 45 ARG n 1 46 VAL n 1 47 VAL n 1 48 MET n 1 49 LYS n 1 50 SER n 1 51 TYR n 1 52 LEU n 1 53 SER n 1 54 GLY n 1 55 MET n 1 56 PRO n 1 57 GLU n 1 58 CYS n 1 59 LYS n 1 60 PHE n 1 61 GLY n 1 62 MET n 1 63 ASN n 1 64 ASP n 1 65 LYS n 1 66 ILE n 1 67 VAL n 1 68 ILE n 1 69 GLU n 1 70 LYS n 1 71 GLN n 1 72 GLY n 1 73 LYS n 1 74 GLY n 1 75 THR n 1 76 ALA n 1 77 ASP n 1 78 GLU n 1 79 THR n 1 80 SER n 1 81 LYS n 1 82 SER n 1 83 GLY n 1 84 LYS n 1 85 GLN n 1 86 SER n 1 87 ILE n 1 88 ALA n 1 89 ILE n 1 90 ASP n 1 91 ASP n 1 92 CYS n 1 93 THR n 1 94 PHE n 1 95 HIS n 1 96 GLN n 1 97 CYS n 1 98 VAL n 1 99 ARG n 1 100 LEU n 1 101 SER n 1 102 LYS n 1 103 PHE n 1 104 ASP n 1 105 SER n 1 106 GLU n 1 107 ARG n 1 108 SER n 1 109 ILE n 1 110 SER n 1 111 PHE n 1 112 ILE n 1 113 PRO n 1 114 PRO n 1 115 ASP n 1 116 GLY n 1 117 GLU n 1 118 PHE n 1 119 GLU n 1 120 LEU n 1 121 MET n 1 122 ARG n 1 123 TYR n 1 124 ARG n 1 125 THR n 1 126 THR n 1 127 LYS n 1 128 ASP n 1 129 ILE n 1 130 ILE n 1 131 LEU n 1 132 PRO n 1 133 PHE n 1 134 ARG n 1 135 VAL n 1 136 ILE n 1 137 PRO n 1 138 LEU n 1 139 VAL n 1 140 ARG n 1 141 GLU n 1 142 VAL n 1 143 GLY n 1 144 ARG n 1 145 THR n 1 146 LYS n 1 147 LEU n 1 148 GLU n 1 149 VAL n 1 150 LYS n 1 151 VAL n 1 152 VAL n 1 153 ILE n 1 154 LYS n 1 155 SER n 1 156 ASN n 1 157 PHE n 1 158 LYS n 1 159 PRO n 1 160 SER n 1 161 LEU n 1 162 LEU n 1 163 ALA n 1 164 GLN n 1 165 LYS n 1 166 ILE n 1 167 GLU n 1 168 VAL n 1 169 ARG n 1 170 ILE n 1 171 PRO n 1 172 THR n 1 173 PRO n 1 174 LEU n 1 175 ASN n 1 176 THR n 1 177 SER n 1 178 GLY n 1 179 VAL n 1 180 GLN n 1 181 VAL n 1 182 ILE n 1 183 CYS n 1 184 MET n 1 185 LYS n 1 186 GLY n 1 187 LYS n 1 188 ALA n 1 189 LYS n 1 190 TYR n 1 191 LYS n 1 192 ALA n 1 193 SER n 1 194 GLU n 1 195 ASN n 1 196 ALA n 1 197 ILE n 1 198 VAL n 1 199 TRP n 1 200 LYS n 1 201 ILE n 1 202 LYS n 1 203 ARG n 1 204 MET n 1 205 ALA n 1 206 GLY n 1 207 MET n 1 208 LYS n 1 209 GLU n 1 210 SER n 1 211 GLN n 1 212 ILE n 1 213 SER n 1 214 ALA n 1 215 GLU n 1 216 ILE n 1 217 GLU n 1 218 LEU n 1 219 LEU n 1 220 PRO n 1 221 THR n 1 222 ASN n 1 223 ASP n 1 224 LYS n 1 225 LYS n 1 226 LYS n 1 227 TRP n 1 228 ALA n 1 229 ARG n 1 230 PRO n 1 231 PRO n 1 232 ILE n 1 233 SER n 1 234 MET n 1 235 ASN n 1 236 PHE n 1 237 GLU n 1 238 VAL n 1 239 PRO n 1 240 PHE n 1 241 ALA n 1 242 PRO n 1 243 SER n 1 244 GLY n 1 245 LEU n 1 246 LYS n 1 247 VAL n 1 248 ARG n 1 249 TYR n 1 250 LEU n 1 251 LYS n 1 252 VAL n 1 253 PHE n 1 254 GLU n 1 255 PRO n 1 256 LYS n 1 257 LEU n 1 258 ASN n 1 259 TYR n 1 260 SER n 1 261 ASP n 1 262 HIS n 1 263 ASP n 1 264 VAL n 1 265 ILE n 1 266 LYS n 1 267 TRP n 1 268 VAL n 1 269 ARG n 1 270 TYR n 1 271 ILE n 1 272 GLY n 1 273 ARG n 1 274 SER n 1 275 GLY n 1 276 ILE n 1 277 TYR n 1 278 GLU n 1 279 THR n 1 280 ARG n 1 281 CYS n 2 1 LEU n 2 2 TYR n 2 3 CYS n 2 4 TYR n 2 5 GLU n 2 6 GLN n 2 7 LEU n 2 8 ASN n 2 9 ASP n 2 10 GLU n 2 11 GLU n 2 12 GLU n 2 13 GLU n 2 14 GLU n 2 15 ASP n 2 16 GLU n 2 17 ILE n 2 18 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 281 'Norway rat' ? Ap2m1 ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 18 ? ? E7 ? ? ? ? ? ? 'Human papillomavirus 16' 333760 ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 155 ? ? ? A . n A 1 2 HIS 2 156 ? ? ? A . n A 1 3 MET 3 157 ? ? ? A . n A 1 4 GLN 4 158 ? ? ? A . n A 1 5 ILE 5 159 159 ILE ILE A . n A 1 6 GLY 6 160 160 GLY GLY A . n A 1 7 TRP 7 161 161 TRP TRP A . n A 1 8 ARG 8 162 162 ARG ARG A . n A 1 9 ARG 9 163 163 ARG ARG A . n A 1 10 GLU 10 164 164 GLU GLU A . n A 1 11 GLY 11 165 165 GLY GLY A . n A 1 12 ILE 12 166 166 ILE ILE A . n A 1 13 LYS 13 167 167 LYS LYS A . n A 1 14 TYR 14 168 168 TYR TYR A . n A 1 15 ARG 15 169 169 ARG ARG A . n A 1 16 ARG 16 170 170 ARG ARG A . n A 1 17 ASN 17 171 171 ASN ASN A . n A 1 18 GLU 18 172 172 GLU GLU A . n A 1 19 LEU 19 173 173 LEU LEU A . n A 1 20 PHE 20 174 174 PHE PHE A . n A 1 21 LEU 21 175 175 LEU LEU A . n A 1 22 ASP 22 176 176 ASP ASP A . n A 1 23 VAL 23 177 177 VAL VAL A . n A 1 24 LEU 24 178 178 LEU LEU A . n A 1 25 GLU 25 179 179 GLU GLU A . n A 1 26 SER 26 180 180 SER SER A . n A 1 27 VAL 27 181 181 VAL VAL A . n A 1 28 ASN 28 182 182 ASN ASN A . n A 1 29 LEU 29 183 183 LEU LEU A . n A 1 30 LEU 30 184 184 LEU LEU A . n A 1 31 MET 31 185 185 MET MET A . n A 1 32 SER 32 186 186 SER SER A . n A 1 33 PRO 33 187 187 PRO PRO A . n A 1 34 GLN 34 188 188 GLN GLN A . n A 1 35 GLY 35 189 189 GLY GLY A . n A 1 36 GLN 36 190 190 GLN GLN A . n A 1 37 VAL 37 191 191 VAL VAL A . n A 1 38 LEU 38 192 192 LEU LEU A . n A 1 39 SER 39 193 193 SER SER A . n A 1 40 ALA 40 194 194 ALA ALA A . n A 1 41 HIS 41 195 195 HIS HIS A . n A 1 42 VAL 42 196 196 VAL VAL A . n A 1 43 SER 43 197 197 SER SER A . n A 1 44 GLY 44 198 198 GLY GLY A . n A 1 45 ARG 45 199 199 ARG ARG A . n A 1 46 VAL 46 200 200 VAL VAL A . n A 1 47 VAL 47 201 201 VAL VAL A . n A 1 48 MET 48 202 202 MET MET A . n A 1 49 LYS 49 203 203 LYS LYS A . n A 1 50 SER 50 204 204 SER SER A . n A 1 51 TYR 51 205 205 TYR TYR A . n A 1 52 LEU 52 206 206 LEU LEU A . n A 1 53 SER 53 207 207 SER SER A . n A 1 54 GLY 54 208 208 GLY GLY A . n A 1 55 MET 55 209 209 MET MET A . n A 1 56 PRO 56 210 210 PRO PRO A . n A 1 57 GLU 57 211 211 GLU GLU A . n A 1 58 CYS 58 212 212 CYS CYS A . n A 1 59 LYS 59 213 213 LYS LYS A . n A 1 60 PHE 60 214 214 PHE PHE A . n A 1 61 GLY 61 215 215 GLY GLY A . n A 1 62 MET 62 216 216 MET MET A . n A 1 63 ASN 63 217 217 ASN ASN A . n A 1 64 ASP 64 218 218 ASP ASP A . n A 1 65 LYS 65 219 ? ? ? A . n A 1 66 ILE 66 220 ? ? ? A . n A 1 67 VAL 67 221 ? ? ? A . n A 1 68 ILE 68 222 ? ? ? A . n A 1 69 GLU 69 223 ? ? ? A . n A 1 70 LYS 70 224 ? ? ? A . n A 1 71 GLN 71 225 ? ? ? A . n A 1 72 GLY 72 226 ? ? ? A . n A 1 73 LYS 73 227 ? ? ? A . n A 1 74 GLY 74 228 ? ? ? A . n A 1 75 THR 75 229 ? ? ? A . n A 1 76 ALA 76 230 ? ? ? A . n A 1 77 ASP 77 231 ? ? ? A . n A 1 78 GLU 78 232 ? ? ? A . n A 1 79 THR 79 233 ? ? ? A . n A 1 80 SER 80 234 ? ? ? A . n A 1 81 LYS 81 235 ? ? ? A . n A 1 82 SER 82 236 ? ? ? A . n A 1 83 GLY 83 237 ? ? ? A . n A 1 84 LYS 84 238 ? ? ? A . n A 1 85 GLN 85 239 239 GLN GLN A . n A 1 86 SER 86 240 240 SER SER A . n A 1 87 ILE 87 241 241 ILE ILE A . n A 1 88 ALA 88 242 242 ALA ALA A . n A 1 89 ILE 89 243 243 ILE ILE A . n A 1 90 ASP 90 244 244 ASP ASP A . n A 1 91 ASP 91 245 245 ASP ASP A . n A 1 92 CYS 92 246 246 CYS CYS A . n A 1 93 THR 93 247 247 THR THR A . n A 1 94 PHE 94 248 248 PHE PHE A . n A 1 95 HIS 95 249 249 HIS HIS A . n A 1 96 GLN 96 250 250 GLN GLN A . n A 1 97 CYS 97 251 251 CYS CYS A . n A 1 98 VAL 98 252 252 VAL VAL A . n A 1 99 ARG 99 253 253 ARG ARG A . n A 1 100 LEU 100 254 ? ? ? A . n A 1 101 SER 101 255 ? ? ? A . n A 1 102 LYS 102 256 ? ? ? A . n A 1 103 PHE 103 257 ? ? ? A . n A 1 104 ASP 104 258 ? ? ? A . n A 1 105 SER 105 259 ? ? ? A . n A 1 106 GLU 106 260 ? ? ? A . n A 1 107 ARG 107 261 ? ? ? A . n A 1 108 SER 108 262 ? ? ? A . n A 1 109 ILE 109 263 263 ILE ILE A . n A 1 110 SER 110 264 264 SER SER A . n A 1 111 PHE 111 265 265 PHE PHE A . n A 1 112 ILE 112 266 266 ILE ILE A . n A 1 113 PRO 113 267 267 PRO PRO A . n A 1 114 PRO 114 268 268 PRO PRO A . n A 1 115 ASP 115 269 269 ASP ASP A . n A 1 116 GLY 116 270 270 GLY GLY A . n A 1 117 GLU 117 271 271 GLU GLU A . n A 1 118 PHE 118 272 272 PHE PHE A . n A 1 119 GLU 119 273 273 GLU GLU A . n A 1 120 LEU 120 274 274 LEU LEU A . n A 1 121 MET 121 275 275 MET MET A . n A 1 122 ARG 122 276 276 ARG ARG A . n A 1 123 TYR 123 277 277 TYR TYR A . n A 1 124 ARG 124 278 278 ARG ARG A . n A 1 125 THR 125 279 279 THR THR A . n A 1 126 THR 126 280 280 THR THR A . n A 1 127 LYS 127 281 281 LYS LYS A . n A 1 128 ASP 128 282 282 ASP ASP A . n A 1 129 ILE 129 283 283 ILE ILE A . n A 1 130 ILE 130 284 284 ILE ILE A . n A 1 131 LEU 131 285 285 LEU LEU A . n A 1 132 PRO 132 286 286 PRO PRO A . n A 1 133 PHE 133 287 287 PHE PHE A . n A 1 134 ARG 134 288 288 ARG ARG A . n A 1 135 VAL 135 289 289 VAL VAL A . n A 1 136 ILE 136 290 290 ILE ILE A . n A 1 137 PRO 137 291 291 PRO PRO A . n A 1 138 LEU 138 292 292 LEU LEU A . n A 1 139 VAL 139 293 293 VAL VAL A . n A 1 140 ARG 140 294 294 ARG ARG A . n A 1 141 GLU 141 295 295 GLU GLU A . n A 1 142 VAL 142 296 296 VAL VAL A . n A 1 143 GLY 143 297 297 GLY GLY A . n A 1 144 ARG 144 298 298 ARG ARG A . n A 1 145 THR 145 299 299 THR THR A . n A 1 146 LYS 146 300 300 LYS LYS A . n A 1 147 LEU 147 301 301 LEU LEU A . n A 1 148 GLU 148 302 302 GLU GLU A . n A 1 149 VAL 149 303 303 VAL VAL A . n A 1 150 LYS 150 304 304 LYS LYS A . n A 1 151 VAL 151 305 305 VAL VAL A . n A 1 152 VAL 152 306 306 VAL VAL A . n A 1 153 ILE 153 307 307 ILE ILE A . n A 1 154 LYS 154 308 308 LYS LYS A . n A 1 155 SER 155 309 309 SER SER A . n A 1 156 ASN 156 310 310 ASN ASN A . n A 1 157 PHE 157 311 311 PHE PHE A . n A 1 158 LYS 158 312 312 LYS LYS A . n A 1 159 PRO 159 313 313 PRO PRO A . n A 1 160 SER 160 314 314 SER SER A . n A 1 161 LEU 161 315 315 LEU LEU A . n A 1 162 LEU 162 316 316 LEU LEU A . n A 1 163 ALA 163 317 317 ALA ALA A . n A 1 164 GLN 164 318 318 GLN GLN A . n A 1 165 LYS 165 319 319 LYS LYS A . n A 1 166 ILE 166 320 320 ILE ILE A . n A 1 167 GLU 167 321 321 GLU GLU A . n A 1 168 VAL 168 322 322 VAL VAL A . n A 1 169 ARG 169 323 323 ARG ARG A . n A 1 170 ILE 170 324 324 ILE ILE A . n A 1 171 PRO 171 325 325 PRO PRO A . n A 1 172 THR 172 326 326 THR THR A . n A 1 173 PRO 173 327 327 PRO PRO A . n A 1 174 LEU 174 328 328 LEU LEU A . n A 1 175 ASN 175 329 329 ASN ASN A . n A 1 176 THR 176 330 330 THR THR A . n A 1 177 SER 177 331 331 SER SER A . n A 1 178 GLY 178 332 332 GLY GLY A . n A 1 179 VAL 179 333 333 VAL VAL A . n A 1 180 GLN 180 334 334 GLN GLN A . n A 1 181 VAL 181 335 335 VAL VAL A . n A 1 182 ILE 182 336 336 ILE ILE A . n A 1 183 CYS 183 337 337 CYS CYS A . n A 1 184 MET 184 338 338 MET MET A . n A 1 185 LYS 185 339 339 LYS LYS A . n A 1 186 GLY 186 340 340 GLY GLY A . n A 1 187 LYS 187 341 341 LYS LYS A . n A 1 188 ALA 188 342 342 ALA ALA A . n A 1 189 LYS 189 343 343 LYS LYS A . n A 1 190 TYR 190 344 344 TYR TYR A . n A 1 191 LYS 191 345 345 LYS LYS A . n A 1 192 ALA 192 346 346 ALA ALA A . n A 1 193 SER 193 347 347 SER SER A . n A 1 194 GLU 194 348 348 GLU GLU A . n A 1 195 ASN 195 349 349 ASN ASN A . n A 1 196 ALA 196 350 350 ALA ALA A . n A 1 197 ILE 197 351 351 ILE ILE A . n A 1 198 VAL 198 352 352 VAL VAL A . n A 1 199 TRP 199 353 353 TRP TRP A . n A 1 200 LYS 200 354 354 LYS LYS A . n A 1 201 ILE 201 355 355 ILE ILE A . n A 1 202 LYS 202 356 356 LYS LYS A . n A 1 203 ARG 203 357 357 ARG ARG A . n A 1 204 MET 204 358 358 MET MET A . n A 1 205 ALA 205 359 359 ALA ALA A . n A 1 206 GLY 206 360 360 GLY GLY A . n A 1 207 MET 207 361 361 MET MET A . n A 1 208 LYS 208 362 362 LYS LYS A . n A 1 209 GLU 209 363 363 GLU GLU A . n A 1 210 SER 210 364 364 SER SER A . n A 1 211 GLN 211 365 365 GLN GLN A . n A 1 212 ILE 212 366 366 ILE ILE A . n A 1 213 SER 213 367 367 SER SER A . n A 1 214 ALA 214 368 368 ALA ALA A . n A 1 215 GLU 215 369 369 GLU GLU A . n A 1 216 ILE 216 370 370 ILE ILE A . n A 1 217 GLU 217 371 371 GLU GLU A . n A 1 218 LEU 218 372 372 LEU LEU A . n A 1 219 LEU 219 373 373 LEU LEU A . n A 1 220 PRO 220 374 374 PRO PRO A . n A 1 221 THR 221 375 375 THR THR A . n A 1 222 ASN 222 376 376 ASN ASN A . n A 1 223 ASP 223 377 377 ASP ASP A . n A 1 224 LYS 224 378 378 LYS LYS A . n A 1 225 LYS 225 379 379 LYS LYS A . n A 1 226 LYS 226 380 380 LYS LYS A . n A 1 227 TRP 227 381 381 TRP TRP A . n A 1 228 ALA 228 382 382 ALA ALA A . n A 1 229 ARG 229 383 383 ARG ARG A . n A 1 230 PRO 230 384 384 PRO PRO A . n A 1 231 PRO 231 385 385 PRO PRO A . n A 1 232 ILE 232 386 386 ILE ILE A . n A 1 233 SER 233 387 387 SER SER A . n A 1 234 MET 234 388 388 MET MET A . n A 1 235 ASN 235 389 389 ASN ASN A . n A 1 236 PHE 236 390 390 PHE PHE A . n A 1 237 GLU 237 391 391 GLU GLU A . n A 1 238 VAL 238 392 392 VAL VAL A . n A 1 239 PRO 239 393 393 PRO PRO A . n A 1 240 PHE 240 394 394 PHE PHE A . n A 1 241 ALA 241 395 395 ALA ALA A . n A 1 242 PRO 242 396 396 PRO PRO A . n A 1 243 SER 243 397 397 SER SER A . n A 1 244 GLY 244 398 398 GLY GLY A . n A 1 245 LEU 245 399 399 LEU LEU A . n A 1 246 LYS 246 400 400 LYS LYS A . n A 1 247 VAL 247 401 401 VAL VAL A . n A 1 248 ARG 248 402 402 ARG ARG A . n A 1 249 TYR 249 403 403 TYR TYR A . n A 1 250 LEU 250 404 404 LEU LEU A . n A 1 251 LYS 251 405 405 LYS LYS A . n A 1 252 VAL 252 406 406 VAL VAL A . n A 1 253 PHE 253 407 407 PHE PHE A . n A 1 254 GLU 254 408 408 GLU GLU A . n A 1 255 PRO 255 409 409 PRO PRO A . n A 1 256 LYS 256 410 410 LYS LYS A . n A 1 257 LEU 257 411 411 LEU LEU A . n A 1 258 ASN 258 412 412 ASN ASN A . n A 1 259 TYR 259 413 413 TYR TYR A . n A 1 260 SER 260 414 414 SER SER A . n A 1 261 ASP 261 415 415 ASP ASP A . n A 1 262 HIS 262 416 416 HIS HIS A . n A 1 263 ASP 263 417 417 ASP ASP A . n A 1 264 VAL 264 418 418 VAL VAL A . n A 1 265 ILE 265 419 419 ILE ILE A . n A 1 266 LYS 266 420 420 LYS LYS A . n A 1 267 TRP 267 421 421 TRP TRP A . n A 1 268 VAL 268 422 422 VAL VAL A . n A 1 269 ARG 269 423 423 ARG ARG A . n A 1 270 TYR 270 424 424 TYR TYR A . n A 1 271 ILE 271 425 425 ILE ILE A . n A 1 272 GLY 272 426 426 GLY GLY A . n A 1 273 ARG 273 427 427 ARG ARG A . n A 1 274 SER 274 428 428 SER SER A . n A 1 275 GLY 275 429 429 GLY GLY A . n A 1 276 ILE 276 430 430 ILE ILE A . n A 1 277 TYR 277 431 431 TYR TYR A . n A 1 278 GLU 278 432 432 GLU GLU A . n A 1 279 THR 279 433 433 THR THR A . n A 1 280 ARG 280 434 434 ARG ARG A . n A 1 281 CYS 281 435 435 CYS CYS A . n B 2 1 LEU 1 22 ? ? ? B . n B 2 2 TYR 2 23 ? ? ? B . n B 2 3 CYS 3 24 24 CYS CYS B . n B 2 4 TYR 4 25 25 TYR TYR B . n B 2 5 GLU 5 26 26 GLU GLU B . n B 2 6 GLN 6 27 27 GLN GLN B . n B 2 7 LEU 7 28 28 LEU LEU B . n B 2 8 ASN 8 29 29 ASN ASN B . n B 2 9 ASP 9 30 30 ASP ASP B . n B 2 10 GLU 10 31 31 GLU GLU B . n B 2 11 GLU 11 32 32 GLU GLU B . n B 2 12 GLU 12 33 ? ? ? B . n B 2 13 GLU 13 34 ? ? ? B . n B 2 14 GLU 14 35 ? ? ? B . n B 2 15 ASP 15 36 ? ? ? B . n B 2 16 GLU 16 37 ? ? ? B . n B 2 17 ILE 17 38 ? ? ? B . n B 2 18 ASP 18 39 ? ? ? B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 167 ? CE ? A LYS 13 CE 2 1 Y 1 A LYS 167 ? NZ ? A LYS 13 NZ 3 1 Y 1 A LYS 213 ? CG ? A LYS 59 CG 4 1 Y 1 A LYS 213 ? CD ? A LYS 59 CD 5 1 Y 1 A LYS 213 ? CE ? A LYS 59 CE 6 1 Y 1 A LYS 213 ? NZ ? A LYS 59 NZ 7 1 Y 1 A ASP 245 ? CG ? A ASP 91 CG 8 1 Y 1 A ASP 245 ? OD1 ? A ASP 91 OD1 9 1 Y 1 A ASP 245 ? OD2 ? A ASP 91 OD2 10 1 Y 1 A ARG 298 ? CG ? A ARG 144 CG 11 1 Y 1 A ARG 298 ? CD ? A ARG 144 CD 12 1 Y 1 A ARG 298 ? NE ? A ARG 144 NE 13 1 Y 1 A ARG 298 ? CZ ? A ARG 144 CZ 14 1 Y 1 A ARG 298 ? NH1 ? A ARG 144 NH1 15 1 Y 1 A ARG 298 ? NH2 ? A ARG 144 NH2 16 1 Y 1 A LYS 304 ? CD ? A LYS 150 CD 17 1 Y 1 A LYS 304 ? CE ? A LYS 150 CE 18 1 Y 1 A LYS 304 ? NZ ? A LYS 150 NZ 19 1 Y 1 A LYS 308 ? CG ? A LYS 154 CG 20 1 Y 1 A LYS 308 ? CD ? A LYS 154 CD 21 1 Y 1 A LYS 308 ? CE ? A LYS 154 CE 22 1 Y 1 A LYS 308 ? NZ ? A LYS 154 NZ 23 1 Y 1 A LYS 319 ? CE ? A LYS 165 CE 24 1 Y 1 A LYS 319 ? NZ ? A LYS 165 NZ 25 1 Y 1 A LYS 339 ? CD ? A LYS 185 CD 26 1 Y 1 A LYS 339 ? CE ? A LYS 185 CE 27 1 Y 1 A LYS 339 ? NZ ? A LYS 185 NZ 28 1 Y 1 A LYS 341 ? CG ? A LYS 187 CG 29 1 Y 1 A LYS 341 ? CD ? A LYS 187 CD 30 1 Y 1 A LYS 341 ? CE ? A LYS 187 CE 31 1 Y 1 A LYS 341 ? NZ ? A LYS 187 NZ 32 1 Y 1 A LYS 343 ? CG ? A LYS 189 CG 33 1 Y 1 A LYS 343 ? CD ? A LYS 189 CD 34 1 Y 1 A LYS 343 ? CE ? A LYS 189 CE 35 1 Y 1 A LYS 343 ? NZ ? A LYS 189 NZ 36 1 Y 1 A LYS 345 ? CD ? A LYS 191 CD 37 1 Y 1 A LYS 345 ? CE ? A LYS 191 CE 38 1 Y 1 A LYS 345 ? NZ ? A LYS 191 NZ 39 1 Y 1 A LYS 378 ? CG ? A LYS 224 CG 40 1 Y 1 A LYS 378 ? CD ? A LYS 224 CD 41 1 Y 1 A LYS 378 ? CE ? A LYS 224 CE 42 1 Y 1 A LYS 378 ? NZ ? A LYS 224 NZ 43 1 Y 1 A LYS 379 ? CG ? A LYS 225 CG 44 1 Y 1 A LYS 379 ? CD ? A LYS 225 CD 45 1 Y 1 A LYS 379 ? CE ? A LYS 225 CE 46 1 Y 1 A LYS 379 ? NZ ? A LYS 225 NZ 47 1 Y 1 A LYS 380 ? CG ? A LYS 226 CG 48 1 Y 1 A LYS 380 ? CD ? A LYS 226 CD 49 1 Y 1 A LYS 380 ? CE ? A LYS 226 CE 50 1 Y 1 A LYS 380 ? NZ ? A LYS 226 NZ 51 1 Y 1 A LYS 400 ? CD ? A LYS 246 CD 52 1 Y 1 A LYS 400 ? CE ? A LYS 246 CE 53 1 Y 1 A LYS 400 ? NZ ? A LYS 246 NZ 54 1 Y 1 A ARG 402 ? CG ? A ARG 248 CG 55 1 Y 1 A ARG 402 ? CD ? A ARG 248 CD 56 1 Y 1 A ARG 402 ? NE ? A ARG 248 NE 57 1 Y 1 A ARG 402 ? CZ ? A ARG 248 CZ 58 1 Y 1 A ARG 402 ? NH1 ? A ARG 248 NH1 59 1 Y 1 A ARG 402 ? NH2 ? A ARG 248 NH2 60 1 Y 1 A LYS 405 ? CD ? A LYS 251 CD 61 1 Y 1 A LYS 405 ? CE ? A LYS 251 CE 62 1 Y 1 A LYS 405 ? NZ ? A LYS 251 NZ 63 1 Y 1 A HIS 416 ? CG ? A HIS 262 CG 64 1 Y 1 A HIS 416 ? ND1 ? A HIS 262 ND1 65 1 Y 1 A HIS 416 ? CD2 ? A HIS 262 CD2 66 1 Y 1 A HIS 416 ? CE1 ? A HIS 262 CE1 67 1 Y 1 A HIS 416 ? NE2 ? A HIS 262 NE2 68 1 Y 1 B ASN 29 ? CG ? B ASN 8 CG 69 1 Y 1 B ASN 29 ? OD1 ? B ASN 8 OD1 70 1 Y 1 B ASN 29 ? ND2 ? B ASN 8 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9UUL _cell.details ? _cell.formula_units_Z ? _cell.length_a 125.569 _cell.length_a_esd ? _cell.length_b 125.569 _cell.length_b_esd ? _cell.length_c 74.251 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9UUL _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9UUL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 74.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.5 M ammonium chloride and 100 mM sodium acetate trihydrate (pH 4.5)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-10-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9UUL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.298 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9969 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.298 _reflns_shell.d_res_low 3.36 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 457 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.300 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9UUL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.298 _refine.ls_d_res_low 43.869 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9960 _refine.ls_number_reflns_R_free 988 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.67 _refine.ls_percent_reflns_R_free 9.92 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1967 _refine.ls_R_factor_R_free 0.2247 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1935 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.51 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.96 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.38 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2008 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2008 _refine_hist.d_res_high 3.298 _refine_hist.d_res_low 43.869 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 2048 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.131 ? 2774 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 15.286 ? 1249 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 314 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 355 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.2981 3.4719 . . 130 1190 90.00 . . . . 0.2770 . . . . . . . . . . . . . . . 0.2978 'X-RAY DIFFRACTION' 3.4719 3.6893 . . 132 1261 97.00 . . . . 0.2389 . . . . . . . . . . . . . . . 0.2517 'X-RAY DIFFRACTION' 3.6893 3.9740 . . 143 1276 98.00 . . . . 0.2076 . . . . . . . . . . . . . . . 0.2398 'X-RAY DIFFRACTION' 3.9740 4.3736 . . 143 1292 99.00 . . . . 0.1709 . . . . . . . . . . . . . . . 0.2191 'X-RAY DIFFRACTION' 4.3736 5.0057 . . 143 1309 99.00 . . . . 0.1552 . . . . . . . . . . . . . . . 0.1833 'X-RAY DIFFRACTION' 5.0057 6.3037 . . 142 1316 100.00 . . . . 0.1937 . . . . . . . . . . . . . . . 0.2160 'X-RAY DIFFRACTION' 6.3037 43.869 . . 155 1328 99.00 . . . . 0.1932 . . . . . . . . . . . . . . . 0.2317 # _struct.entry_id 9UUL _struct.title 'Crystal structure of the mu2 subunit of the clathrin-adaptor protein 2 (AP2) bound to HPV16 E7(residues 22-39; S31E and S32E)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9UUL _struct_keywords.text 'mu2, clathrin-adaptor protein 2, AP2, HPV16, E7, CR2, ENDOCYTOSIS' _struct_keywords.pdbx_keywords ENDOCYTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP AP2M1_RAT P84092 ? 1 ;QIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSG KQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLA QKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPS GLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC ; 158 2 UNP VE7_HPV16 P03129 ? 2 LYCYEQLNDSSEEEDEID 22 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9UUL A 4 ? 281 ? P84092 158 ? 435 ? 158 435 2 2 9UUL B 1 ? 18 ? P03129 22 ? 39 ? 22 39 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9UUL GLY A 1 ? UNP P84092 ? ? 'expression tag' 155 1 1 9UUL HIS A 2 ? UNP P84092 ? ? 'expression tag' 156 2 1 9UUL MET A 3 ? UNP P84092 ? ? 'expression tag' 157 3 2 9UUL GLU B 10 ? UNP P03129 SER 31 'engineered mutation' 31 4 2 9UUL GLU B 11 ? UNP P03129 SER 32 'engineered mutation' 32 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 950 ? 1 MORE -7 ? 1 'SSA (A^2)' 13610 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 260 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 264 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 414 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 418 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 6 ? AA3 ? 3 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 91 ? PHE A 94 ? ASP A 245 PHE A 248 AA1 2 GLY A 116 ? THR A 125 ? GLY A 270 THR A 279 AA1 3 VAL A 37 ? TYR A 51 ? VAL A 191 TYR A 205 AA1 4 GLU A 18 ? MET A 31 ? GLU A 172 MET A 185 AA1 5 ILE A 265 ? THR A 279 ? ILE A 419 THR A 433 AA1 6 ILE A 232 ? VAL A 238 ? ILE A 386 VAL A 392 AA1 7 LEU A 162 ? PRO A 171 ? LEU A 316 PRO A 325 AA1 8 ALA A 196 ? ALA A 205 ? ALA A 350 ALA A 359 AA1 9 LYS A 187 ? LYS A 191 ? LYS A 341 LYS A 345 AA2 1 ASP A 91 ? PHE A 94 ? ASP A 245 PHE A 248 AA2 2 GLY A 116 ? THR A 125 ? GLY A 270 THR A 279 AA2 3 VAL A 37 ? TYR A 51 ? VAL A 191 TYR A 205 AA2 4 GLU A 18 ? MET A 31 ? GLU A 172 MET A 185 AA2 5 ILE A 265 ? THR A 279 ? ILE A 419 THR A 433 AA2 6 GLU B 5 ? GLN B 6 ? GLU B 26 GLN B 27 AA3 1 SER A 110 ? PHE A 111 ? SER A 264 PHE A 265 AA3 2 GLU A 57 ? MET A 62 ? GLU A 211 MET A 216 AA3 3 VAL A 247 ? PHE A 253 ? VAL A 401 PHE A 407 AA4 1 PHE A 133 ? VAL A 142 ? PHE A 287 VAL A 296 AA4 2 LYS A 146 ? SER A 155 ? LYS A 300 SER A 309 AA4 3 LYS A 208 ? LEU A 218 ? LYS A 362 LEU A 372 AA4 4 THR A 176 ? CYS A 183 ? THR A 330 CYS A 337 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 93 ? N THR A 247 O ARG A 122 ? O ARG A 276 AA1 2 3 O PHE A 118 ? O PHE A 272 N MET A 48 ? N MET A 202 AA1 3 4 O LYS A 49 ? O LYS A 203 N PHE A 20 ? N PHE A 174 AA1 4 5 N LEU A 29 ? N LEU A 183 O ILE A 276 ? O ILE A 430 AA1 5 6 O GLY A 272 ? O GLY A 426 N VAL A 238 ? N VAL A 392 AA1 6 7 O GLU A 237 ? O GLU A 391 N GLN A 164 ? N GLN A 318 AA1 7 8 N ILE A 170 ? N ILE A 324 O ILE A 197 ? O ILE A 351 AA1 8 9 O VAL A 198 ? O VAL A 352 N LYS A 189 ? N LYS A 343 AA2 1 2 N THR A 93 ? N THR A 247 O ARG A 122 ? O ARG A 276 AA2 2 3 O PHE A 118 ? O PHE A 272 N MET A 48 ? N MET A 202 AA2 3 4 O LYS A 49 ? O LYS A 203 N PHE A 20 ? N PHE A 174 AA2 4 5 N LEU A 29 ? N LEU A 183 O ILE A 276 ? O ILE A 430 AA2 5 6 N VAL A 268 ? N VAL A 422 O GLU B 5 ? O GLU B 26 AA3 1 2 O PHE A 111 ? O PHE A 265 N CYS A 58 ? N CYS A 212 AA3 2 3 N GLY A 61 ? N GLY A 215 O TYR A 249 ? O TYR A 403 AA4 1 2 N ARG A 140 ? N ARG A 294 O GLU A 148 ? O GLU A 302 AA4 2 3 N VAL A 149 ? N VAL A 303 O ALA A 214 ? O ALA A 368 AA4 3 4 O GLU A 215 ? O GLU A 369 N GLN A 180 ? N GLN A 334 # _pdbx_entry_details.entry_id 9UUL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 193 ? ? -173.07 148.73 2 1 ALA A 194 ? ? -170.63 144.07 3 1 SER A 240 ? ? -123.73 -157.56 4 1 ASN A 329 ? ? -96.80 58.75 5 1 MET A 338 ? ? -93.89 -68.88 6 1 ALA A 350 ? ? -171.81 137.35 7 1 ASN A 376 ? ? -50.43 109.28 8 1 PRO A 393 ? ? -80.59 46.01 9 1 ASN A 412 ? ? -80.53 31.83 10 1 GLU B 31 ? ? -105.81 46.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 155 ? A GLY 1 2 1 Y 1 A HIS 156 ? A HIS 2 3 1 Y 1 A MET 157 ? A MET 3 4 1 Y 1 A GLN 158 ? A GLN 4 5 1 Y 1 A LYS 219 ? A LYS 65 6 1 Y 1 A ILE 220 ? A ILE 66 7 1 Y 1 A VAL 221 ? A VAL 67 8 1 Y 1 A ILE 222 ? A ILE 68 9 1 Y 1 A GLU 223 ? A GLU 69 10 1 Y 1 A LYS 224 ? A LYS 70 11 1 Y 1 A GLN 225 ? A GLN 71 12 1 Y 1 A GLY 226 ? A GLY 72 13 1 Y 1 A LYS 227 ? A LYS 73 14 1 Y 1 A GLY 228 ? A GLY 74 15 1 Y 1 A THR 229 ? A THR 75 16 1 Y 1 A ALA 230 ? A ALA 76 17 1 Y 1 A ASP 231 ? A ASP 77 18 1 Y 1 A GLU 232 ? A GLU 78 19 1 Y 1 A THR 233 ? A THR 79 20 1 Y 1 A SER 234 ? A SER 80 21 1 Y 1 A LYS 235 ? A LYS 81 22 1 Y 1 A SER 236 ? A SER 82 23 1 Y 1 A GLY 237 ? A GLY 83 24 1 Y 1 A LYS 238 ? A LYS 84 25 1 Y 1 A LEU 254 ? A LEU 100 26 1 Y 1 A SER 255 ? A SER 101 27 1 Y 1 A LYS 256 ? A LYS 102 28 1 Y 1 A PHE 257 ? A PHE 103 29 1 Y 1 A ASP 258 ? A ASP 104 30 1 Y 1 A SER 259 ? A SER 105 31 1 Y 1 A GLU 260 ? A GLU 106 32 1 Y 1 A ARG 261 ? A ARG 107 33 1 Y 1 A SER 262 ? A SER 108 34 1 Y 1 B LEU 22 ? B LEU 1 35 1 Y 1 B TYR 23 ? B TYR 2 36 1 Y 1 B GLU 33 ? B GLU 12 37 1 Y 1 B GLU 34 ? B GLU 13 38 1 Y 1 B GLU 35 ? B GLU 14 39 1 Y 1 B ASP 36 ? B ASP 15 40 1 Y 1 B GLU 37 ? B GLU 16 41 1 Y 1 B ILE 38 ? B ILE 17 42 1 Y 1 B ASP 39 ? B ASP 18 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' RS-2023-00278696 1 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' KGM9952522 2 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' KGM1322511 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3H85 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9UUL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.007964 _atom_sites.fract_transf_matrix[1][2] 0.004598 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009196 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013468 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #