data_9VF4 # _entry.id 9VF4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VF4 pdb_00009vf4 10.2210/pdb9vf4/pdb WWPDB D_1300059574 ? ? EMDB EMD-65024 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2026-05-27 ? 2 'EM metadata' 1 0 2026-05-27 ? 3 'Additional map' 1 0 2026-05-27 1 4 FSC 1 0 2026-05-27 ? 5 'Half map' 1 0 2026-05-27 1 6 'Half map' 1 0 2026-05-27 2 7 Image 1 0 2026-05-27 ? 8 Mask 1 0 2026-05-27 1 9 'Primary map' 1 0 2026-05-27 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'EM metadata' repository 'Initial release' ? ? 3 3 'Additional map' repository 'Initial release' ? ? 4 4 FSC repository 'Initial release' ? ? 5 5 'Half map' repository 'Initial release' ? ? 6 6 'Half map' repository 'Initial release' ? ? 7 7 Image repository 'Initial release' ? ? 8 8 Mask repository 'Initial release' ? ? 9 9 'Primary map' repository 'Initial release' ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VF4 _pdbx_database_status.recvd_initial_deposition_date 2025-06-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'CryoEM structure of phospholipid-independent cyclised RP4 pilus' _pdbx_database_related.db_id EMD-65024 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_contact_author.id 2 _pdbx_contact_author.email konstantinos.beis@imperial.ac.uk _pdbx_contact_author.name_first Konstantinos _pdbx_contact_author.name_last Beis _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5727-4721 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ishimoto, N.' 1 0000-0001-8976-8582 'Beis, K.' 2 0000-0001-5727-4721 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'CryoEM structure of phospholipid-independent cyclised RP4 pilu' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ishimoto, N.' 1 ? primary 'Beis, K.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TrbC/VIRB2 family protein' _entity.formula_weight 8139.474 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGIVVAGGVLIFGGELNAFFRTLIFLVLVMALLVGAQNVMSTFFGRG _entity_poly.pdbx_seq_one_letter_code_can SEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGIVVAGGVLIFGGELNAFFRTLIFLVLVMALLVGAQNVMSTFFGRG _entity_poly.pdbx_strand_id c _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 GLY n 1 4 THR n 1 5 GLY n 1 6 GLY n 1 7 SER n 1 8 LEU n 1 9 PRO n 1 10 TYR n 1 11 GLU n 1 12 SER n 1 13 TRP n 1 14 LEU n 1 15 THR n 1 16 ASN n 1 17 LEU n 1 18 ARG n 1 19 ASN n 1 20 SER n 1 21 VAL n 1 22 THR n 1 23 GLY n 1 24 PRO n 1 25 VAL n 1 26 ALA n 1 27 PHE n 1 28 ALA n 1 29 LEU n 1 30 SER n 1 31 ILE n 1 32 ILE n 1 33 GLY n 1 34 ILE n 1 35 VAL n 1 36 VAL n 1 37 ALA n 1 38 GLY n 1 39 GLY n 1 40 VAL n 1 41 LEU n 1 42 ILE n 1 43 PHE n 1 44 GLY n 1 45 GLY n 1 46 GLU n 1 47 LEU n 1 48 ASN n 1 49 ALA n 1 50 PHE n 1 51 PHE n 1 52 ARG n 1 53 THR n 1 54 LEU n 1 55 ILE n 1 56 PHE n 1 57 LEU n 1 58 VAL n 1 59 LEU n 1 60 VAL n 1 61 MET n 1 62 ALA n 1 63 LEU n 1 64 LEU n 1 65 VAL n 1 66 GLY n 1 67 ALA n 1 68 GLN n 1 69 ASN n 1 70 VAL n 1 71 MET n 1 72 SER n 1 73 THR n 1 74 PHE n 1 75 PHE n 1 76 GLY n 1 77 ARG n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 78 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'p482-1_00154, p492-9_00169' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER c . n A 1 2 GLU 2 2 2 GLU GLU c . n A 1 3 GLY 3 3 3 GLY GLY c . n A 1 4 THR 4 4 4 THR THR c . n A 1 5 GLY 5 5 5 GLY GLY c . n A 1 6 GLY 6 6 6 GLY GLY c . n A 1 7 SER 7 7 7 SER SER c . n A 1 8 LEU 8 8 8 LEU LEU c . n A 1 9 PRO 9 9 9 PRO PRO c . n A 1 10 TYR 10 10 10 TYR TYR c . n A 1 11 GLU 11 11 11 GLU GLU c . n A 1 12 SER 12 12 12 SER SER c . n A 1 13 TRP 13 13 13 TRP TRP c . n A 1 14 LEU 14 14 14 LEU LEU c . n A 1 15 THR 15 15 15 THR THR c . n A 1 16 ASN 16 16 16 ASN ASN c . n A 1 17 LEU 17 17 17 LEU LEU c . n A 1 18 ARG 18 18 18 ARG ARG c . n A 1 19 ASN 19 19 19 ASN ASN c . n A 1 20 SER 20 20 20 SER SER c . n A 1 21 VAL 21 21 21 VAL VAL c . n A 1 22 THR 22 22 22 THR THR c . n A 1 23 GLY 23 23 23 GLY GLY c . n A 1 24 PRO 24 24 24 PRO PRO c . n A 1 25 VAL 25 25 25 VAL VAL c . n A 1 26 ALA 26 26 26 ALA ALA c . n A 1 27 PHE 27 27 27 PHE PHE c . n A 1 28 ALA 28 28 28 ALA ALA c . n A 1 29 LEU 29 29 29 LEU LEU c . n A 1 30 SER 30 30 30 SER SER c . n A 1 31 ILE 31 31 31 ILE ILE c . n A 1 32 ILE 32 32 32 ILE ILE c . n A 1 33 GLY 33 33 33 GLY GLY c . n A 1 34 ILE 34 34 34 ILE ILE c . n A 1 35 VAL 35 35 35 VAL VAL c . n A 1 36 VAL 36 36 36 VAL VAL c . n A 1 37 ALA 37 37 37 ALA ALA c . n A 1 38 GLY 38 38 38 GLY GLY c . n A 1 39 GLY 39 39 39 GLY GLY c . n A 1 40 VAL 40 40 40 VAL VAL c . n A 1 41 LEU 41 41 41 LEU LEU c . n A 1 42 ILE 42 42 42 ILE ILE c . n A 1 43 PHE 43 43 43 PHE PHE c . n A 1 44 GLY 44 44 44 GLY GLY c . n A 1 45 GLY 45 45 45 GLY GLY c . n A 1 46 GLU 46 46 46 GLU GLU c . n A 1 47 LEU 47 47 47 LEU LEU c . n A 1 48 ASN 48 48 48 ASN ASN c . n A 1 49 ALA 49 49 49 ALA ALA c . n A 1 50 PHE 50 50 50 PHE PHE c . n A 1 51 PHE 51 51 51 PHE PHE c . n A 1 52 ARG 52 52 52 ARG ARG c . n A 1 53 THR 53 53 53 THR THR c . n A 1 54 LEU 54 54 54 LEU LEU c . n A 1 55 ILE 55 55 55 ILE ILE c . n A 1 56 PHE 56 56 56 PHE PHE c . n A 1 57 LEU 57 57 57 LEU LEU c . n A 1 58 VAL 58 58 58 VAL VAL c . n A 1 59 LEU 59 59 59 LEU LEU c . n A 1 60 VAL 60 60 60 VAL VAL c . n A 1 61 MET 61 61 61 MET MET c . n A 1 62 ALA 62 62 62 ALA ALA c . n A 1 63 LEU 63 63 63 LEU LEU c . n A 1 64 LEU 64 64 64 LEU LEU c . n A 1 65 VAL 65 65 65 VAL VAL c . n A 1 66 GLY 66 66 66 GLY GLY c . n A 1 67 ALA 67 67 67 ALA ALA c . n A 1 68 GLN 68 68 68 GLN GLN c . n A 1 69 ASN 69 69 69 ASN ASN c . n A 1 70 VAL 70 70 70 VAL VAL c . n A 1 71 MET 71 71 71 MET MET c . n A 1 72 SER 72 72 72 SER SER c . n A 1 73 THR 73 73 73 THR THR c . n A 1 74 PHE 74 74 74 PHE PHE c . n A 1 75 PHE 75 75 75 PHE PHE c . n A 1 76 GLY 76 76 76 GLY GLY c . n A 1 77 ARG 77 77 77 ARG ARG c . n A 1 78 GLY 78 78 78 GLY GLY c . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9VF4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VF4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VF4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VF4 _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.74 _refine.ls_d_res_low ? _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work ? _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'REAL-SPACE (WEIGHTED MAP SUM AT ATOM CENTERS)' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.006 ? 32175 ? f_bond_d ? ? ? 'ELECTRON MICROSCOPY' ? 0.485 ? 43670 ? f_angle_d ? ? ? 'ELECTRON MICROSCOPY' ? 3.834 ? 4455 ? f_dihedral_angle_d ? ? ? 'ELECTRON MICROSCOPY' ? 0.041 ? 5280 ? f_chiral_restr ? ? ? 'ELECTRON MICROSCOPY' ? 0.004 ? 5445 ? f_plane_restr ? ? ? # _struct.entry_id 9VF4 _struct.title 'CryoEM structure of phospholipid-independent cyclised RP4 pilus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VF4 _struct_keywords.text 'Pilus, Conjugation, Antibiotic, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2R4AH65_ECOLX _struct_ref.pdbx_db_accession A0A2R4AH65 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGIVVAGGVLIFGGELNAFFRTLIFLVLVMALLVGAQNVMSTFFGRG _struct_ref.pdbx_align_begin 37 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VF4 _struct_ref_seq.pdbx_strand_id c _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A2R4AH65 _struct_ref_seq.db_align_beg 37 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 78 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details none _pdbx_struct_assembly.oligomeric_details 55-meric _pdbx_struct_assembly.oligomeric_count 55 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression ;1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55 ; _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? -0.54610200 0.83771900 0.00000000 83.50988 -0.83771900 -0.54610200 0.00000000 281.02385 0.00000000 0.00000000 1.00000000 -75.75000 3 'point symmetry operation' ? ? 0.62796300 0.77824300 0.00000000 -47.88684 -0.77824300 0.62796300 0.00000000 135.60422 0.00000000 0.00000000 1.00000000 -75.75000 4 'point symmetry operation' ? ? 0.93420400 -0.35673800 0.00000000 49.81163 0.35673800 0.93420400 0.00000000 -34.29863 0.00000000 0.00000000 1.00000000 -75.75000 5 'point symmetry operation' ? ? -0.05059300 -0.99871900 0.00000000 241.58933 0.99871900 -0.05059300 0.00000000 6.11527 0.00000000 0.00000000 1.00000000 -75.75000 6 'point symmetry operation' ? ? -0.96547300 -0.26050500 0.00000000 262.41599 0.26050500 -0.96547300 0.00000000 200.99528 0.00000000 0.00000000 1.00000000 -75.75000 7 'point symmetry operation' ? ? -0.14746400 0.98906700 0.00000000 18.67308 -0.98906700 -0.14746400 0.00000000 251.87143 0.00000000 0.00000000 1.00000000 -60.60000 8 'point symmetry operation' ? ? 0.89509000 0.44588500 0.00000000 -40.19691 -0.44588500 0.89509000 0.00000000 64.93216 0.00000000 0.00000000 1.00000000 -60.60000 9 'point symmetry operation' ? ? 0.70066000 -0.71349500 0.00000000 119.40107 0.71349500 0.70066000 0.00000000 -48.82394 0.00000000 0.00000000 1.00000000 -60.60000 10 'point symmetry operation' ? ? -0.46205800 -0.88685000 0.00000000 276.90804 0.88685000 -0.46205800 0.00000000 67.81019 0.00000000 0.00000000 1.00000000 -60.60000 11 'point symmetry operation' ? ? -0.98622800 0.16539200 0.00000000 214.65472 -0.16539200 -0.98622800 0.00000000 253.65016 0.00000000 0.00000000 1.00000000 -60.60000 12 'point symmetry operation' ? ? 0.27798500 0.96058500 0.00000000 -28.12462 -0.96058500 0.27798500 0.00000000 198.35835 0.00000000 0.00000000 1.00000000 -45.45000 13 'point symmetry operation' ? ? 0.99947300 0.03245700 0.00000000 -3.76423 -0.03245700 0.99947300 0.00000000 3.88845 0.00000000 0.00000000 1.00000000 -45.45000 14 'point symmetry operation' ? ? 0.33972300 -0.94052600 0.00000000 188.71541 0.94052600 0.33972300 0.00000000 -33.03794 0.00000000 0.00000000 1.00000000 -45.45000 15 'point symmetry operation' ? ? -0.78951300 -0.61373400 0.00000000 283.31397 0.61373400 -0.78951300 0.00000000 138.61019 0.00000000 0.00000000 1.00000000 -45.45000 16 'point symmetry operation' ? ? -0.82766900 0.56121700 0.00000000 149.29947 -0.56121700 -0.82766900 0.00000000 281.62096 0.00000000 0.00000000 1.00000000 -45.45000 17 'point symmetry operation' ? ? 0.65289200 0.75745100 0.00000000 -48.37452 -0.75745100 0.65289200 0.00000000 130.21426 0.00000000 0.00000000 1.00000000 -30.30000 18 'point symmetry operation' ? ? 0.92213300 -0.38687200 0.00000000 54.78709 0.38687200 0.92213300 0.00000000 -36.42803 0.00000000 0.00000000 1.00000000 -30.30000 19 'point symmetry operation' ? ? -0.08298200 -0.99655100 0.00000000 245.15201 0.99655100 -0.08298200 0.00000000 10.18919 0.00000000 0.00000000 1.00000000 -30.30000 20 'point symmetry operation' ? ? -0.97341900 -0.22903100 0.00000000 259.64240 0.22903100 -0.97341900 0.00000000 205.64250 0.00000000 0.00000000 1.00000000 -30.30000 21 'point symmetry operation' ? ? -0.51862400 0.85500200 0.00000000 78.23303 -0.85500200 -0.51862400 0.00000000 279.82207 0.00000000 0.00000000 1.00000000 -30.30000 22 'point symmetry operation' ? ? 0.90909100 0.41659800 0.00000000 -38.39481 -0.41659800 0.90909100 0.00000000 59.82903 0.00000000 0.00000000 1.00000000 -15.15000 23 'point symmetry operation' ? ? 0.67713300 -0.73586100 0.00000000 124.81131 0.73586100 0.67713300 0.00000000 -48.68699 0.00000000 0.00000000 1.00000000 -15.15000 24 'point symmetry operation' ? ? -0.49060000 -0.87138500 0.00000000 278.44966 0.87138500 -0.49060000 0.00000000 72.99796 0.00000000 0.00000000 1.00000000 -15.15000 25 'point symmetry operation' ? ? -0.98034000 0.19731500 0.00000000 210.19725 -0.19731500 -0.98034000 0.00000000 256.71942 0.00000000 0.00000000 1.00000000 -15.15000 26 'point symmetry operation' ? ? -0.11528400 0.99333300 0.00000000 14.37660 -0.99333300 -0.11528400 0.00000000 248.58058 0.00000000 0.00000000 1.00000000 -15.15000 27 'point symmetry operation' ? ? 0.30901700 -0.95105700 0.00000000 193.57676 0.95105700 0.30901700 0.00000000 -30.65955 0.00000000 0.00000000 1.00000000 0.00000 28 'point symmetry operation' ? ? -0.80901700 -0.58778500 0.00000000 282.55422 0.58778500 -0.80901700 0.00000000 143.96857 0.00000000 0.00000000 1.00000000 0.00000 29 'point symmetry operation' ? ? -0.80901700 0.58778500 0.00000000 143.96857 -0.58778500 -0.80901700 0.00000000 282.55422 0.00000000 0.00000000 1.00000000 0.00000 30 'point symmetry operation' ? ? 0.30901700 0.95105700 0.00000000 -30.65955 -0.95105700 0.30901700 0.00000000 193.57676 0.00000000 0.00000000 1.00000000 0.00000 31 'point symmetry operation' ? ? 0.90909100 -0.41659800 0.00000000 59.82903 0.41659800 0.90909100 0.00000000 -38.39481 0.00000000 0.00000000 1.00000000 15.15000 32 'point symmetry operation' ? ? -0.11528400 -0.99333300 0.00000000 248.58058 0.99333300 -0.11528400 0.00000000 14.37660 0.00000000 0.00000000 1.00000000 15.15000 33 'point symmetry operation' ? ? -0.98034000 -0.19731500 0.00000000 256.71942 0.19731500 -0.98034000 0.00000000 210.19725 0.00000000 0.00000000 1.00000000 15.15000 34 'point symmetry operation' ? ? -0.49060000 0.87138500 0.00000000 72.99796 -0.87138500 -0.49060000 0.00000000 278.44966 0.00000000 0.00000000 1.00000000 15.15000 35 'point symmetry operation' ? ? 0.67713300 0.73586100 0.00000000 -48.68699 -0.73586100 0.67713300 0.00000000 124.81131 0.00000000 0.00000000 1.00000000 15.15000 36 'point symmetry operation' ? ? 0.65289200 -0.75745100 0.00000000 130.21426 0.75745100 0.65289200 0.00000000 -48.37452 0.00000000 0.00000000 1.00000000 30.30000 37 'point symmetry operation' ? ? -0.51862400 -0.85500200 0.00000000 279.82207 0.85500200 -0.51862400 0.00000000 78.23303 0.00000000 0.00000000 1.00000000 30.30000 38 'point symmetry operation' ? ? -0.97341900 0.22903100 0.00000000 205.64250 -0.22903100 -0.97341900 0.00000000 259.64240 0.00000000 0.00000000 1.00000000 30.30000 39 'point symmetry operation' ? ? -0.08298200 0.99655100 0.00000000 10.18919 -0.99655100 -0.08298200 0.00000000 245.15201 0.00000000 0.00000000 1.00000000 30.30000 40 'point symmetry operation' ? ? 0.92213300 0.38687200 0.00000000 -36.42803 -0.38687200 0.92213300 0.00000000 54.78709 0.00000000 0.00000000 1.00000000 30.30000 41 'point symmetry operation' ? ? 0.27798500 -0.96058500 0.00000000 198.35835 0.96058500 0.27798500 0.00000000 -28.12462 0.00000000 0.00000000 1.00000000 45.45000 42 'point symmetry operation' ? ? -0.82766900 -0.56121700 0.00000000 281.62096 0.56121700 -0.82766900 0.00000000 149.29947 0.00000000 0.00000000 1.00000000 45.45000 43 'point symmetry operation' ? ? -0.78951300 0.61373400 0.00000000 138.61019 -0.61373400 -0.78951300 0.00000000 283.31397 0.00000000 0.00000000 1.00000000 45.45000 44 'point symmetry operation' ? ? 0.33972300 0.94052600 0.00000000 -33.03794 -0.94052600 0.33972300 0.00000000 188.71541 0.00000000 0.00000000 1.00000000 45.45000 45 'point symmetry operation' ? ? 0.99947300 -0.03245700 0.00000000 3.88845 0.03245700 0.99947300 0.00000000 -3.76423 0.00000000 0.00000000 1.00000000 45.45000 46 'point symmetry operation' ? ? -0.14746400 -0.98906700 0.00000000 251.87143 0.98906700 -0.14746400 0.00000000 18.67308 0.00000000 0.00000000 1.00000000 60.60000 47 'point symmetry operation' ? ? -0.98622800 -0.16539200 0.00000000 253.65016 0.16539200 -0.98622800 0.00000000 214.65472 0.00000000 0.00000000 1.00000000 60.60000 48 'point symmetry operation' ? ? -0.46205800 0.88685000 0.00000000 67.81019 -0.88685000 -0.46205800 0.00000000 276.90804 0.00000000 0.00000000 1.00000000 60.60000 49 'point symmetry operation' ? ? 0.70066000 0.71349500 0.00000000 -48.82394 -0.71349500 0.70066000 0.00000000 119.40107 0.00000000 0.00000000 1.00000000 60.60000 50 'point symmetry operation' ? ? 0.89509000 -0.44588500 0.00000000 64.93216 0.44588500 0.89509000 0.00000000 -40.19691 0.00000000 0.00000000 1.00000000 60.60000 51 'point symmetry operation' ? ? -0.54610200 -0.83771900 0.00000000 281.02385 0.83771900 -0.54610200 0.00000000 83.50988 0.00000000 0.00000000 1.00000000 75.75000 52 'point symmetry operation' ? ? -0.96547300 0.26050500 0.00000000 200.99528 -0.26050500 -0.96547300 0.00000000 262.41599 0.00000000 0.00000000 1.00000000 75.75000 53 'point symmetry operation' ? ? -0.05059300 0.99871900 0.00000000 6.11527 -0.99871900 -0.05059300 0.00000000 241.58933 0.00000000 0.00000000 1.00000000 75.75000 54 'point symmetry operation' ? ? 0.93420400 0.35673800 0.00000000 -34.29863 -0.35673800 0.93420400 0.00000000 49.81163 0.00000000 0.00000000 1.00000000 75.75000 55 'point symmetry operation' ? ? 0.62796300 -0.77824300 0.00000000 135.60422 0.77824300 0.62796300 0.00000000 -47.88684 0.00000000 0.00000000 1.00000000 75.75000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 9 ? GLY A 23 ? PRO c 9 GLY c 23 1 ? 15 HELX_P HELX_P2 AA2 GLY A 23 ? PHE A 43 ? GLY c 23 PHE c 43 1 ? 21 HELX_P HELX_P3 AA3 GLU A 46 ? VAL A 65 ? GLU c 46 VAL c 65 1 ? 20 HELX_P HELX_P4 AA4 GLY A 66 ? THR A 73 ? GLY c 66 THR c 73 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLY _struct_conn.ptnr2_label_seq_id 78 _struct_conn.ptnr2_label_atom_id C _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id c _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id c _struct_conn.ptnr2_auth_comp_id GLY _struct_conn.ptnr2_auth_seq_id 78 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.328 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SER _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id GLY _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 78 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id SER _pdbx_modification_feature.auth_asym_id c _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id GLY _pdbx_modification_feature.modified_residue_auth_asym_id c _pdbx_modification_feature.modified_residue_auth_seq_id 78 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom N _pdbx_modification_feature.modified_residue_id_linking_atom C _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # _pdbx_entry_details.entry_id 9VF4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 N c SER 1 ? ? O c GLY 78 ? ? 2.08 2 1 O c GLU 2 ? ? NH1 c ARG 77 ? ? 2.17 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id c _pdbx_validate_torsion.auth_seq_id 2 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 55.15 _pdbx_validate_torsion.psi -96.03 # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 9VF4 _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 9VF4 _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.74 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 10674 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages 1 _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type HELICAL # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 8.0 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type 'ORGANELLE OR CELLULAR COMPONENT' _em_entity_assembly.name P-pilus _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 9VF4 _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'TFS KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_min 800 _em_imaging.nominal_defocus_max 1800 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN _em_imaging.objective_aperture ? _em_imaging.microscope_serial_number ? _em_imaging.microscope_version ? # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 300 _em_sample_support.grid_type 'Quantifoil R1.2/1.3' _em_sample_support.details ? _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_vitrification.entry_id 9VF4 _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity 100 _em_vitrification.temp ? _em_vitrification.chamber_temperature 298 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 9VF4 _em_experiment.id 1 _em_experiment.reconstruction_method HELICAL _em_experiment.aggregation_state FILAMENT _em_experiment.entity_assembly_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 ILE N N N N 107 ILE CA C N S 108 ILE C C N N 109 ILE O O N N 110 ILE CB C N S 111 ILE CG1 C N N 112 ILE CG2 C N N 113 ILE CD1 C N N 114 ILE OXT O N N 115 ILE H H N N 116 ILE H2 H N N 117 ILE HA H N N 118 ILE HB H N N 119 ILE HG12 H N N 120 ILE HG13 H N N 121 ILE HG21 H N N 122 ILE HG22 H N N 123 ILE HG23 H N N 124 ILE HD11 H N N 125 ILE HD12 H N N 126 ILE HD13 H N N 127 ILE HXT H N N 128 LEU N N N N 129 LEU CA C N S 130 LEU C C N N 131 LEU O O N N 132 LEU CB C N N 133 LEU CG C N N 134 LEU CD1 C N N 135 LEU CD2 C N N 136 LEU OXT O N N 137 LEU H H N N 138 LEU H2 H N N 139 LEU HA H N N 140 LEU HB2 H N N 141 LEU HB3 H N N 142 LEU HG H N N 143 LEU HD11 H N N 144 LEU HD12 H N N 145 LEU HD13 H N N 146 LEU HD21 H N N 147 LEU HD22 H N N 148 LEU HD23 H N N 149 LEU HXT H N N 150 MET N N N N 151 MET CA C N S 152 MET C C N N 153 MET O O N N 154 MET CB C N N 155 MET CG C N N 156 MET SD S N N 157 MET CE C N N 158 MET OXT O N N 159 MET H H N N 160 MET H2 H N N 161 MET HA H N N 162 MET HB2 H N N 163 MET HB3 H N N 164 MET HG2 H N N 165 MET HG3 H N N 166 MET HE1 H N N 167 MET HE2 H N N 168 MET HE3 H N N 169 MET HXT H N N 170 PHE N N N N 171 PHE CA C N S 172 PHE C C N N 173 PHE O O N N 174 PHE CB C N N 175 PHE CG C Y N 176 PHE CD1 C Y N 177 PHE CD2 C Y N 178 PHE CE1 C Y N 179 PHE CE2 C Y N 180 PHE CZ C Y N 181 PHE OXT O N N 182 PHE H H N N 183 PHE H2 H N N 184 PHE HA H N N 185 PHE HB2 H N N 186 PHE HB3 H N N 187 PHE HD1 H N N 188 PHE HD2 H N N 189 PHE HE1 H N N 190 PHE HE2 H N N 191 PHE HZ H N N 192 PHE HXT H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TRP N N N N 242 TRP CA C N S 243 TRP C C N N 244 TRP O O N N 245 TRP CB C N N 246 TRP CG C Y N 247 TRP CD1 C Y N 248 TRP CD2 C Y N 249 TRP NE1 N Y N 250 TRP CE2 C Y N 251 TRP CE3 C Y N 252 TRP CZ2 C Y N 253 TRP CZ3 C Y N 254 TRP CH2 C Y N 255 TRP OXT O N N 256 TRP H H N N 257 TRP H2 H N N 258 TRP HA H N N 259 TRP HB2 H N N 260 TRP HB3 H N N 261 TRP HD1 H N N 262 TRP HE1 H N N 263 TRP HE3 H N N 264 TRP HZ2 H N N 265 TRP HZ3 H N N 266 TRP HH2 H N N 267 TRP HXT H N N 268 TYR N N N N 269 TYR CA C N S 270 TYR C C N N 271 TYR O O N N 272 TYR CB C N N 273 TYR CG C Y N 274 TYR CD1 C Y N 275 TYR CD2 C Y N 276 TYR CE1 C Y N 277 TYR CE2 C Y N 278 TYR CZ C Y N 279 TYR OH O N N 280 TYR OXT O N N 281 TYR H H N N 282 TYR H2 H N N 283 TYR HA H N N 284 TYR HB2 H N N 285 TYR HB3 H N N 286 TYR HD1 H N N 287 TYR HD2 H N N 288 TYR HE1 H N N 289 TYR HE2 H N N 290 TYR HH H N N 291 TYR HXT H N N 292 VAL N N N N 293 VAL CA C N S 294 VAL C C N N 295 VAL O O N N 296 VAL CB C N N 297 VAL CG1 C N N 298 VAL CG2 C N N 299 VAL OXT O N N 300 VAL H H N N 301 VAL H2 H N N 302 VAL HA H N N 303 VAL HB H N N 304 VAL HG11 H N N 305 VAL HG12 H N N 306 VAL HG13 H N N 307 VAL HG21 H N N 308 VAL HG22 H N N 309 VAL HG23 H N N 310 VAL HXT H N N 311 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 ILE N CA sing N N 101 ILE N H sing N N 102 ILE N H2 sing N N 103 ILE CA C sing N N 104 ILE CA CB sing N N 105 ILE CA HA sing N N 106 ILE C O doub N N 107 ILE C OXT sing N N 108 ILE CB CG1 sing N N 109 ILE CB CG2 sing N N 110 ILE CB HB sing N N 111 ILE CG1 CD1 sing N N 112 ILE CG1 HG12 sing N N 113 ILE CG1 HG13 sing N N 114 ILE CG2 HG21 sing N N 115 ILE CG2 HG22 sing N N 116 ILE CG2 HG23 sing N N 117 ILE CD1 HD11 sing N N 118 ILE CD1 HD12 sing N N 119 ILE CD1 HD13 sing N N 120 ILE OXT HXT sing N N 121 LEU N CA sing N N 122 LEU N H sing N N 123 LEU N H2 sing N N 124 LEU CA C sing N N 125 LEU CA CB sing N N 126 LEU CA HA sing N N 127 LEU C O doub N N 128 LEU C OXT sing N N 129 LEU CB CG sing N N 130 LEU CB HB2 sing N N 131 LEU CB HB3 sing N N 132 LEU CG CD1 sing N N 133 LEU CG CD2 sing N N 134 LEU CG HG sing N N 135 LEU CD1 HD11 sing N N 136 LEU CD1 HD12 sing N N 137 LEU CD1 HD13 sing N N 138 LEU CD2 HD21 sing N N 139 LEU CD2 HD22 sing N N 140 LEU CD2 HD23 sing N N 141 LEU OXT HXT sing N N 142 MET N CA sing N N 143 MET N H sing N N 144 MET N H2 sing N N 145 MET CA C sing N N 146 MET CA CB sing N N 147 MET CA HA sing N N 148 MET C O doub N N 149 MET C OXT sing N N 150 MET CB CG sing N N 151 MET CB HB2 sing N N 152 MET CB HB3 sing N N 153 MET CG SD sing N N 154 MET CG HG2 sing N N 155 MET CG HG3 sing N N 156 MET SD CE sing N N 157 MET CE HE1 sing N N 158 MET CE HE2 sing N N 159 MET CE HE3 sing N N 160 MET OXT HXT sing N N 161 PHE N CA sing N N 162 PHE N H sing N N 163 PHE N H2 sing N N 164 PHE CA C sing N N 165 PHE CA CB sing N N 166 PHE CA HA sing N N 167 PHE C O doub N N 168 PHE C OXT sing N N 169 PHE CB CG sing N N 170 PHE CB HB2 sing N N 171 PHE CB HB3 sing N N 172 PHE CG CD1 doub Y N 173 PHE CG CD2 sing Y N 174 PHE CD1 CE1 sing Y N 175 PHE CD1 HD1 sing N N 176 PHE CD2 CE2 doub Y N 177 PHE CD2 HD2 sing N N 178 PHE CE1 CZ doub Y N 179 PHE CE1 HE1 sing N N 180 PHE CE2 CZ sing Y N 181 PHE CE2 HE2 sing N N 182 PHE CZ HZ sing N N 183 PHE OXT HXT sing N N 184 PRO N CA sing N N 185 PRO N CD sing N N 186 PRO N H sing N N 187 PRO CA C sing N N 188 PRO CA CB sing N N 189 PRO CA HA sing N N 190 PRO C O doub N N 191 PRO C OXT sing N N 192 PRO CB CG sing N N 193 PRO CB HB2 sing N N 194 PRO CB HB3 sing N N 195 PRO CG CD sing N N 196 PRO CG HG2 sing N N 197 PRO CG HG3 sing N N 198 PRO CD HD2 sing N N 199 PRO CD HD3 sing N N 200 PRO OXT HXT sing N N 201 SER N CA sing N N 202 SER N H sing N N 203 SER N H2 sing N N 204 SER CA C sing N N 205 SER CA CB sing N N 206 SER CA HA sing N N 207 SER C O doub N N 208 SER C OXT sing N N 209 SER CB OG sing N N 210 SER CB HB2 sing N N 211 SER CB HB3 sing N N 212 SER OG HG sing N N 213 SER OXT HXT sing N N 214 THR N CA sing N N 215 THR N H sing N N 216 THR N H2 sing N N 217 THR CA C sing N N 218 THR CA CB sing N N 219 THR CA HA sing N N 220 THR C O doub N N 221 THR C OXT sing N N 222 THR CB OG1 sing N N 223 THR CB CG2 sing N N 224 THR CB HB sing N N 225 THR OG1 HG1 sing N N 226 THR CG2 HG21 sing N N 227 THR CG2 HG22 sing N N 228 THR CG2 HG23 sing N N 229 THR OXT HXT sing N N 230 TRP N CA sing N N 231 TRP N H sing N N 232 TRP N H2 sing N N 233 TRP CA C sing N N 234 TRP CA CB sing N N 235 TRP CA HA sing N N 236 TRP C O doub N N 237 TRP C OXT sing N N 238 TRP CB CG sing N N 239 TRP CB HB2 sing N N 240 TRP CB HB3 sing N N 241 TRP CG CD1 doub Y N 242 TRP CG CD2 sing Y N 243 TRP CD1 NE1 sing Y N 244 TRP CD1 HD1 sing N N 245 TRP CD2 CE2 doub Y N 246 TRP CD2 CE3 sing Y N 247 TRP NE1 CE2 sing Y N 248 TRP NE1 HE1 sing N N 249 TRP CE2 CZ2 sing Y N 250 TRP CE3 CZ3 doub Y N 251 TRP CE3 HE3 sing N N 252 TRP CZ2 CH2 doub Y N 253 TRP CZ2 HZ2 sing N N 254 TRP CZ3 CH2 sing Y N 255 TRP CZ3 HZ3 sing N N 256 TRP CH2 HH2 sing N N 257 TRP OXT HXT sing N N 258 TYR N CA sing N N 259 TYR N H sing N N 260 TYR N H2 sing N N 261 TYR CA C sing N N 262 TYR CA CB sing N N 263 TYR CA HA sing N N 264 TYR C O doub N N 265 TYR C OXT sing N N 266 TYR CB CG sing N N 267 TYR CB HB2 sing N N 268 TYR CB HB3 sing N N 269 TYR CG CD1 doub Y N 270 TYR CG CD2 sing Y N 271 TYR CD1 CE1 sing Y N 272 TYR CD1 HD1 sing N N 273 TYR CD2 CE2 doub Y N 274 TYR CD2 HD2 sing N N 275 TYR CE1 CZ doub Y N 276 TYR CE1 HE1 sing N N 277 TYR CE2 CZ sing Y N 278 TYR CE2 HE2 sing N N 279 TYR CZ OH sing N N 280 TYR OH HH sing N N 281 TYR OXT HXT sing N N 282 VAL N CA sing N N 283 VAL N H sing N N 284 VAL N H2 sing N N 285 VAL CA C sing N N 286 VAL CA CB sing N N 287 VAL CA HA sing N N 288 VAL C O doub N N 289 VAL C OXT sing N N 290 VAL CB CG1 sing N N 291 VAL CB CG2 sing N N 292 VAL CB HB sing N N 293 VAL CG1 HG11 sing N N 294 VAL CG1 HG12 sing N N 295 VAL CG1 HG13 sing N N 296 VAL CG2 HG21 sing N N 297 VAL CG2 HG22 sing N N 298 VAL CG2 HG23 sing N N 299 VAL OXT HXT sing N N 300 # _em_admin.current_status REL _em_admin.deposition_date 2025-06-10 _em_admin.deposition_site PDBJ _em_admin.entry_id 9VF4 _em_admin.last_update 2026-05-27 _em_admin.map_release_date 2026-05-27 _em_admin.title 'CryoEM structure of phospholipid-independent cyclised RP4 pilus' # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type NONE # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units KILODALTONS/NANOMETER _em_entity_assembly_molwt.value 8.14 # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 562 _em_entity_assembly_naturalsource.organism 'Escherichia coli' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? _em_entity_assembly_naturalsource.details ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.details ? _em_helical_entity.axial_symmetry C5 _em_helical_entity.angular_rotation_per_subunit 24.62 _em_helical_entity.axial_rise_per_subunit 15.15 # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 50.0 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'FEI FALCON IV (4k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged 1 _em_image_recording.num_real_images 3405 # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version _em_software.reference_DOI 'PARTICLE SELECTION' ? 1 1 ? ? cryoSPARC ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 EPU ? ? MASKING ? 3 ? ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? cryoSPARC ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? ? 'MODEL FITTING' ? 7 ? 1 ? 'UCSF ChimeraX' ? ? 'MODEL FITTING' ? 8 ? 1 ? Coot ? ? OTHER ? 9 ? ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? cryoSPARC ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? cryoSPARC ? ? CLASSIFICATION ? 12 1 ? ? ? ? ? RECONSTRUCTION ? 13 1 ? ? cryoSPARC ? ? 'MODEL REFINEMENT' ? 14 ? 1 ? PHENIX 1.20.1_4487 ? 'VOLUME SELECTION' ? 15 1 1 1 ? ? ? 'SERIES ALIGNMENT' ? 16 1 1 1 ? ? ? 'MOLECULAR REPLACEMENT' ? 17 1 1 1 ? ? ? 'LATTICE DISTORTION CORRECTION' ? 18 1 1 1 ? ? ? 'SYMMETRY DETERMINATION' ? 19 1 1 1 ? ? ? 'CRYSTALLOGRAPHY MERGING' ? 20 1 1 1 ? ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 9VF4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #