data_9VFE # _entry.id 9VFE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VFE pdb_00009vfe 10.2210/pdb9vfe/pdb WWPDB D_1300060440 ? ? BMRB 31131 ? 10.13018/BMR31131 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-01 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9VFE _pdbx_database_status.recvd_initial_deposition_date 2025-06-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of XPC binding domain of hHR23B (apo form)' _pdbx_database_related.db_id 31131 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email chrischang@princeton.edu _pdbx_contact_author.name_first Christopher _pdbx_contact_author.name_last Chang _pdbx_contact_author.name_mi J. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5732-9497 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xiao, T.' 1 ? 'He, D.' 2 ? 'Kelly, M.J.S.' 3 ? 'Chang, C.J.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 85 _citation.language ? _citation.page_first 3443 _citation.page_last 3459.e11 _citation.title ;RAD23B acquires a copper metalloadaptor function in amphibian-to-reptile evolution to increase metabolism and regulate genomic integrity. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2025.08.024 _citation.pdbx_database_id_PubMed 40972527 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xiao, T.' 1 ? primary 'He, D.' 2 ? primary 'Liu, D.' 3 ? primary 'Jia, S.' 4 ? primary 'Chen, Q.' 5 ? primary 'Silverman, D.' 6 ? primary 'Maitra, N.' 7 ? primary 'Huang, A.Y.' 8 ? primary 'Pezacki, A.' 9 ? primary 'Nguyen, T.T.' 10 ? primary 'Rao, G.' 11 ? primary 'Tillage, R.' 12 ? primary 'Deng, K.' 13 ? primary 'Weinshenker, D.' 14 ? primary 'Britt, R.D.' 15 ? primary 'Kelly, M.J.S.' 16 ? primary 'Dan, Y.' 17 ? primary 'Chang, C.J.' 18 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UV excision repair protein RAD23 homolog B' _entity.formula_weight 8071.005 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HR23B,hHR23B,XP-C repair-complementing complex 58 kDa protein,p58' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGG _entity_poly.pdbx_seq_one_letter_code_can SGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 GLY n 1 4 HIS n 1 5 PRO n 1 6 LEU n 1 7 GLU n 1 8 PHE n 1 9 LEU n 1 10 ARG n 1 11 ASN n 1 12 GLN n 1 13 PRO n 1 14 GLN n 1 15 PHE n 1 16 GLN n 1 17 GLN n 1 18 MET n 1 19 ARG n 1 20 GLN n 1 21 ILE n 1 22 ILE n 1 23 GLN n 1 24 GLN n 1 25 ASN n 1 26 PRO n 1 27 SER n 1 28 LEU n 1 29 LEU n 1 30 PRO n 1 31 ALA n 1 32 LEU n 1 33 LEU n 1 34 GLN n 1 35 GLN n 1 36 ILE n 1 37 GLY n 1 38 ARG n 1 39 GLU n 1 40 ASN n 1 41 PRO n 1 42 GLN n 1 43 LEU n 1 44 LEU n 1 45 GLN n 1 46 GLN n 1 47 ILE n 1 48 SER n 1 49 GLN n 1 50 HIS n 1 51 GLN n 1 52 GLU n 1 53 HIS n 1 54 PHE n 1 55 ILE n 1 56 GLN n 1 57 MET n 1 58 LEU n 1 59 ASN n 1 60 GLU n 1 61 PRO n 1 62 VAL n 1 63 GLN n 1 64 GLU n 1 65 ALA n 1 66 GLY n 1 67 GLY n 1 68 GLN n 1 69 GLY n 1 70 GLY n 1 71 GLY n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 72 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RAD23B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VFE _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9VFE _struct.title 'Solution structure of XPC binding domain of hHR23B (apo form)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VFE _struct_keywords.text 'metal-free form, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RD23B_HUMAN _struct_ref.pdbx_db_accession P54727 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGG _struct_ref.pdbx_align_begin 271 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VFE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54727 _struct_ref_seq.db_align_beg 271 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 342 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 72 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ASN A 11 ? GLU A 7 ASN A 11 5 ? 5 HELX_P HELX_P2 AA2 GLN A 12 ? ASN A 25 ? GLN A 12 ASN A 25 1 ? 14 HELX_P HELX_P3 AA3 LEU A 28 ? ASN A 40 ? LEU A 28 ASN A 40 1 ? 13 HELX_P HELX_P4 AA4 ASN A 40 ? HIS A 50 ? ASN A 40 HIS A 50 1 ? 11 HELX_P HELX_P5 AA5 GLN A 51 ? HIS A 53 ? GLN A 51 HIS A 53 5 ? 3 HELX_P HELX_P6 AA6 PHE A 54 ? GLU A 60 ? PHE A 54 GLU A 60 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9VFE _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 26 ? ? -69.09 0.30 2 1 ASN A 40 ? ? -153.27 81.85 3 1 GLU A 64 ? ? -114.33 -81.31 4 2 ASN A 40 ? ? -150.61 86.23 5 3 LEU A 6 ? ? -113.21 75.71 6 4 ASN A 40 ? ? -154.25 83.86 7 5 GLN A 68 ? ? -156.99 -32.73 8 6 GLN A 68 ? ? -121.27 -59.66 9 8 VAL A 62 ? ? -160.82 113.37 10 9 ASN A 40 ? ? -153.51 82.49 11 10 LEU A 6 ? ? -114.56 70.87 12 10 GLN A 68 ? ? 65.07 -68.69 # _pdbx_nmr_ensemble.entry_id 9VFE _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9VFE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.1 mM [U-100% 13C; U-100% 15N] UV excision repair protein RAD23 homolog B, 20 mM sodium phosphate, 160 mM sodium chloride, 95% H2O/5% [U-100% 2H] D2O ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% [U-100% 2H] D2O' _pdbx_nmr_sample_details.label '13C, 15N_WT' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'UV excision repair protein RAD23 homolog B' 1.1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 160 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 160 _pdbx_nmr_exptl_sample_conditions.details '20 mM sodium phosphate, 160 mM NaCl, pH 7.4' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCA' 1 isotropic 2 1 1 CBCANH 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HBHA(CO)NH' 1 isotropic 5 1 1 '3D C(CO)NH' 1 isotropic 6 1 1 '3D HCCH-TOCSY' 2 isotropic 7 1 1 '3D 1H-13C NOESY' 2 isotropic 8 1 1 '3D 1H-15N NOESY' 2 isotropic 9 1 1 '2D 1H-15N HSQC' 2 isotropic # _pdbx_nmr_refine.entry_id 9VFE _pdbx_nmr_refine.method 'matrix relaxation' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' CYANA 3.98.15 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 refinement 'X-PLOR NIH' 3.7.0.1 'Schwieters, Kuszewski, Tjandra and Clore' 4 'peak picking' CYANA 3.2 ;Guntert, Mumenthaler and Wuthrich now ARTINA/NMRtist: assignments. ARTINA can be used by non-experts, reducing the effort for a protein assignment or structure determination by NMR essentially to the preparation of the sample and the spectra measurements. Klukowski, P., Riek, R. and Guentert, P. Rapid protein assignments and structures from raw NMR spectra with the deep learning technique ARTINA (2022). Nature Communications 13, 6151 ; 5 collection TopSpin 4.0 'Bruker Biospin' 6 processing TopSpin 4.2 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 ILE N N N N 128 ILE CA C N S 129 ILE C C N N 130 ILE O O N N 131 ILE CB C N S 132 ILE CG1 C N N 133 ILE CG2 C N N 134 ILE CD1 C N N 135 ILE OXT O N N 136 ILE H H N N 137 ILE H2 H N N 138 ILE HA H N N 139 ILE HB H N N 140 ILE HG12 H N N 141 ILE HG13 H N N 142 ILE HG21 H N N 143 ILE HG22 H N N 144 ILE HG23 H N N 145 ILE HD11 H N N 146 ILE HD12 H N N 147 ILE HD13 H N N 148 ILE HXT H N N 149 LEU N N N N 150 LEU CA C N S 151 LEU C C N N 152 LEU O O N N 153 LEU CB C N N 154 LEU CG C N N 155 LEU CD1 C N N 156 LEU CD2 C N N 157 LEU OXT O N N 158 LEU H H N N 159 LEU H2 H N N 160 LEU HA H N N 161 LEU HB2 H N N 162 LEU HB3 H N N 163 LEU HG H N N 164 LEU HD11 H N N 165 LEU HD12 H N N 166 LEU HD13 H N N 167 LEU HD21 H N N 168 LEU HD22 H N N 169 LEU HD23 H N N 170 LEU HXT H N N 171 MET N N N N 172 MET CA C N S 173 MET C C N N 174 MET O O N N 175 MET CB C N N 176 MET CG C N N 177 MET SD S N N 178 MET CE C N N 179 MET OXT O N N 180 MET H H N N 181 MET H2 H N N 182 MET HA H N N 183 MET HB2 H N N 184 MET HB3 H N N 185 MET HG2 H N N 186 MET HG3 H N N 187 MET HE1 H N N 188 MET HE2 H N N 189 MET HE3 H N N 190 MET HXT H N N 191 PHE N N N N 192 PHE CA C N S 193 PHE C C N N 194 PHE O O N N 195 PHE CB C N N 196 PHE CG C Y N 197 PHE CD1 C Y N 198 PHE CD2 C Y N 199 PHE CE1 C Y N 200 PHE CE2 C Y N 201 PHE CZ C Y N 202 PHE OXT O N N 203 PHE H H N N 204 PHE H2 H N N 205 PHE HA H N N 206 PHE HB2 H N N 207 PHE HB3 H N N 208 PHE HD1 H N N 209 PHE HD2 H N N 210 PHE HE1 H N N 211 PHE HE2 H N N 212 PHE HZ H N N 213 PHE HXT H N N 214 PRO N N N N 215 PRO CA C N S 216 PRO C C N N 217 PRO O O N N 218 PRO CB C N N 219 PRO CG C N N 220 PRO CD C N N 221 PRO OXT O N N 222 PRO H H N N 223 PRO HA H N N 224 PRO HB2 H N N 225 PRO HB3 H N N 226 PRO HG2 H N N 227 PRO HG3 H N N 228 PRO HD2 H N N 229 PRO HD3 H N N 230 PRO HXT H N N 231 SER N N N N 232 SER CA C N S 233 SER C C N N 234 SER O O N N 235 SER CB C N N 236 SER OG O N N 237 SER OXT O N N 238 SER H H N N 239 SER H2 H N N 240 SER HA H N N 241 SER HB2 H N N 242 SER HB3 H N N 243 SER HG H N N 244 SER HXT H N N 245 VAL N N N N 246 VAL CA C N S 247 VAL C C N N 248 VAL O O N N 249 VAL CB C N N 250 VAL CG1 C N N 251 VAL CG2 C N N 252 VAL OXT O N N 253 VAL H H N N 254 VAL H2 H N N 255 VAL HA H N N 256 VAL HB H N N 257 VAL HG11 H N N 258 VAL HG12 H N N 259 VAL HG13 H N N 260 VAL HG21 H N N 261 VAL HG22 H N N 262 VAL HG23 H N N 263 VAL HXT H N N 264 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 ILE N CA sing N N 122 ILE N H sing N N 123 ILE N H2 sing N N 124 ILE CA C sing N N 125 ILE CA CB sing N N 126 ILE CA HA sing N N 127 ILE C O doub N N 128 ILE C OXT sing N N 129 ILE CB CG1 sing N N 130 ILE CB CG2 sing N N 131 ILE CB HB sing N N 132 ILE CG1 CD1 sing N N 133 ILE CG1 HG12 sing N N 134 ILE CG1 HG13 sing N N 135 ILE CG2 HG21 sing N N 136 ILE CG2 HG22 sing N N 137 ILE CG2 HG23 sing N N 138 ILE CD1 HD11 sing N N 139 ILE CD1 HD12 sing N N 140 ILE CD1 HD13 sing N N 141 ILE OXT HXT sing N N 142 LEU N CA sing N N 143 LEU N H sing N N 144 LEU N H2 sing N N 145 LEU CA C sing N N 146 LEU CA CB sing N N 147 LEU CA HA sing N N 148 LEU C O doub N N 149 LEU C OXT sing N N 150 LEU CB CG sing N N 151 LEU CB HB2 sing N N 152 LEU CB HB3 sing N N 153 LEU CG CD1 sing N N 154 LEU CG CD2 sing N N 155 LEU CG HG sing N N 156 LEU CD1 HD11 sing N N 157 LEU CD1 HD12 sing N N 158 LEU CD1 HD13 sing N N 159 LEU CD2 HD21 sing N N 160 LEU CD2 HD22 sing N N 161 LEU CD2 HD23 sing N N 162 LEU OXT HXT sing N N 163 MET N CA sing N N 164 MET N H sing N N 165 MET N H2 sing N N 166 MET CA C sing N N 167 MET CA CB sing N N 168 MET CA HA sing N N 169 MET C O doub N N 170 MET C OXT sing N N 171 MET CB CG sing N N 172 MET CB HB2 sing N N 173 MET CB HB3 sing N N 174 MET CG SD sing N N 175 MET CG HG2 sing N N 176 MET CG HG3 sing N N 177 MET SD CE sing N N 178 MET CE HE1 sing N N 179 MET CE HE2 sing N N 180 MET CE HE3 sing N N 181 MET OXT HXT sing N N 182 PHE N CA sing N N 183 PHE N H sing N N 184 PHE N H2 sing N N 185 PHE CA C sing N N 186 PHE CA CB sing N N 187 PHE CA HA sing N N 188 PHE C O doub N N 189 PHE C OXT sing N N 190 PHE CB CG sing N N 191 PHE CB HB2 sing N N 192 PHE CB HB3 sing N N 193 PHE CG CD1 doub Y N 194 PHE CG CD2 sing Y N 195 PHE CD1 CE1 sing Y N 196 PHE CD1 HD1 sing N N 197 PHE CD2 CE2 doub Y N 198 PHE CD2 HD2 sing N N 199 PHE CE1 CZ doub Y N 200 PHE CE1 HE1 sing N N 201 PHE CE2 CZ sing Y N 202 PHE CE2 HE2 sing N N 203 PHE CZ HZ sing N N 204 PHE OXT HXT sing N N 205 PRO N CA sing N N 206 PRO N CD sing N N 207 PRO N H sing N N 208 PRO CA C sing N N 209 PRO CA CB sing N N 210 PRO CA HA sing N N 211 PRO C O doub N N 212 PRO C OXT sing N N 213 PRO CB CG sing N N 214 PRO CB HB2 sing N N 215 PRO CB HB3 sing N N 216 PRO CG CD sing N N 217 PRO CG HG2 sing N N 218 PRO CG HG3 sing N N 219 PRO CD HD2 sing N N 220 PRO CD HD3 sing N N 221 PRO OXT HXT sing N N 222 SER N CA sing N N 223 SER N H sing N N 224 SER N H2 sing N N 225 SER CA C sing N N 226 SER CA CB sing N N 227 SER CA HA sing N N 228 SER C O doub N N 229 SER C OXT sing N N 230 SER CB OG sing N N 231 SER CB HB2 sing N N 232 SER CB HB3 sing N N 233 SER OG HG sing N N 234 SER OXT HXT sing N N 235 VAL N CA sing N N 236 VAL N H sing N N 237 VAL N H2 sing N N 238 VAL CA C sing N N 239 VAL CA CB sing N N 240 VAL CA HA sing N N 241 VAL C O doub N N 242 VAL C OXT sing N N 243 VAL CB CG1 sing N N 244 VAL CB CG2 sing N N 245 VAL CB HB sing N N 246 VAL CG1 HG11 sing N N 247 VAL CG1 HG12 sing N N 248 VAL CG1 HG13 sing N N 249 VAL CG2 HG21 sing N N 250 VAL CG2 HG22 sing N N 251 VAL CG2 HG23 sing N N 252 VAL OXT HXT sing N N 253 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 600 ? 2 'AVANCE NEO' ? Bruker 800 ? # _atom_sites.entry_id 9VFE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #