data_9VIP # _entry.id 9VIP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VIP pdb_00009vip 10.2210/pdb9vip/pdb WWPDB D_1300060751 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-08 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VIP _pdbx_database_status.recvd_initial_deposition_date 2025-06-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9VIO _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email wangmzh@ahu.edu.cn _pdbx_contact_author.name_first Mingzhu _pdbx_contact_author.name_last Wang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1416-2759 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, M.' 1 0009-0009-4137-3018 'Kong, C.' 2 ? 'Wei, Q.' 3 ? 'Guo, S.' 4 ? 'Chen, X.' 5 ? 'Wang, M.' 6 0000-0003-1416-2759 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 329 _citation.language ? _citation.page_first 147810 _citation.page_last 147810 _citation.title 'Structural insights into the adenosylcobinamide-phosphate guanylyltransferase activity of CobU from Akkermansia muciniphila.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2025.147810 _citation.pdbx_database_id_PubMed 40976292 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, M.' 1 ? primary 'Kong, C.' 2 ? primary 'Wei, Q.' 3 ? primary 'Guo, S.' 4 ? primary 'Chen, X.' 5 ? primary 'Li, Q.' 6 ? primary 'Wang, M.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Adenosylcobinamide kinase' 22107.193 1 2.7.1.156,2.7.7.62 ? ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 25 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adenosylcobinamide-phosphate guanylyltransferase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMTLVLGGIRSGKSQYAEQIAAGFGKKILYVATAEVWPGAGSMEYRVRKHQERRPKSWLTL ECPRHVASAVGESGLLDQVDGVILECVTLLSSNTLYAQKDPTDYEPFQEALIEEIEALKKLIRQSPVPWVLVSSETGMGI SQSDAETRHYCDGLGIANQLLAKSADEVYFMVAGLPLTVKKG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMTLVLGGIRSGKSQYAEQIAAGFGKKILYVATAEVWPGAGSMEYRVRKHQERRPKSWLTL ECPRHVASAVGESGLLDQVDGVILECVTLLSSNTLYAQKDPTDYEPFQEALIEEIEALKKLIRQSPVPWVLVSSETGMGI SQSDAETRHYCDGLGIANQLLAKSADEVYFMVAGLPLTVKKG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 THR n 1 23 LEU n 1 24 VAL n 1 25 LEU n 1 26 GLY n 1 27 GLY n 1 28 ILE n 1 29 ARG n 1 30 SER n 1 31 GLY n 1 32 LYS n 1 33 SER n 1 34 GLN n 1 35 TYR n 1 36 ALA n 1 37 GLU n 1 38 GLN n 1 39 ILE n 1 40 ALA n 1 41 ALA n 1 42 GLY n 1 43 PHE n 1 44 GLY n 1 45 LYS n 1 46 LYS n 1 47 ILE n 1 48 LEU n 1 49 TYR n 1 50 VAL n 1 51 ALA n 1 52 THR n 1 53 ALA n 1 54 GLU n 1 55 VAL n 1 56 TRP n 1 57 PRO n 1 58 GLY n 1 59 ALA n 1 60 GLY n 1 61 SER n 1 62 MET n 1 63 GLU n 1 64 TYR n 1 65 ARG n 1 66 VAL n 1 67 ARG n 1 68 LYS n 1 69 HIS n 1 70 GLN n 1 71 GLU n 1 72 ARG n 1 73 ARG n 1 74 PRO n 1 75 LYS n 1 76 SER n 1 77 TRP n 1 78 LEU n 1 79 THR n 1 80 LEU n 1 81 GLU n 1 82 CYS n 1 83 PRO n 1 84 ARG n 1 85 HIS n 1 86 VAL n 1 87 ALA n 1 88 SER n 1 89 ALA n 1 90 VAL n 1 91 GLY n 1 92 GLU n 1 93 SER n 1 94 GLY n 1 95 LEU n 1 96 LEU n 1 97 ASP n 1 98 GLN n 1 99 VAL n 1 100 ASP n 1 101 GLY n 1 102 VAL n 1 103 ILE n 1 104 LEU n 1 105 GLU n 1 106 CYS n 1 107 VAL n 1 108 THR n 1 109 LEU n 1 110 LEU n 1 111 SER n 1 112 SER n 1 113 ASN n 1 114 THR n 1 115 LEU n 1 116 TYR n 1 117 ALA n 1 118 GLN n 1 119 LYS n 1 120 ASP n 1 121 PRO n 1 122 THR n 1 123 ASP n 1 124 TYR n 1 125 GLU n 1 126 PRO n 1 127 PHE n 1 128 GLN n 1 129 GLU n 1 130 ALA n 1 131 LEU n 1 132 ILE n 1 133 GLU n 1 134 GLU n 1 135 ILE n 1 136 GLU n 1 137 ALA n 1 138 LEU n 1 139 LYS n 1 140 LYS n 1 141 LEU n 1 142 ILE n 1 143 ARG n 1 144 GLN n 1 145 SER n 1 146 PRO n 1 147 VAL n 1 148 PRO n 1 149 TRP n 1 150 VAL n 1 151 LEU n 1 152 VAL n 1 153 SER n 1 154 SER n 1 155 GLU n 1 156 THR n 1 157 GLY n 1 158 MET n 1 159 GLY n 1 160 ILE n 1 161 SER n 1 162 GLN n 1 163 SER n 1 164 ASP n 1 165 ALA n 1 166 GLU n 1 167 THR n 1 168 ARG n 1 169 HIS n 1 170 TYR n 1 171 CYS n 1 172 ASP n 1 173 GLY n 1 174 LEU n 1 175 GLY n 1 176 ILE n 1 177 ALA n 1 178 ASN n 1 179 GLN n 1 180 LEU n 1 181 LEU n 1 182 ALA n 1 183 LYS n 1 184 SER n 1 185 ALA n 1 186 ASP n 1 187 GLU n 1 188 VAL n 1 189 TYR n 1 190 PHE n 1 191 MET n 1 192 VAL n 1 193 ALA n 1 194 GLY n 1 195 LEU n 1 196 PRO n 1 197 LEU n 1 198 THR n 1 199 VAL n 1 200 LYS n 1 201 LYS n 1 202 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 202 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Amuc_1678 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Akkermansia muciniphila ATCC BAA-835' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 349741 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 -2 GLY GLY A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 THR 22 2 2 THR THR A . n A 1 23 LEU 23 3 3 LEU LEU A . n A 1 24 VAL 24 4 4 VAL VAL A . n A 1 25 LEU 25 5 5 LEU LEU A . n A 1 26 GLY 26 6 6 GLY GLY A . n A 1 27 GLY 27 7 7 GLY GLY A . n A 1 28 ILE 28 8 8 ILE ILE A . n A 1 29 ARG 29 9 9 ARG ARG A . n A 1 30 SER 30 10 10 SER SER A . n A 1 31 GLY 31 11 11 GLY GLY A . n A 1 32 LYS 32 12 12 LYS LYS A . n A 1 33 SER 33 13 13 SER SER A . n A 1 34 GLN 34 14 14 GLN GLN A . n A 1 35 TYR 35 15 15 TYR TYR A . n A 1 36 ALA 36 16 16 ALA ALA A . n A 1 37 GLU 37 17 17 GLU GLU A . n A 1 38 GLN 38 18 18 GLN GLN A . n A 1 39 ILE 39 19 19 ILE ILE A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 ALA 41 21 21 ALA ALA A . n A 1 42 GLY 42 22 22 GLY GLY A . n A 1 43 PHE 43 23 23 PHE PHE A . n A 1 44 GLY 44 24 24 GLY GLY A . n A 1 45 LYS 45 25 25 LYS LYS A . n A 1 46 LYS 46 26 26 LYS LYS A . n A 1 47 ILE 47 27 27 ILE ILE A . n A 1 48 LEU 48 28 28 LEU LEU A . n A 1 49 TYR 49 29 29 TYR TYR A . n A 1 50 VAL 50 30 30 VAL VAL A . n A 1 51 ALA 51 31 31 ALA ALA A . n A 1 52 THR 52 32 32 THR THR A . n A 1 53 ALA 53 33 33 ALA ALA A . n A 1 54 GLU 54 34 34 GLU GLU A . n A 1 55 VAL 55 35 ? ? ? A . n A 1 56 TRP 56 36 ? ? ? A . n A 1 57 PRO 57 37 ? ? ? A . n A 1 58 GLY 58 38 ? ? ? A . n A 1 59 ALA 59 39 ? ? ? A . n A 1 60 GLY 60 40 ? ? ? A . n A 1 61 SER 61 41 ? ? ? A . n A 1 62 MET 62 42 42 MET MET A . n A 1 63 GLU 63 43 43 GLU GLU A . n A 1 64 TYR 64 44 44 TYR TYR A . n A 1 65 ARG 65 45 45 ARG ARG A . n A 1 66 VAL 66 46 46 VAL VAL A . n A 1 67 ARG 67 47 47 ARG ARG A . n A 1 68 LYS 68 48 48 LYS LYS A . n A 1 69 HIS 69 49 49 HIS HIS A . n A 1 70 GLN 70 50 50 GLN GLN A . n A 1 71 GLU 71 51 51 GLU GLU A . n A 1 72 ARG 72 52 52 ARG ARG A . n A 1 73 ARG 73 53 53 ARG ARG A . n A 1 74 PRO 74 54 54 PRO PRO A . n A 1 75 LYS 75 55 55 LYS LYS A . n A 1 76 SER 76 56 56 SER SER A . n A 1 77 TRP 77 57 57 TRP TRP A . n A 1 78 LEU 78 58 58 LEU LEU A . n A 1 79 THR 79 59 59 THR THR A . n A 1 80 LEU 80 60 60 LEU LEU A . n A 1 81 GLU 81 61 61 GLU GLU A . n A 1 82 CYS 82 62 62 CYS CYS A . n A 1 83 PRO 83 63 63 PRO PRO A . n A 1 84 ARG 84 64 64 ARG ARG A . n A 1 85 HIS 85 65 65 HIS HIS A . n A 1 86 VAL 86 66 66 VAL VAL A . n A 1 87 ALA 87 67 67 ALA ALA A . n A 1 88 SER 88 68 68 SER SER A . n A 1 89 ALA 89 69 69 ALA ALA A . n A 1 90 VAL 90 70 70 VAL VAL A . n A 1 91 GLY 91 71 71 GLY GLY A . n A 1 92 GLU 92 72 72 GLU GLU A . n A 1 93 SER 93 73 73 SER SER A . n A 1 94 GLY 94 74 74 GLY GLY A . n A 1 95 LEU 95 75 75 LEU LEU A . n A 1 96 LEU 96 76 76 LEU LEU A . n A 1 97 ASP 97 77 77 ASP ASP A . n A 1 98 GLN 98 78 78 GLN GLN A . n A 1 99 VAL 99 79 79 VAL VAL A . n A 1 100 ASP 100 80 80 ASP ASP A . n A 1 101 GLY 101 81 81 GLY GLY A . n A 1 102 VAL 102 82 82 VAL VAL A . n A 1 103 ILE 103 83 83 ILE ILE A . n A 1 104 LEU 104 84 84 LEU LEU A . n A 1 105 GLU 105 85 85 GLU GLU A . n A 1 106 CYS 106 86 86 CYS CYS A . n A 1 107 VAL 107 87 87 VAL VAL A . n A 1 108 THR 108 88 88 THR THR A . n A 1 109 LEU 109 89 89 LEU LEU A . n A 1 110 LEU 110 90 90 LEU LEU A . n A 1 111 SER 111 91 91 SER SER A . n A 1 112 SER 112 92 92 SER SER A . n A 1 113 ASN 113 93 93 ASN ASN A . n A 1 114 THR 114 94 94 THR THR A . n A 1 115 LEU 115 95 95 LEU LEU A . n A 1 116 TYR 116 96 96 TYR TYR A . n A 1 117 ALA 117 97 97 ALA ALA A . n A 1 118 GLN 118 98 98 GLN GLN A . n A 1 119 LYS 119 99 99 LYS LYS A . n A 1 120 ASP 120 100 100 ASP ASP A . n A 1 121 PRO 121 101 101 PRO PRO A . n A 1 122 THR 122 102 102 THR THR A . n A 1 123 ASP 123 103 103 ASP ASP A . n A 1 124 TYR 124 104 104 TYR TYR A . n A 1 125 GLU 125 105 105 GLU GLU A . n A 1 126 PRO 126 106 106 PRO PRO A . n A 1 127 PHE 127 107 107 PHE PHE A . n A 1 128 GLN 128 108 108 GLN GLN A . n A 1 129 GLU 129 109 109 GLU GLU A . n A 1 130 ALA 130 110 110 ALA ALA A . n A 1 131 LEU 131 111 111 LEU LEU A . n A 1 132 ILE 132 112 112 ILE ILE A . n A 1 133 GLU 133 113 113 GLU GLU A . n A 1 134 GLU 134 114 114 GLU GLU A . n A 1 135 ILE 135 115 115 ILE ILE A . n A 1 136 GLU 136 116 116 GLU GLU A . n A 1 137 ALA 137 117 117 ALA ALA A . n A 1 138 LEU 138 118 118 LEU LEU A . n A 1 139 LYS 139 119 119 LYS LYS A . n A 1 140 LYS 140 120 120 LYS LYS A . n A 1 141 LEU 141 121 121 LEU LEU A . n A 1 142 ILE 142 122 122 ILE ILE A . n A 1 143 ARG 143 123 123 ARG ARG A . n A 1 144 GLN 144 124 124 GLN GLN A . n A 1 145 SER 145 125 125 SER SER A . n A 1 146 PRO 146 126 126 PRO PRO A . n A 1 147 VAL 147 127 127 VAL VAL A . n A 1 148 PRO 148 128 128 PRO PRO A . n A 1 149 TRP 149 129 129 TRP TRP A . n A 1 150 VAL 150 130 130 VAL VAL A . n A 1 151 LEU 151 131 131 LEU LEU A . n A 1 152 VAL 152 132 132 VAL VAL A . n A 1 153 SER 153 133 133 SER SER A . n A 1 154 SER 154 134 134 SER SER A . n A 1 155 GLU 155 135 135 GLU GLU A . n A 1 156 THR 156 136 136 THR THR A . n A 1 157 GLY 157 137 137 GLY GLY A . n A 1 158 MET 158 138 138 MET MET A . n A 1 159 GLY 159 139 139 GLY GLY A . n A 1 160 ILE 160 140 140 ILE ILE A . n A 1 161 SER 161 141 141 SER SER A . n A 1 162 GLN 162 142 142 GLN GLN A . n A 1 163 SER 163 143 143 SER SER A . n A 1 164 ASP 164 144 144 ASP ASP A . n A 1 165 ALA 165 145 145 ALA ALA A . n A 1 166 GLU 166 146 146 GLU GLU A . n A 1 167 THR 167 147 147 THR THR A . n A 1 168 ARG 168 148 148 ARG ARG A . n A 1 169 HIS 169 149 149 HIS HIS A . n A 1 170 TYR 170 150 150 TYR TYR A . n A 1 171 CYS 171 151 151 CYS CYS A . n A 1 172 ASP 172 152 152 ASP ASP A . n A 1 173 GLY 173 153 153 GLY GLY A . n A 1 174 LEU 174 154 154 LEU LEU A . n A 1 175 GLY 175 155 155 GLY GLY A . n A 1 176 ILE 176 156 156 ILE ILE A . n A 1 177 ALA 177 157 157 ALA ALA A . n A 1 178 ASN 178 158 158 ASN ASN A . n A 1 179 GLN 179 159 159 GLN GLN A . n A 1 180 LEU 180 160 160 LEU LEU A . n A 1 181 LEU 181 161 161 LEU LEU A . n A 1 182 ALA 182 162 162 ALA ALA A . n A 1 183 LYS 183 163 163 LYS LYS A . n A 1 184 SER 184 164 164 SER SER A . n A 1 185 ALA 185 165 165 ALA ALA A . n A 1 186 ASP 186 166 166 ASP ASP A . n A 1 187 GLU 187 167 167 GLU GLU A . n A 1 188 VAL 188 168 168 VAL VAL A . n A 1 189 TYR 189 169 169 TYR TYR A . n A 1 190 PHE 190 170 170 PHE PHE A . n A 1 191 MET 191 171 171 MET MET A . n A 1 192 VAL 192 172 172 VAL VAL A . n A 1 193 ALA 193 173 173 ALA ALA A . n A 1 194 GLY 194 174 174 GLY GLY A . n A 1 195 LEU 195 175 175 LEU LEU A . n A 1 196 PRO 196 176 176 PRO PRO A . n A 1 197 LEU 197 177 177 LEU LEU A . n A 1 198 THR 198 178 178 THR THR A . n A 1 199 VAL 199 179 179 VAL VAL A . n A 1 200 LYS 200 180 180 LYS LYS A . n A 1 201 LYS 201 181 181 LYS LYS A . n A 1 202 GLY 202 182 182 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 201 GOL GOL A . C 3 HOH 1 301 16 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 5 HOH HOH A . C 3 HOH 4 304 14 HOH HOH A . C 3 HOH 5 305 24 HOH HOH A . C 3 HOH 6 306 25 HOH HOH A . C 3 HOH 7 307 11 HOH HOH A . C 3 HOH 8 308 23 HOH HOH A . C 3 HOH 9 309 13 HOH HOH A . C 3 HOH 10 310 20 HOH HOH A . C 3 HOH 11 311 3 HOH HOH A . C 3 HOH 12 312 17 HOH HOH A . C 3 HOH 13 313 9 HOH HOH A . C 3 HOH 14 314 1 HOH HOH A . C 3 HOH 15 315 8 HOH HOH A . C 3 HOH 16 316 22 HOH HOH A . C 3 HOH 17 317 7 HOH HOH A . C 3 HOH 18 318 19 HOH HOH A . C 3 HOH 19 319 18 HOH HOH A . C 3 HOH 20 320 12 HOH HOH A . C 3 HOH 21 321 4 HOH HOH A . C 3 HOH 22 322 15 HOH HOH A . C 3 HOH 23 323 6 HOH HOH A . C 3 HOH 24 324 21 HOH HOH A . C 3 HOH 25 325 10 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 42 ? CG ? A MET 62 CG 2 1 Y 1 A MET 42 ? SD ? A MET 62 SD 3 1 Y 1 A MET 42 ? CE ? A MET 62 CE 4 1 Y 1 A LYS 48 ? CG ? A LYS 68 CG 5 1 Y 1 A LYS 48 ? CD ? A LYS 68 CD 6 1 Y 1 A LYS 48 ? CE ? A LYS 68 CE 7 1 Y 1 A LYS 48 ? NZ ? A LYS 68 NZ 8 1 Y 1 A GLN 50 ? CG ? A GLN 70 CG 9 1 Y 1 A GLN 50 ? CD ? A GLN 70 CD 10 1 Y 1 A GLN 50 ? OE1 ? A GLN 70 OE1 11 1 Y 1 A GLN 50 ? NE2 ? A GLN 70 NE2 12 1 Y 1 A GLU 51 ? CG ? A GLU 71 CG 13 1 Y 1 A GLU 51 ? CD ? A GLU 71 CD 14 1 Y 1 A GLU 51 ? OE1 ? A GLU 71 OE1 15 1 Y 1 A GLU 51 ? OE2 ? A GLU 71 OE2 16 1 Y 1 A ARG 52 ? CG ? A ARG 72 CG 17 1 Y 1 A ARG 52 ? CD ? A ARG 72 CD 18 1 Y 1 A ARG 52 ? NE ? A ARG 72 NE 19 1 Y 1 A ARG 52 ? CZ ? A ARG 72 CZ 20 1 Y 1 A ARG 52 ? NH1 ? A ARG 72 NH1 21 1 Y 1 A ARG 52 ? NH2 ? A ARG 72 NH2 22 1 Y 1 A LYS 55 ? CG ? A LYS 75 CG 23 1 Y 1 A LYS 55 ? CD ? A LYS 75 CD 24 1 Y 1 A LYS 55 ? CE ? A LYS 75 CE 25 1 Y 1 A LYS 55 ? NZ ? A LYS 75 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9VIP _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.115 _cell.length_a_esd ? _cell.length_b 88.115 _cell.length_b_esd ? _cell.length_c 88.115 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VIP _symmetry.cell_setting ? _symmetry.Int_Tables_number 195 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VIP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05M cesium chloride, 0.1M MES monohydrate pH 7.0, 26% Jeffamine M-600, pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-06-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9785 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NFPSS BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9785 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site NFPSS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9VIP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10366 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 36.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.964 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.105 _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.103 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.30 2.38 ? ? ? ? ? ? 1001 ? ? ? ? ? ? ? ? ? ? ? 40.1 0.911 ? ? 1.766 0.278 ? 1 1 0.886 0.969 ? 100.0 ? 1.744 ? ? ? ? ? ? ? ? ? 2.38 2.48 ? ? ? ? ? ? 1007 ? ? ? ? ? ? ? ? ? ? ? 39.4 0.938 ? ? 1.185 0.188 ? 2 1 0.949 0.987 ? 100.0 ? 1.170 ? ? ? ? ? ? ? ? ? 2.48 2.59 ? ? ? ? ? ? 1046 ? ? ? ? ? ? ? ? ? ? ? 40.2 0.961 ? ? 0.760 0.120 ? 3 1 0.966 0.991 ? 100.0 ? 0.751 ? ? ? ? ? ? ? ? ? 2.59 2.73 ? ? ? ? ? ? 1013 ? ? ? ? ? ? ? ? ? ? ? 38.6 1.012 ? ? 0.538 0.086 ? 4 1 0.981 0.995 ? 100.0 ? 0.531 ? ? ? ? ? ? ? ? ? 2.73 2.90 ? ? ? ? ? ? 1031 ? ? ? ? ? ? ? ? ? ? ? 38.6 1.007 ? ? 0.335 0.054 ? 5 1 0.993 0.998 ? 100.0 ? 0.331 ? ? ? ? ? ? ? ? ? 2.90 3.12 ? ? ? ? ? ? 1025 ? ? ? ? ? ? ? ? ? ? ? 38.4 0.958 ? ? 0.223 0.036 ? 6 1 0.996 0.999 ? 100.0 ? 0.220 ? ? ? ? ? ? ? ? ? 3.12 3.44 ? ? ? ? ? ? 1038 ? ? ? ? ? ? ? ? ? ? ? 35.5 0.996 ? ? 0.152 0.026 ? 7 1 0.997 0.999 ? 100.0 ? 0.150 ? ? ? ? ? ? ? ? ? 3.44 3.93 ? ? ? ? ? ? 1035 ? ? ? ? ? ? ? ? ? ? ? 33.6 0.966 ? ? 0.112 0.020 ? 8 1 0.998 1.000 ? 100.0 ? 0.110 ? ? ? ? ? ? ? ? ? 3.93 4.95 ? ? ? ? ? ? 1056 ? ? ? ? ? ? ? ? ? ? ? 31.3 0.941 ? ? 0.091 0.017 ? 9 1 0.999 1.000 ? 100.0 ? 0.089 ? ? ? ? ? ? ? ? ? 4.95 50.00 ? ? ? ? ? ? 1114 ? ? ? ? ? ? ? ? ? ? ? 30.5 0.950 ? ? 0.078 0.015 ? 10 1 0.999 1.000 ? 100.0 ? 0.077 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VIP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 29.37 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10306 _refine.ls_number_reflns_R_free 509 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.47 _refine.ls_percent_reflns_R_free 4.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2048 _refine.ls_R_factor_R_free 0.2379 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2031 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.24 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.32 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1347 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1378 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 29.37 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 1379 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.710 ? 1869 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 13.509 ? 504 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.046 ? 216 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 239 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.53 . . 114 2393 98.00 . . . . 0.3005 . . . . . . . . . . . . . . . 0.3421 'X-RAY DIFFRACTION' 2.54 2.90 . . 141 2403 100.00 . . . . 0.2418 . . . . . . . . . . . . . . . 0.3102 'X-RAY DIFFRACTION' 2.90 3.65 . . 141 2436 100.00 . . . . 0.2694 . . . . . . . . . . . . . . . 0.3156 'X-RAY DIFFRACTION' 3.66 29.37 . . 113 2565 100.00 . . . . 0.1694 . . . . . . . . . . . . . . . 0.1907 # _struct.entry_id 9VIP _struct.title ;Crystal strcture of adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU from Akkermansia muciniphila, crystal form II ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VIP _struct_keywords.text ;VB12, Cobamide remodeling, CobU, adenosylcobinamide kinase, adenosylcobinamide phosphate guanylyltransferase, Akkermansia muciniphila, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2UM52_AKKM8 _struct_ref.pdbx_db_accession B2UM52 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTLVLGGIRSGKSQYAEQIAAGFGKKILYVATAEVWPGAGSMEYRVRKHQERRPKSWLTLECPRHVASAVGESGLLDQVD GVILECVTLLSSNTLYAQKDPTDYEPFQEALIEEIEALKKLIRQSPVPWVLVSSETGMGISQSDAETRHYCDGLGIANQL LAKSADEVYFMVAGLPLTVKKG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VIP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 202 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B2UM52 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9VIP MET A 1 ? UNP B2UM52 ? ? 'initiating methionine' -19 1 1 9VIP GLY A 2 ? UNP B2UM52 ? ? 'expression tag' -18 2 1 9VIP SER A 3 ? UNP B2UM52 ? ? 'expression tag' -17 3 1 9VIP SER A 4 ? UNP B2UM52 ? ? 'expression tag' -16 4 1 9VIP HIS A 5 ? UNP B2UM52 ? ? 'expression tag' -15 5 1 9VIP HIS A 6 ? UNP B2UM52 ? ? 'expression tag' -14 6 1 9VIP HIS A 7 ? UNP B2UM52 ? ? 'expression tag' -13 7 1 9VIP HIS A 8 ? UNP B2UM52 ? ? 'expression tag' -12 8 1 9VIP HIS A 9 ? UNP B2UM52 ? ? 'expression tag' -11 9 1 9VIP HIS A 10 ? UNP B2UM52 ? ? 'expression tag' -10 10 1 9VIP SER A 11 ? UNP B2UM52 ? ? 'expression tag' -9 11 1 9VIP SER A 12 ? UNP B2UM52 ? ? 'expression tag' -8 12 1 9VIP GLY A 13 ? UNP B2UM52 ? ? 'expression tag' -7 13 1 9VIP LEU A 14 ? UNP B2UM52 ? ? 'expression tag' -6 14 1 9VIP VAL A 15 ? UNP B2UM52 ? ? 'expression tag' -5 15 1 9VIP PRO A 16 ? UNP B2UM52 ? ? 'expression tag' -4 16 1 9VIP ARG A 17 ? UNP B2UM52 ? ? 'expression tag' -3 17 1 9VIP GLY A 18 ? UNP B2UM52 ? ? 'expression tag' -2 18 1 9VIP SER A 19 ? UNP B2UM52 ? ? 'expression tag' -1 19 1 9VIP HIS A 20 ? UNP B2UM52 ? ? 'expression tag' 0 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5880 ? 1 MORE -46 ? 1 'SSA (A^2)' 24350 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 31 ? GLY A 44 ? GLY A 11 GLY A 24 1 ? 14 HELX_P HELX_P2 AA2 HIS A 85 ? GLY A 94 ? HIS A 65 GLY A 74 1 ? 10 HELX_P HELX_P3 AA3 LEU A 95 ? GLN A 98 ? LEU A 75 GLN A 78 5 ? 4 HELX_P HELX_P4 AA4 CYS A 106 ? ALA A 117 ? CYS A 86 ALA A 97 1 ? 12 HELX_P HELX_P5 AA5 TYR A 124 ? GLN A 144 ? TYR A 104 GLN A 124 1 ? 21 HELX_P HELX_P6 AA6 ASP A 164 ? ALA A 185 ? ASP A 144 ALA A 165 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 105 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 85 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 CYS _struct_mon_prot_cis.pdbx_label_seq_id_2 106 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 CYS _struct_mon_prot_cis.pdbx_auth_seq_id_2 86 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.20 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 78 ? GLU A 81 ? LEU A 58 GLU A 61 AA1 2 ILE A 47 ? ALA A 51 ? ILE A 27 ALA A 31 AA1 3 GLY A 101 ? GLU A 105 ? GLY A 81 GLU A 85 AA1 4 TRP A 149 ? SER A 154 ? TRP A 129 SER A 134 AA1 5 MET A 21 ? GLY A 26 ? MET A 1 GLY A 6 AA1 6 GLU A 187 ? VAL A 192 ? GLU A 167 VAL A 172 AA1 7 LEU A 195 ? LYS A 200 ? LEU A 175 LYS A 180 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 78 ? O LEU A 58 N TYR A 49 ? N TYR A 29 AA1 2 3 N VAL A 50 ? N VAL A 30 O GLU A 105 ? O GLU A 85 AA1 3 4 N VAL A 102 ? N VAL A 82 O VAL A 150 ? O VAL A 130 AA1 4 5 O LEU A 151 ? O LEU A 131 N THR A 22 ? N THR A 2 AA1 5 6 N LEU A 23 ? N LEU A 3 O TYR A 189 ? O TYR A 169 AA1 6 7 N VAL A 188 ? N VAL A 168 O VAL A 199 ? O VAL A 179 # _pdbx_entry_details.entry_id 9VIP _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 304 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 304 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 2.14 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 320 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A VAL 35 ? A VAL 55 19 1 Y 1 A TRP 36 ? A TRP 56 20 1 Y 1 A PRO 37 ? A PRO 57 21 1 Y 1 A GLY 38 ? A GLY 58 22 1 Y 1 A ALA 39 ? A ALA 59 23 1 Y 1 A GLY 40 ? A GLY 60 24 1 Y 1 A SER 41 ? A SER 61 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TRP N N N N 335 TRP CA C N S 336 TRP C C N N 337 TRP O O N N 338 TRP CB C N N 339 TRP CG C Y N 340 TRP CD1 C Y N 341 TRP CD2 C Y N 342 TRP NE1 N Y N 343 TRP CE2 C Y N 344 TRP CE3 C Y N 345 TRP CZ2 C Y N 346 TRP CZ3 C Y N 347 TRP CH2 C Y N 348 TRP OXT O N N 349 TRP H H N N 350 TRP H2 H N N 351 TRP HA H N N 352 TRP HB2 H N N 353 TRP HB3 H N N 354 TRP HD1 H N N 355 TRP HE1 H N N 356 TRP HE3 H N N 357 TRP HZ2 H N N 358 TRP HZ3 H N N 359 TRP HH2 H N N 360 TRP HXT H N N 361 TYR N N N N 362 TYR CA C N S 363 TYR C C N N 364 TYR O O N N 365 TYR CB C N N 366 TYR CG C Y N 367 TYR CD1 C Y N 368 TYR CD2 C Y N 369 TYR CE1 C Y N 370 TYR CE2 C Y N 371 TYR CZ C Y N 372 TYR OH O N N 373 TYR OXT O N N 374 TYR H H N N 375 TYR H2 H N N 376 TYR HA H N N 377 TYR HB2 H N N 378 TYR HB3 H N N 379 TYR HD1 H N N 380 TYR HD2 H N N 381 TYR HE1 H N N 382 TYR HE2 H N N 383 TYR HH H N N 384 TYR HXT H N N 385 VAL N N N N 386 VAL CA C N S 387 VAL C C N N 388 VAL O O N N 389 VAL CB C N N 390 VAL CG1 C N N 391 VAL CG2 C N N 392 VAL OXT O N N 393 VAL H H N N 394 VAL H2 H N N 395 VAL HA H N N 396 VAL HB H N N 397 VAL HG11 H N N 398 VAL HG12 H N N 399 VAL HG13 H N N 400 VAL HG21 H N N 401 VAL HG22 H N N 402 VAL HG23 H N N 403 VAL HXT H N N 404 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 2108085MC75 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9VIP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011349 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011349 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011349 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #