data_9VOM # _entry.id 9VOM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VOM pdb_00009vom 10.2210/pdb9vom/pdb WWPDB D_1300061148 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-10 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VOM _pdbx_database_status.recvd_initial_deposition_date 2025-07-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 wangwm@sxu.edu.cn W.M. Wang ? 'principal investigator/group leader' 0000-0002-0903-3461 3 wanghf@sxu.edu.cn H.F. Wang ? 'principal investigator/group leader' 0000-0002-8162-9243 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, W.M.' 1 0000-0002-0903-3461 'Yao, H.' 2 ? 'Wang, H.F.' 3 0000-0002-8162-9243 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Small _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1613-6829 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first e73922 _citation.page_last e73922 _citation.title 'Redesign of the Ferritin Ferroxidase Center for Universal Molecular Binding or Specific Recognition.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/smll.73922 _citation.pdbx_database_id_PubMed 42178779 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 ? primary 'Yao, H.' 2 ? primary 'Gong, W.' 3 ? primary 'Ma, D.' 4 ? primary 'Qiao, J.' 5 ? primary 'Zhang, Y.' 6 ? primary 'Wu, L.' 7 ? primary 'Fan, C.' 8 ? primary 'Zhao, Y.' 9 ? primary 'Wang, Z.' 10 ? primary 'Jia, Z.' 11 ? primary 'Guo, Y.' 12 ? primary 'Zhang, N.' 13 ? primary 'Zhao, G.' 14 0000-0001-8587-9680 primary 'Yun, Y.' 15 ? primary 'Wang, H.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain, N-terminally processed' 20067.391 1 ? E28A/Y35A/Y55A/H58A/Q59A/E62A/E63A/H66A/K69A/K87Q/E108A/H137A/Y138A/E141A/Q142A/K144A/E148A ? ? 2 non-polymer syn '3-[(E)-phenyldiazenyl]aniline' 197.236 2 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 5 water nat water 18.015 210 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLALYASYVALSMSYYFDRDDVALKNFAKAFLAASHAAREAAEALMKLQNQRGGRI FLQDIQKPDCDDWESGLNAMECALHLAKNVNQSLLELHKLATDKNDPHLCDFIETAALNAAVAAIKALGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;TTASTSQVRQNYHQDSEAAINRQINLALYASYVALSMSYYFDRDDVALKNFAKAFLAASHAAREAAEALMKLQNQRGGRI FLQDIQKPDCDDWESGLNAMECALHLAKNVNQSLLELHKLATDKNDPHLCDFIETAALNAAVAAIKALGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-[(E)-phenyldiazenyl]aniline' A1ES0 3 'MAGNESIUM ION' MG 4 'FE (III) ION' FE 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 ALA n 1 4 SER n 1 5 THR n 1 6 SER n 1 7 GLN n 1 8 VAL n 1 9 ARG n 1 10 GLN n 1 11 ASN n 1 12 TYR n 1 13 HIS n 1 14 GLN n 1 15 ASP n 1 16 SER n 1 17 GLU n 1 18 ALA n 1 19 ALA n 1 20 ILE n 1 21 ASN n 1 22 ARG n 1 23 GLN n 1 24 ILE n 1 25 ASN n 1 26 LEU n 1 27 ALA n 1 28 LEU n 1 29 TYR n 1 30 ALA n 1 31 SER n 1 32 TYR n 1 33 VAL n 1 34 ALA n 1 35 LEU n 1 36 SER n 1 37 MET n 1 38 SER n 1 39 TYR n 1 40 TYR n 1 41 PHE n 1 42 ASP n 1 43 ARG n 1 44 ASP n 1 45 ASP n 1 46 VAL n 1 47 ALA n 1 48 LEU n 1 49 LYS n 1 50 ASN n 1 51 PHE n 1 52 ALA n 1 53 LYS n 1 54 ALA n 1 55 PHE n 1 56 LEU n 1 57 ALA n 1 58 ALA n 1 59 SER n 1 60 HIS n 1 61 ALA n 1 62 ALA n 1 63 ARG n 1 64 GLU n 1 65 ALA n 1 66 ALA n 1 67 GLU n 1 68 ALA n 1 69 LEU n 1 70 MET n 1 71 LYS n 1 72 LEU n 1 73 GLN n 1 74 ASN n 1 75 GLN n 1 76 ARG n 1 77 GLY n 1 78 GLY n 1 79 ARG n 1 80 ILE n 1 81 PHE n 1 82 LEU n 1 83 GLN n 1 84 ASP n 1 85 ILE n 1 86 GLN n 1 87 LYS n 1 88 PRO n 1 89 ASP n 1 90 CYS n 1 91 ASP n 1 92 ASP n 1 93 TRP n 1 94 GLU n 1 95 SER n 1 96 GLY n 1 97 LEU n 1 98 ASN n 1 99 ALA n 1 100 MET n 1 101 GLU n 1 102 CYS n 1 103 ALA n 1 104 LEU n 1 105 HIS n 1 106 LEU n 1 107 ALA n 1 108 LYS n 1 109 ASN n 1 110 VAL n 1 111 ASN n 1 112 GLN n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 GLU n 1 117 LEU n 1 118 HIS n 1 119 LYS n 1 120 LEU n 1 121 ALA n 1 122 THR n 1 123 ASP n 1 124 LYS n 1 125 ASN n 1 126 ASP n 1 127 PRO n 1 128 HIS n 1 129 LEU n 1 130 CYS n 1 131 ASP n 1 132 PHE n 1 133 ILE n 1 134 GLU n 1 135 THR n 1 136 ALA n 1 137 ALA n 1 138 LEU n 1 139 ASN n 1 140 ALA n 1 141 ALA n 1 142 VAL n 1 143 ALA n 1 144 ALA n 1 145 ILE n 1 146 LYS n 1 147 ALA n 1 148 LEU n 1 149 GLY n 1 150 ASP n 1 151 HIS n 1 152 VAL n 1 153 THR n 1 154 ASN n 1 155 LEU n 1 156 ARG n 1 157 LYS n 1 158 MET n 1 159 GLY n 1 160 ALA n 1 161 PRO n 1 162 GLU n 1 163 SER n 1 164 GLY n 1 165 LEU n 1 166 ALA n 1 167 GLU n 1 168 TYR n 1 169 LEU n 1 170 PHE n 1 171 ASP n 1 172 LYS n 1 173 HIS n 1 174 THR n 1 175 LEU n 1 176 GLY n 1 177 ASP n 1 178 SER n 1 179 ASP n 1 180 ASN n 1 181 GLU n 1 182 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1ES0 non-polymer . '3-[(E)-phenyldiazenyl]aniline' ? 'C12 H11 N3' 197.236 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ASP 177 177 ? ? ? A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 ASP 179 179 ? ? ? A . n A 1 180 ASN 180 180 ? ? ? A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 SER 182 182 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1ES0 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1ES0 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1ES0 1 201 1 A1ES0 AZB A . C 2 A1ES0 1 202 2 A1ES0 AZB A . D 3 MG 1 203 1 MG MG A . E 3 MG 1 204 2 MG MG A . F 4 FE 1 205 1 FE FE A . G 5 HOH 1 301 146 HOH HOH A . G 5 HOH 2 302 84 HOH HOH A . G 5 HOH 3 303 98 HOH HOH A . G 5 HOH 4 304 123 HOH HOH A . G 5 HOH 5 305 19 HOH HOH A . G 5 HOH 6 306 166 HOH HOH A . G 5 HOH 7 307 87 HOH HOH A . G 5 HOH 8 308 135 HOH HOH A . G 5 HOH 9 309 62 HOH HOH A . G 5 HOH 10 310 147 HOH HOH A . G 5 HOH 11 311 8 HOH HOH A . G 5 HOH 12 312 15 HOH HOH A . G 5 HOH 13 313 175 HOH HOH A . G 5 HOH 14 314 61 HOH HOH A . G 5 HOH 15 315 48 HOH HOH A . G 5 HOH 16 316 69 HOH HOH A . G 5 HOH 17 317 43 HOH HOH A . G 5 HOH 18 318 70 HOH HOH A . G 5 HOH 19 319 112 HOH HOH A . G 5 HOH 20 320 7 HOH HOH A . G 5 HOH 21 321 74 HOH HOH A . G 5 HOH 22 322 81 HOH HOH A . G 5 HOH 23 323 77 HOH HOH A . G 5 HOH 24 324 161 HOH HOH A . G 5 HOH 25 325 59 HOH HOH A . G 5 HOH 26 326 10 HOH HOH A . G 5 HOH 27 327 121 HOH HOH A . G 5 HOH 28 328 100 HOH HOH A . G 5 HOH 29 329 4 HOH HOH A . G 5 HOH 30 330 93 HOH HOH A . G 5 HOH 31 331 71 HOH HOH A . G 5 HOH 32 332 31 HOH HOH A . G 5 HOH 33 333 50 HOH HOH A . G 5 HOH 34 334 46 HOH HOH A . G 5 HOH 35 335 36 HOH HOH A . G 5 HOH 36 336 21 HOH HOH A . G 5 HOH 37 337 42 HOH HOH A . G 5 HOH 38 338 152 HOH HOH A . G 5 HOH 39 339 73 HOH HOH A . G 5 HOH 40 340 45 HOH HOH A . G 5 HOH 41 341 204 HOH HOH A . G 5 HOH 42 342 159 HOH HOH A . G 5 HOH 43 343 32 HOH HOH A . G 5 HOH 44 344 67 HOH HOH A . G 5 HOH 45 345 122 HOH HOH A . G 5 HOH 46 346 169 HOH HOH A . G 5 HOH 47 347 113 HOH HOH A . G 5 HOH 48 348 153 HOH HOH A . G 5 HOH 49 349 111 HOH HOH A . G 5 HOH 50 350 63 HOH HOH A . G 5 HOH 51 351 129 HOH HOH A . G 5 HOH 52 352 200 HOH HOH A . G 5 HOH 53 353 103 HOH HOH A . G 5 HOH 54 354 117 HOH HOH A . G 5 HOH 55 355 18 HOH HOH A . G 5 HOH 56 356 13 HOH HOH A . G 5 HOH 57 357 3 HOH HOH A . G 5 HOH 58 358 23 HOH HOH A . G 5 HOH 59 359 110 HOH HOH A . G 5 HOH 60 360 82 HOH HOH A . G 5 HOH 61 361 126 HOH HOH A . G 5 HOH 62 362 53 HOH HOH A . G 5 HOH 63 363 65 HOH HOH A . G 5 HOH 64 364 64 HOH HOH A . G 5 HOH 65 365 104 HOH HOH A . G 5 HOH 66 366 55 HOH HOH A . G 5 HOH 67 367 83 HOH HOH A . G 5 HOH 68 368 142 HOH HOH A . G 5 HOH 69 369 11 HOH HOH A . G 5 HOH 70 370 94 HOH HOH A . G 5 HOH 71 371 205 HOH HOH A . G 5 HOH 72 372 12 HOH HOH A . G 5 HOH 73 373 14 HOH HOH A . G 5 HOH 74 374 86 HOH HOH A . G 5 HOH 75 375 72 HOH HOH A . G 5 HOH 76 376 157 HOH HOH A . G 5 HOH 77 377 88 HOH HOH A . G 5 HOH 78 378 9 HOH HOH A . G 5 HOH 79 379 150 HOH HOH A . G 5 HOH 80 380 136 HOH HOH A . G 5 HOH 81 381 170 HOH HOH A . G 5 HOH 82 382 16 HOH HOH A . G 5 HOH 83 383 24 HOH HOH A . G 5 HOH 84 384 165 HOH HOH A . G 5 HOH 85 385 80 HOH HOH A . G 5 HOH 86 386 96 HOH HOH A . G 5 HOH 87 387 1 HOH HOH A . G 5 HOH 88 388 76 HOH HOH A . G 5 HOH 89 389 40 HOH HOH A . G 5 HOH 90 390 137 HOH HOH A . G 5 HOH 91 391 44 HOH HOH A . G 5 HOH 92 392 17 HOH HOH A . G 5 HOH 93 393 26 HOH HOH A . G 5 HOH 94 394 20 HOH HOH A . G 5 HOH 95 395 105 HOH HOH A . G 5 HOH 96 396 120 HOH HOH A . G 5 HOH 97 397 163 HOH HOH A . G 5 HOH 98 398 49 HOH HOH A . G 5 HOH 99 399 194 HOH HOH A . G 5 HOH 100 400 191 HOH HOH A . G 5 HOH 101 401 102 HOH HOH A . G 5 HOH 102 402 116 HOH HOH A . G 5 HOH 103 403 183 HOH HOH A . G 5 HOH 104 404 124 HOH HOH A . G 5 HOH 105 405 118 HOH HOH A . G 5 HOH 106 406 134 HOH HOH A . G 5 HOH 107 407 91 HOH HOH A . G 5 HOH 108 408 68 HOH HOH A . G 5 HOH 109 409 39 HOH HOH A . G 5 HOH 110 410 179 HOH HOH A . G 5 HOH 111 411 202 HOH HOH A . G 5 HOH 112 412 125 HOH HOH A . G 5 HOH 113 413 132 HOH HOH A . G 5 HOH 114 414 180 HOH HOH A . G 5 HOH 115 415 97 HOH HOH A . G 5 HOH 116 416 212 HOH HOH A . G 5 HOH 117 417 141 HOH HOH A . G 5 HOH 118 418 58 HOH HOH A . G 5 HOH 119 419 92 HOH HOH A . G 5 HOH 120 420 108 HOH HOH A . G 5 HOH 121 421 28 HOH HOH A . G 5 HOH 122 422 155 HOH HOH A . G 5 HOH 123 423 198 HOH HOH A . G 5 HOH 124 424 178 HOH HOH A . G 5 HOH 125 425 106 HOH HOH A . G 5 HOH 126 426 115 HOH HOH A . G 5 HOH 127 427 37 HOH HOH A . G 5 HOH 128 428 211 HOH HOH A . G 5 HOH 129 429 199 HOH HOH A . G 5 HOH 130 430 52 HOH HOH A . G 5 HOH 131 431 128 HOH HOH A . G 5 HOH 132 432 201 HOH HOH A . G 5 HOH 133 433 160 HOH HOH A . G 5 HOH 134 434 203 HOH HOH A . G 5 HOH 135 435 182 HOH HOH A . G 5 HOH 136 436 29 HOH HOH A . G 5 HOH 137 437 47 HOH HOH A . G 5 HOH 138 438 195 HOH HOH A . G 5 HOH 139 439 164 HOH HOH A . G 5 HOH 140 440 193 HOH HOH A . G 5 HOH 141 441 174 HOH HOH A . G 5 HOH 142 442 27 HOH HOH A . G 5 HOH 143 443 171 HOH HOH A . G 5 HOH 144 444 143 HOH HOH A . G 5 HOH 145 445 138 HOH HOH A . G 5 HOH 146 446 22 HOH HOH A . G 5 HOH 147 447 197 HOH HOH A . G 5 HOH 148 448 34 HOH HOH A . G 5 HOH 149 449 209 HOH HOH A . G 5 HOH 150 450 210 HOH HOH A . G 5 HOH 151 451 56 HOH HOH A . G 5 HOH 152 452 6 HOH HOH A . G 5 HOH 153 453 156 HOH HOH A . G 5 HOH 154 454 127 HOH HOH A . G 5 HOH 155 455 188 HOH HOH A . G 5 HOH 156 456 41 HOH HOH A . G 5 HOH 157 457 85 HOH HOH A . G 5 HOH 158 458 149 HOH HOH A . G 5 HOH 159 459 75 HOH HOH A . G 5 HOH 160 460 60 HOH HOH A . G 5 HOH 161 461 176 HOH HOH A . G 5 HOH 162 462 158 HOH HOH A . G 5 HOH 163 463 207 HOH HOH A . G 5 HOH 164 464 148 HOH HOH A . G 5 HOH 165 465 167 HOH HOH A . G 5 HOH 166 466 151 HOH HOH A . G 5 HOH 167 467 168 HOH HOH A . G 5 HOH 168 468 140 HOH HOH A . G 5 HOH 169 469 54 HOH HOH A . G 5 HOH 170 470 51 HOH HOH A . G 5 HOH 171 471 2 HOH HOH A . G 5 HOH 172 472 189 HOH HOH A . G 5 HOH 173 473 25 HOH HOH A . G 5 HOH 174 474 206 HOH HOH A . G 5 HOH 175 475 107 HOH HOH A . G 5 HOH 176 476 133 HOH HOH A . G 5 HOH 177 477 89 HOH HOH A . G 5 HOH 178 478 131 HOH HOH A . G 5 HOH 179 479 144 HOH HOH A . G 5 HOH 180 480 162 HOH HOH A . G 5 HOH 181 481 109 HOH HOH A . G 5 HOH 182 482 5 HOH HOH A . G 5 HOH 183 483 186 HOH HOH A . G 5 HOH 184 484 99 HOH HOH A . G 5 HOH 185 485 184 HOH HOH A . G 5 HOH 186 486 145 HOH HOH A . G 5 HOH 187 487 57 HOH HOH A . G 5 HOH 188 488 119 HOH HOH A . G 5 HOH 189 489 196 HOH HOH A . G 5 HOH 190 490 173 HOH HOH A . G 5 HOH 191 491 101 HOH HOH A . G 5 HOH 192 492 66 HOH HOH A . G 5 HOH 193 493 90 HOH HOH A . G 5 HOH 194 494 139 HOH HOH A . G 5 HOH 195 495 35 HOH HOH A . G 5 HOH 196 496 30 HOH HOH A . G 5 HOH 197 497 33 HOH HOH A . G 5 HOH 198 498 208 HOH HOH A . G 5 HOH 199 499 38 HOH HOH A . G 5 HOH 200 500 177 HOH HOH A . G 5 HOH 201 501 78 HOH HOH A . G 5 HOH 202 502 79 HOH HOH A . G 5 HOH 203 503 187 HOH HOH A . G 5 HOH 204 504 213 HOH HOH A . G 5 HOH 205 505 114 HOH HOH A . G 5 HOH 206 506 181 HOH HOH A . G 5 HOH 207 507 130 HOH HOH A . G 5 HOH 208 508 154 HOH HOH A . G 5 HOH 209 509 185 HOH HOH A . G 5 HOH 210 510 192 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.2_4158: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9VOM _cell.details ? _cell.formula_units_Z ? _cell.length_a 183.456 _cell.length_a_esd ? _cell.length_b 183.456 _cell.length_b_esd ? _cell.length_c 183.456 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VOM _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VOM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Bicine MgCl2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-12-10 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9VOM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18428 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.735 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.097 _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star 1.000 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.00 2.03 ? ? ? ? ? ? 890 ? ? ? ? ? ? ? ? ? ? ? 26.2 0.449 ? ? 0.573 0.111 ? 1 1 0.965 0.991 ? 100.0 ? 0.562 ? ? ? ? ? ? ? ? ? 2.03 2.07 ? ? ? ? ? ? 898 ? ? ? ? ? ? ? ? ? ? ? 26.5 0.455 ? ? 0.485 0.094 ? 2 1 0.980 0.995 ? 100.0 ? 0.476 ? ? ? ? ? ? ? ? ? 2.07 2.11 ? ? ? ? ? ? 890 ? ? ? ? ? ? ? ? ? ? ? 26.2 0.474 ? ? 0.428 0.083 ? 3 1 0.984 0.996 ? 100.0 ? 0.420 ? ? ? ? ? ? ? ? ? 2.11 2.15 ? ? ? ? ? ? 906 ? ? ? ? ? ? ? ? ? ? ? 26.0 0.485 ? ? 0.356 0.069 ? 4 1 0.988 0.997 ? 100.0 ? 0.349 ? ? ? ? ? ? ? ? ? 2.15 2.20 ? ? ? ? ? ? 907 ? ? ? ? ? ? ? ? ? ? ? 25.7 0.506 ? ? 0.308 0.060 ? 5 1 0.989 0.997 ? 100.0 ? 0.302 ? ? ? ? ? ? ? ? ? 2.20 2.25 ? ? ? ? ? ? 896 ? ? ? ? ? ? ? ? ? ? ? 25.1 0.538 ? ? 0.286 0.057 ? 6 1 0.990 0.997 ? 100.0 ? 0.281 ? ? ? ? ? ? ? ? ? 2.25 2.31 ? ? ? ? ? ? 892 ? ? ? ? ? ? ? ? ? ? ? 23.3 0.607 ? ? 0.264 0.055 ? 7 1 0.991 0.998 ? 100.0 ? 0.259 ? ? ? ? ? ? ? ? ? 2.31 2.37 ? ? ? ? ? ? 894 ? ? ? ? ? ? ? ? ? ? ? 25.9 0.637 ? ? 0.235 0.046 ? 8 1 0.994 0.999 ? 100.0 ? 0.231 ? ? ? ? ? ? ? ? ? 2.37 2.44 ? ? ? ? ? ? 928 ? ? ? ? ? ? ? ? ? ? ? 26.3 0.611 ? ? 0.214 0.041 ? 9 1 0.994 0.998 ? 100.0 ? 0.210 ? ? ? ? ? ? ? ? ? 2.44 2.52 ? ? ? ? ? ? 891 ? ? ? ? ? ? ? ? ? ? ? 26.5 0.642 ? ? 0.180 0.035 ? 10 1 0.996 0.999 ? 100.0 ? 0.177 ? ? ? ? ? ? ? ? ? 2.52 2.61 ? ? ? ? ? ? 918 ? ? ? ? ? ? ? ? ? ? ? 25.7 0.676 ? ? 0.166 0.032 ? 11 1 0.996 0.999 ? 100.0 ? 0.163 ? ? ? ? ? ? ? ? ? 2.61 2.71 ? ? ? ? ? ? 906 ? ? ? ? ? ? ? ? ? ? ? 25.2 0.724 ? ? 0.146 0.029 ? 12 1 0.997 0.999 ? 100.0 ? 0.143 ? ? ? ? ? ? ? ? ? 2.71 2.84 ? ? ? ? ? ? 918 ? ? ? ? ? ? ? ? ? ? ? 23.3 0.817 ? ? 0.127 0.026 ? 13 1 0.997 0.999 ? 100.0 ? 0.124 ? ? ? ? ? ? ? ? ? 2.84 2.99 ? ? ? ? ? ? 920 ? ? ? ? ? ? ? ? ? ? ? 26.0 0.947 ? ? 0.111 0.022 ? 14 1 0.997 0.999 ? 100.0 ? 0.109 ? ? ? ? ? ? ? ? ? 2.99 3.17 ? ? ? ? ? ? 928 ? ? ? ? ? ? ? ? ? ? ? 25.9 1.028 ? ? 0.098 0.019 ? 15 1 0.998 0.999 ? 100.0 ? 0.096 ? ? ? ? ? ? ? ? ? 3.17 3.42 ? ? ? ? ? ? 929 ? ? ? ? ? ? ? ? ? ? ? 25.5 1.147 ? ? 0.085 0.017 ? 16 1 0.998 1.000 ? 100.0 ? 0.084 ? ? ? ? ? ? ? ? ? 3.42 3.76 ? ? ? ? ? ? 930 ? ? ? ? ? ? ? ? ? ? ? 23.6 1.244 ? ? 0.070 0.014 ? 17 1 0.999 1.000 ? 100.0 ? 0.068 ? ? ? ? ? ? ? ? ? 3.76 4.31 ? ? ? ? ? ? 946 ? ? ? ? ? ? ? ? ? ? ? 25.8 1.182 ? ? 0.060 0.012 ? 18 1 0.999 1.000 ? 100.0 ? 0.059 ? ? ? ? ? ? ? ? ? 4.31 5.43 ? ? ? ? ? ? 973 ? ? ? ? ? ? ? ? ? ? ? 23.6 0.980 ? ? 0.055 0.011 ? 19 1 0.999 1.000 ? 100.0 ? 0.054 ? ? ? ? ? ? ? ? ? 5.43 50.00 ? ? ? ? ? ? 1068 ? ? ? ? ? ? ? ? ? ? ? 22.1 0.540 ? ? 0.042 0.009 ? 20 1 1.000 1.000 ? 100.0 ? 0.041 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VOM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 35.31 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18407 _refine.ls_number_reflns_R_free 1840 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1764 _refine.ls_R_factor_R_free 0.1990 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1740 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.19 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.15 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1337 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 210 _refine_hist.number_atoms_total 1580 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 35.31 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1392 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.718 ? 1878 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 4.675 ? 184 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 204 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 247 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.06 . . 139 1249 100.00 . . . . 0.1607 . . . . . . . . . . . . . . . 0.2184 'X-RAY DIFFRACTION' 2.06 2.12 . . 137 1239 100.00 . . . . 0.1563 . . . . . . . . . . . . . . . 0.2062 'X-RAY DIFFRACTION' 2.12 2.18 . . 138 1246 100.00 . . . . 0.1468 . . . . . . . . . . . . . . . 0.1790 'X-RAY DIFFRACTION' 2.18 2.26 . . 139 1241 100.00 . . . . 0.1490 . . . . . . . . . . . . . . . 0.1835 'X-RAY DIFFRACTION' 2.26 2.35 . . 139 1248 100.00 . . . . 0.1643 . . . . . . . . . . . . . . . 0.2035 'X-RAY DIFFRACTION' 2.35 2.46 . . 138 1249 100.00 . . . . 0.1744 . . . . . . . . . . . . . . . 0.2252 'X-RAY DIFFRACTION' 2.46 2.59 . . 139 1251 100.00 . . . . 0.1815 . . . . . . . . . . . . . . . 0.2039 'X-RAY DIFFRACTION' 2.59 2.75 . . 141 1267 100.00 . . . . 0.1819 . . . . . . . . . . . . . . . 0.2210 'X-RAY DIFFRACTION' 2.75 2.96 . . 141 1271 100.00 . . . . 0.1856 . . . . . . . . . . . . . . . 0.2189 'X-RAY DIFFRACTION' 2.97 3.26 . . 142 1275 100.00 . . . . 0.1789 . . . . . . . . . . . . . . . 0.1814 'X-RAY DIFFRACTION' 3.26 3.73 . . 143 1293 100.00 . . . . 0.1604 . . . . . . . . . . . . . . . 0.1841 'X-RAY DIFFRACTION' 3.74 4.70 . . 148 1321 100.00 . . . . 0.1507 . . . . . . . . . . . . . . . 0.1694 'X-RAY DIFFRACTION' 4.71 35.31 . . 156 1417 99.00 . . . . 0.2128 . . . . . . . . . . . . . . . 0.2277 # _struct.entry_id 9VOM _struct.title 'Crystal strucrue of HuHF-C2-AZB complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VOM _struct_keywords.text 'Ferritin variant, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VOM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02794 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9VOM ALA A 27 ? UNP P02794 GLU 28 'engineered mutation' 27 1 1 9VOM ALA A 34 ? UNP P02794 TYR 35 'engineered mutation' 34 2 1 9VOM ALA A 54 ? UNP P02794 TYR 55 'engineered mutation' 54 3 1 9VOM ALA A 57 ? UNP P02794 HIS 58 'engineered mutation' 57 4 1 9VOM ALA A 58 ? UNP P02794 GLN 59 'engineered mutation' 58 5 1 9VOM ALA A 61 ? UNP P02794 GLU 62 'engineered mutation' 61 6 1 9VOM ALA A 62 ? UNP P02794 GLU 63 'engineered mutation' 62 7 1 9VOM ALA A 65 ? UNP P02794 HIS 66 'engineered mutation' 65 8 1 9VOM ALA A 68 ? UNP P02794 LYS 69 'engineered mutation' 68 9 1 9VOM GLN A 86 ? UNP P02794 LYS 87 'engineered mutation' 86 10 1 9VOM ALA A 107 ? UNP P02794 GLU 108 'engineered mutation' 107 11 1 9VOM ALA A 136 ? UNP P02794 HIS 137 'engineered mutation' 136 12 1 9VOM ALA A 137 ? UNP P02794 TYR 138 'engineered mutation' 137 13 1 9VOM ALA A 140 ? UNP P02794 GLU 141 'engineered mutation' 140 14 1 9VOM ALA A 141 ? UNP P02794 GLN 142 'engineered mutation' 141 15 1 9VOM ALA A 143 ? UNP P02794 LYS 144 'engineered mutation' 143 16 1 9VOM ALA A 147 ? UNP P02794 GLU 148 'engineered mutation' 147 17 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 98840 ? 1 MORE -1179 ? 1 'SSA (A^2)' 135450 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 13 ? PHE A 41 ? HIS A 13 PHE A 41 1 ? 29 HELX_P HELX_P2 AA2 LEU A 48 ? ARG A 76 ? LEU A 48 ARG A 76 1 ? 29 HELX_P HELX_P3 AA3 SER A 95 ? LYS A 124 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 126 ? ALA A 137 ? ASP A 126 ALA A 137 1 ? 12 HELX_P HELX_P5 AA5 ALA A 137 ? GLY A 159 ? ALA A 137 GLY A 159 1 ? 23 HELX_P HELX_P6 AA6 SER A 163 ? THR A 174 ? SER A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 F FE . FE ? ? A ASP 131 A FE 205 12_555 ? ? ? ? ? ? ? 2.604 ? ? metalc2 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 203 A HOH 311 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc3 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 203 A HOH 311 6_555 ? ? ? ? ? ? ? 2.147 ? ? metalc4 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 203 A HOH 452 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 203 A HOH 452 6_555 ? ? ? ? ? ? ? 2.183 ? ? metalc6 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 305 22_555 ? ? ? ? ? ? ? 2.232 ? ? metalc7 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 341 22_555 ? ? ? ? ? ? ? 2.047 ? ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 470 1_555 ? ? ? ? ? ? ? 2.205 ? ? metalc9 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 470 72_555 ? ? ? ? ? ? ? 2.205 ? ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 495 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc11 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 495 72_555 ? ? ? ? ? ? ? 2.032 ? ? metalc12 metalc ? ? F FE . FE ? ? ? 1_555 G HOH . O ? ? A FE 205 A HOH 399 1_555 ? ? ? ? ? ? ? 2.370 ? ? metalc13 metalc ? ? F FE . FE ? ? ? 1_555 G HOH . O ? ? A FE 205 A HOH 399 6_555 ? ? ? ? ? ? ? 2.370 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 FE ? F FE . ? A FE 205 ? 12_555 O ? G HOH . ? A HOH 399 ? 1_555 142.9 ? 2 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 FE ? F FE . ? A FE 205 ? 12_555 O ? G HOH . ? A HOH 399 ? 6_555 142.9 ? 3 O ? G HOH . ? A HOH 399 ? 1_555 FE ? F FE . ? A FE 205 ? 12_555 O ? G HOH . ? A HOH 399 ? 6_555 0.0 ? 4 O ? G HOH . ? A HOH 311 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? G HOH . ? A HOH 311 ? 6_555 94.7 ? 5 O ? G HOH . ? A HOH 311 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? G HOH . ? A HOH 452 ? 1_555 86.9 ? 6 O ? G HOH . ? A HOH 311 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? G HOH . ? A HOH 452 ? 1_555 86.9 ? 7 O ? G HOH . ? A HOH 311 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? G HOH . ? A HOH 452 ? 6_555 177.7 ? 8 O ? G HOH . ? A HOH 311 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? G HOH . ? A HOH 452 ? 6_555 86.9 ? 9 O ? G HOH . ? A HOH 452 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? G HOH . ? A HOH 452 ? 6_555 91.5 ? 10 O ? G HOH . ? A HOH 305 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 341 ? 22_555 90.4 ? 11 O ? G HOH . ? A HOH 305 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 470 ? 1_555 88.7 ? 12 O ? G HOH . ? A HOH 341 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 470 ? 1_555 91.0 ? 13 O ? G HOH . ? A HOH 305 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 470 ? 72_555 88.7 ? 14 O ? G HOH . ? A HOH 341 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 470 ? 72_555 89.0 ? 15 O ? G HOH . ? A HOH 470 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 470 ? 72_555 177.4 ? 16 O ? G HOH . ? A HOH 305 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 1_555 180.0 ? 17 O ? G HOH . ? A HOH 341 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 1_555 89.6 ? 18 O ? G HOH . ? A HOH 470 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 1_555 91.3 ? 19 O ? G HOH . ? A HOH 470 ? 72_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 1_555 91.3 ? 20 O ? G HOH . ? A HOH 305 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 72_555 180.0 ? 21 O ? G HOH . ? A HOH 341 ? 22_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 72_555 89.6 ? 22 O ? G HOH . ? A HOH 470 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 72_555 91.3 ? 23 O ? G HOH . ? A HOH 470 ? 72_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 72_555 91.3 ? 24 O ? G HOH . ? A HOH 495 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 495 ? 72_555 0.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 160 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 161 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.85 # _pdbx_entry_details.entry_id 9VOM _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 46 ? ? -123.93 -64.98 2 1 GLU A 94 ? ? 72.05 -48.25 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 203 ? D MG . 2 1 A MG 204 ? E MG . 3 1 A HOH 305 ? G HOH . 4 1 A HOH 399 ? G HOH . 5 1 A HOH 495 ? G HOH . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 509 ? 5.89 . 2 1 O ? A HOH 510 ? 6.26 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ASP 177 ? A ASP 177 6 1 Y 1 A SER 178 ? A SER 178 7 1 Y 1 A ASP 179 ? A ASP 179 8 1 Y 1 A ASN 180 ? A ASN 180 9 1 Y 1 A GLU 181 ? A GLU 181 10 1 Y 1 A SER 182 ? A SER 182 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1ES0 C11 C Y N 1 A1ES0 C12 C Y N 2 A1ES0 C13 C Y N 3 A1ES0 C14 C Y N 4 A1ES0 C01 C Y N 5 A1ES0 C04 C Y N 6 A1ES0 C05 C Y N 7 A1ES0 C06 C Y N 8 A1ES0 C07 C Y N 9 A1ES0 C08 C Y N 10 A1ES0 C09 C Y N 11 A1ES0 C10 C Y N 12 A1ES0 N02 N N N 13 A1ES0 N03 N N N 14 A1ES0 N15 N N N 15 A1ES0 H121 H N N 16 A1ES0 H131 H N N 17 A1ES0 H141 H N N 18 A1ES0 H051 H N N 19 A1ES0 H061 H N N 20 A1ES0 H071 H N N 21 A1ES0 H081 H N N 22 A1ES0 H091 H N N 23 A1ES0 H101 H N N 24 A1ES0 H151 H N N 25 A1ES0 H152 H N N 26 ALA N N N N 27 ALA CA C N S 28 ALA C C N N 29 ALA O O N N 30 ALA CB C N N 31 ALA OXT O N N 32 ALA H H N N 33 ALA H2 H N N 34 ALA HA H N N 35 ALA HB1 H N N 36 ALA HB2 H N N 37 ALA HB3 H N N 38 ALA HXT H N N 39 ARG N N N N 40 ARG CA C N S 41 ARG C C N N 42 ARG O O N N 43 ARG CB C N N 44 ARG CG C N N 45 ARG CD C N N 46 ARG NE N N N 47 ARG CZ C N N 48 ARG NH1 N N N 49 ARG NH2 N N N 50 ARG OXT O N N 51 ARG H H N N 52 ARG H2 H N N 53 ARG HA H N N 54 ARG HB2 H N N 55 ARG HB3 H N N 56 ARG HG2 H N N 57 ARG HG3 H N N 58 ARG HD2 H N N 59 ARG HD3 H N N 60 ARG HE H N N 61 ARG HH11 H N N 62 ARG HH12 H N N 63 ARG HH21 H N N 64 ARG HH22 H N N 65 ARG HXT H N N 66 ASN N N N N 67 ASN CA C N S 68 ASN C C N N 69 ASN O O N N 70 ASN CB C N N 71 ASN CG C N N 72 ASN OD1 O N N 73 ASN ND2 N N N 74 ASN OXT O N N 75 ASN H H N N 76 ASN H2 H N N 77 ASN HA H N N 78 ASN HB2 H N N 79 ASN HB3 H N N 80 ASN HD21 H N N 81 ASN HD22 H N N 82 ASN HXT H N N 83 ASP N N N N 84 ASP CA C N S 85 ASP C C N N 86 ASP O O N N 87 ASP CB C N N 88 ASP CG C N N 89 ASP OD1 O N N 90 ASP OD2 O N N 91 ASP OXT O N N 92 ASP H H N N 93 ASP H2 H N N 94 ASP HA H N N 95 ASP HB2 H N N 96 ASP HB3 H N N 97 ASP HD2 H N N 98 ASP HXT H N N 99 CYS N N N N 100 CYS CA C N R 101 CYS C C N N 102 CYS O O N N 103 CYS CB C N N 104 CYS SG S N N 105 CYS OXT O N N 106 CYS H H N N 107 CYS H2 H N N 108 CYS HA H N N 109 CYS HB2 H N N 110 CYS HB3 H N N 111 CYS HG H N N 112 CYS HXT H N N 113 FE FE FE N N 114 GLN N N N N 115 GLN CA C N S 116 GLN C C N N 117 GLN O O N N 118 GLN CB C N N 119 GLN CG C N N 120 GLN CD C N N 121 GLN OE1 O N N 122 GLN NE2 N N N 123 GLN OXT O N N 124 GLN H H N N 125 GLN H2 H N N 126 GLN HA H N N 127 GLN HB2 H N N 128 GLN HB3 H N N 129 GLN HG2 H N N 130 GLN HG3 H N N 131 GLN HE21 H N N 132 GLN HE22 H N N 133 GLN HXT H N N 134 GLU N N N N 135 GLU CA C N S 136 GLU C C N N 137 GLU O O N N 138 GLU CB C N N 139 GLU CG C N N 140 GLU CD C N N 141 GLU OE1 O N N 142 GLU OE2 O N N 143 GLU OXT O N N 144 GLU H H N N 145 GLU H2 H N N 146 GLU HA H N N 147 GLU HB2 H N N 148 GLU HB3 H N N 149 GLU HG2 H N N 150 GLU HG3 H N N 151 GLU HE2 H N N 152 GLU HXT H N N 153 GLY N N N N 154 GLY CA C N N 155 GLY C C N N 156 GLY O O N N 157 GLY OXT O N N 158 GLY H H N N 159 GLY H2 H N N 160 GLY HA2 H N N 161 GLY HA3 H N N 162 GLY HXT H N N 163 HIS N N N N 164 HIS CA C N S 165 HIS C C N N 166 HIS O O N N 167 HIS CB C N N 168 HIS CG C Y N 169 HIS ND1 N Y N 170 HIS CD2 C Y N 171 HIS CE1 C Y N 172 HIS NE2 N Y N 173 HIS OXT O N N 174 HIS H H N N 175 HIS H2 H N N 176 HIS HA H N N 177 HIS HB2 H N N 178 HIS HB3 H N N 179 HIS HD1 H N N 180 HIS HD2 H N N 181 HIS HE1 H N N 182 HIS HE2 H N N 183 HIS HXT H N N 184 HOH O O N N 185 HOH H1 H N N 186 HOH H2 H N N 187 ILE N N N N 188 ILE CA C N S 189 ILE C C N N 190 ILE O O N N 191 ILE CB C N S 192 ILE CG1 C N N 193 ILE CG2 C N N 194 ILE CD1 C N N 195 ILE OXT O N N 196 ILE H H N N 197 ILE H2 H N N 198 ILE HA H N N 199 ILE HB H N N 200 ILE HG12 H N N 201 ILE HG13 H N N 202 ILE HG21 H N N 203 ILE HG22 H N N 204 ILE HG23 H N N 205 ILE HD11 H N N 206 ILE HD12 H N N 207 ILE HD13 H N N 208 ILE HXT H N N 209 LEU N N N N 210 LEU CA C N S 211 LEU C C N N 212 LEU O O N N 213 LEU CB C N N 214 LEU CG C N N 215 LEU CD1 C N N 216 LEU CD2 C N N 217 LEU OXT O N N 218 LEU H H N N 219 LEU H2 H N N 220 LEU HA H N N 221 LEU HB2 H N N 222 LEU HB3 H N N 223 LEU HG H N N 224 LEU HD11 H N N 225 LEU HD12 H N N 226 LEU HD13 H N N 227 LEU HD21 H N N 228 LEU HD22 H N N 229 LEU HD23 H N N 230 LEU HXT H N N 231 LYS N N N N 232 LYS CA C N S 233 LYS C C N N 234 LYS O O N N 235 LYS CB C N N 236 LYS CG C N N 237 LYS CD C N N 238 LYS CE C N N 239 LYS NZ N N N 240 LYS OXT O N N 241 LYS H H N N 242 LYS H2 H N N 243 LYS HA H N N 244 LYS HB2 H N N 245 LYS HB3 H N N 246 LYS HG2 H N N 247 LYS HG3 H N N 248 LYS HD2 H N N 249 LYS HD3 H N N 250 LYS HE2 H N N 251 LYS HE3 H N N 252 LYS HZ1 H N N 253 LYS HZ2 H N N 254 LYS HZ3 H N N 255 LYS HXT H N N 256 MET N N N N 257 MET CA C N S 258 MET C C N N 259 MET O O N N 260 MET CB C N N 261 MET CG C N N 262 MET SD S N N 263 MET CE C N N 264 MET OXT O N N 265 MET H H N N 266 MET H2 H N N 267 MET HA H N N 268 MET HB2 H N N 269 MET HB3 H N N 270 MET HG2 H N N 271 MET HG3 H N N 272 MET HE1 H N N 273 MET HE2 H N N 274 MET HE3 H N N 275 MET HXT H N N 276 MG MG MG N N 277 PHE N N N N 278 PHE CA C N S 279 PHE C C N N 280 PHE O O N N 281 PHE CB C N N 282 PHE CG C Y N 283 PHE CD1 C Y N 284 PHE CD2 C Y N 285 PHE CE1 C Y N 286 PHE CE2 C Y N 287 PHE CZ C Y N 288 PHE OXT O N N 289 PHE H H N N 290 PHE H2 H N N 291 PHE HA H N N 292 PHE HB2 H N N 293 PHE HB3 H N N 294 PHE HD1 H N N 295 PHE HD2 H N N 296 PHE HE1 H N N 297 PHE HE2 H N N 298 PHE HZ H N N 299 PHE HXT H N N 300 PRO N N N N 301 PRO CA C N S 302 PRO C C N N 303 PRO O O N N 304 PRO CB C N N 305 PRO CG C N N 306 PRO CD C N N 307 PRO OXT O N N 308 PRO H H N N 309 PRO HA H N N 310 PRO HB2 H N N 311 PRO HB3 H N N 312 PRO HG2 H N N 313 PRO HG3 H N N 314 PRO HD2 H N N 315 PRO HD3 H N N 316 PRO HXT H N N 317 SER N N N N 318 SER CA C N S 319 SER C C N N 320 SER O O N N 321 SER CB C N N 322 SER OG O N N 323 SER OXT O N N 324 SER H H N N 325 SER H2 H N N 326 SER HA H N N 327 SER HB2 H N N 328 SER HB3 H N N 329 SER HG H N N 330 SER HXT H N N 331 THR N N N N 332 THR CA C N S 333 THR C C N N 334 THR O O N N 335 THR CB C N R 336 THR OG1 O N N 337 THR CG2 C N N 338 THR OXT O N N 339 THR H H N N 340 THR H2 H N N 341 THR HA H N N 342 THR HB H N N 343 THR HG1 H N N 344 THR HG21 H N N 345 THR HG22 H N N 346 THR HG23 H N N 347 THR HXT H N N 348 TRP N N N N 349 TRP CA C N S 350 TRP C C N N 351 TRP O O N N 352 TRP CB C N N 353 TRP CG C Y N 354 TRP CD1 C Y N 355 TRP CD2 C Y N 356 TRP NE1 N Y N 357 TRP CE2 C Y N 358 TRP CE3 C Y N 359 TRP CZ2 C Y N 360 TRP CZ3 C Y N 361 TRP CH2 C Y N 362 TRP OXT O N N 363 TRP H H N N 364 TRP H2 H N N 365 TRP HA H N N 366 TRP HB2 H N N 367 TRP HB3 H N N 368 TRP HD1 H N N 369 TRP HE1 H N N 370 TRP HE3 H N N 371 TRP HZ2 H N N 372 TRP HZ3 H N N 373 TRP HH2 H N N 374 TRP HXT H N N 375 TYR N N N N 376 TYR CA C N S 377 TYR C C N N 378 TYR O O N N 379 TYR CB C N N 380 TYR CG C Y N 381 TYR CD1 C Y N 382 TYR CD2 C Y N 383 TYR CE1 C Y N 384 TYR CE2 C Y N 385 TYR CZ C Y N 386 TYR OH O N N 387 TYR OXT O N N 388 TYR H H N N 389 TYR H2 H N N 390 TYR HA H N N 391 TYR HB2 H N N 392 TYR HB3 H N N 393 TYR HD1 H N N 394 TYR HD2 H N N 395 TYR HE1 H N N 396 TYR HE2 H N N 397 TYR HH H N N 398 TYR HXT H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1ES0 C07 C08 doub Y N 1 A1ES0 C07 C06 sing Y N 2 A1ES0 C08 C09 sing Y N 3 A1ES0 C06 C05 doub Y N 4 A1ES0 C09 C04 doub Y N 5 A1ES0 C05 C04 sing Y N 6 A1ES0 C04 N03 sing N N 7 A1ES0 N03 N02 doub N N 8 A1ES0 N02 C01 sing N N 9 A1ES0 C01 C10 doub Y N 10 A1ES0 C01 C14 sing Y N 11 A1ES0 C10 C11 sing Y N 12 A1ES0 C14 C13 doub Y N 13 A1ES0 C11 N15 sing N N 14 A1ES0 C11 C12 doub Y N 15 A1ES0 C13 C12 sing Y N 16 A1ES0 C12 H121 sing N N 17 A1ES0 C13 H131 sing N N 18 A1ES0 C14 H141 sing N N 19 A1ES0 C05 H051 sing N N 20 A1ES0 C06 H061 sing N N 21 A1ES0 C07 H071 sing N N 22 A1ES0 C08 H081 sing N N 23 A1ES0 C09 H091 sing N N 24 A1ES0 C10 H101 sing N N 25 A1ES0 N15 H151 sing N N 26 A1ES0 N15 H152 sing N N 27 ALA N CA sing N N 28 ALA N H sing N N 29 ALA N H2 sing N N 30 ALA CA C sing N N 31 ALA CA CB sing N N 32 ALA CA HA sing N N 33 ALA C O doub N N 34 ALA C OXT sing N N 35 ALA CB HB1 sing N N 36 ALA CB HB2 sing N N 37 ALA CB HB3 sing N N 38 ALA OXT HXT sing N N 39 ARG N CA sing N N 40 ARG N H sing N N 41 ARG N H2 sing N N 42 ARG CA C sing N N 43 ARG CA CB sing N N 44 ARG CA HA sing N N 45 ARG C O doub N N 46 ARG C OXT sing N N 47 ARG CB CG sing N N 48 ARG CB HB2 sing N N 49 ARG CB HB3 sing N N 50 ARG CG CD sing N N 51 ARG CG HG2 sing N N 52 ARG CG HG3 sing N N 53 ARG CD NE sing N N 54 ARG CD HD2 sing N N 55 ARG CD HD3 sing N N 56 ARG NE CZ sing N N 57 ARG NE HE sing N N 58 ARG CZ NH1 sing N N 59 ARG CZ NH2 doub N N 60 ARG NH1 HH11 sing N N 61 ARG NH1 HH12 sing N N 62 ARG NH2 HH21 sing N N 63 ARG NH2 HH22 sing N N 64 ARG OXT HXT sing N N 65 ASN N CA sing N N 66 ASN N H sing N N 67 ASN N H2 sing N N 68 ASN CA C sing N N 69 ASN CA CB sing N N 70 ASN CA HA sing N N 71 ASN C O doub N N 72 ASN C OXT sing N N 73 ASN CB CG sing N N 74 ASN CB HB2 sing N N 75 ASN CB HB3 sing N N 76 ASN CG OD1 doub N N 77 ASN CG ND2 sing N N 78 ASN ND2 HD21 sing N N 79 ASN ND2 HD22 sing N N 80 ASN OXT HXT sing N N 81 ASP N CA sing N N 82 ASP N H sing N N 83 ASP N H2 sing N N 84 ASP CA C sing N N 85 ASP CA CB sing N N 86 ASP CA HA sing N N 87 ASP C O doub N N 88 ASP C OXT sing N N 89 ASP CB CG sing N N 90 ASP CB HB2 sing N N 91 ASP CB HB3 sing N N 92 ASP CG OD1 doub N N 93 ASP CG OD2 sing N N 94 ASP OD2 HD2 sing N N 95 ASP OXT HXT sing N N 96 CYS N CA sing N N 97 CYS N H sing N N 98 CYS N H2 sing N N 99 CYS CA C sing N N 100 CYS CA CB sing N N 101 CYS CA HA sing N N 102 CYS C O doub N N 103 CYS C OXT sing N N 104 CYS CB SG sing N N 105 CYS CB HB2 sing N N 106 CYS CB HB3 sing N N 107 CYS SG HG sing N N 108 CYS OXT HXT sing N N 109 GLN N CA sing N N 110 GLN N H sing N N 111 GLN N H2 sing N N 112 GLN CA C sing N N 113 GLN CA CB sing N N 114 GLN CA HA sing N N 115 GLN C O doub N N 116 GLN C OXT sing N N 117 GLN CB CG sing N N 118 GLN CB HB2 sing N N 119 GLN CB HB3 sing N N 120 GLN CG CD sing N N 121 GLN CG HG2 sing N N 122 GLN CG HG3 sing N N 123 GLN CD OE1 doub N N 124 GLN CD NE2 sing N N 125 GLN NE2 HE21 sing N N 126 GLN NE2 HE22 sing N N 127 GLN OXT HXT sing N N 128 GLU N CA sing N N 129 GLU N H sing N N 130 GLU N H2 sing N N 131 GLU CA C sing N N 132 GLU CA CB sing N N 133 GLU CA HA sing N N 134 GLU C O doub N N 135 GLU C OXT sing N N 136 GLU CB CG sing N N 137 GLU CB HB2 sing N N 138 GLU CB HB3 sing N N 139 GLU CG CD sing N N 140 GLU CG HG2 sing N N 141 GLU CG HG3 sing N N 142 GLU CD OE1 doub N N 143 GLU CD OE2 sing N N 144 GLU OE2 HE2 sing N N 145 GLU OXT HXT sing N N 146 GLY N CA sing N N 147 GLY N H sing N N 148 GLY N H2 sing N N 149 GLY CA C sing N N 150 GLY CA HA2 sing N N 151 GLY CA HA3 sing N N 152 GLY C O doub N N 153 GLY C OXT sing N N 154 GLY OXT HXT sing N N 155 HIS N CA sing N N 156 HIS N H sing N N 157 HIS N H2 sing N N 158 HIS CA C sing N N 159 HIS CA CB sing N N 160 HIS CA HA sing N N 161 HIS C O doub N N 162 HIS C OXT sing N N 163 HIS CB CG sing N N 164 HIS CB HB2 sing N N 165 HIS CB HB3 sing N N 166 HIS CG ND1 sing Y N 167 HIS CG CD2 doub Y N 168 HIS ND1 CE1 doub Y N 169 HIS ND1 HD1 sing N N 170 HIS CD2 NE2 sing Y N 171 HIS CD2 HD2 sing N N 172 HIS CE1 NE2 sing Y N 173 HIS CE1 HE1 sing N N 174 HIS NE2 HE2 sing N N 175 HIS OXT HXT sing N N 176 HOH O H1 sing N N 177 HOH O H2 sing N N 178 ILE N CA sing N N 179 ILE N H sing N N 180 ILE N H2 sing N N 181 ILE CA C sing N N 182 ILE CA CB sing N N 183 ILE CA HA sing N N 184 ILE C O doub N N 185 ILE C OXT sing N N 186 ILE CB CG1 sing N N 187 ILE CB CG2 sing N N 188 ILE CB HB sing N N 189 ILE CG1 CD1 sing N N 190 ILE CG1 HG12 sing N N 191 ILE CG1 HG13 sing N N 192 ILE CG2 HG21 sing N N 193 ILE CG2 HG22 sing N N 194 ILE CG2 HG23 sing N N 195 ILE CD1 HD11 sing N N 196 ILE CD1 HD12 sing N N 197 ILE CD1 HD13 sing N N 198 ILE OXT HXT sing N N 199 LEU N CA sing N N 200 LEU N H sing N N 201 LEU N H2 sing N N 202 LEU CA C sing N N 203 LEU CA CB sing N N 204 LEU CA HA sing N N 205 LEU C O doub N N 206 LEU C OXT sing N N 207 LEU CB CG sing N N 208 LEU CB HB2 sing N N 209 LEU CB HB3 sing N N 210 LEU CG CD1 sing N N 211 LEU CG CD2 sing N N 212 LEU CG HG sing N N 213 LEU CD1 HD11 sing N N 214 LEU CD1 HD12 sing N N 215 LEU CD1 HD13 sing N N 216 LEU CD2 HD21 sing N N 217 LEU CD2 HD22 sing N N 218 LEU CD2 HD23 sing N N 219 LEU OXT HXT sing N N 220 LYS N CA sing N N 221 LYS N H sing N N 222 LYS N H2 sing N N 223 LYS CA C sing N N 224 LYS CA CB sing N N 225 LYS CA HA sing N N 226 LYS C O doub N N 227 LYS C OXT sing N N 228 LYS CB CG sing N N 229 LYS CB HB2 sing N N 230 LYS CB HB3 sing N N 231 LYS CG CD sing N N 232 LYS CG HG2 sing N N 233 LYS CG HG3 sing N N 234 LYS CD CE sing N N 235 LYS CD HD2 sing N N 236 LYS CD HD3 sing N N 237 LYS CE NZ sing N N 238 LYS CE HE2 sing N N 239 LYS CE HE3 sing N N 240 LYS NZ HZ1 sing N N 241 LYS NZ HZ2 sing N N 242 LYS NZ HZ3 sing N N 243 LYS OXT HXT sing N N 244 MET N CA sing N N 245 MET N H sing N N 246 MET N H2 sing N N 247 MET CA C sing N N 248 MET CA CB sing N N 249 MET CA HA sing N N 250 MET C O doub N N 251 MET C OXT sing N N 252 MET CB CG sing N N 253 MET CB HB2 sing N N 254 MET CB HB3 sing N N 255 MET CG SD sing N N 256 MET CG HG2 sing N N 257 MET CG HG3 sing N N 258 MET SD CE sing N N 259 MET CE HE1 sing N N 260 MET CE HE2 sing N N 261 MET CE HE3 sing N N 262 MET OXT HXT sing N N 263 PHE N CA sing N N 264 PHE N H sing N N 265 PHE N H2 sing N N 266 PHE CA C sing N N 267 PHE CA CB sing N N 268 PHE CA HA sing N N 269 PHE C O doub N N 270 PHE C OXT sing N N 271 PHE CB CG sing N N 272 PHE CB HB2 sing N N 273 PHE CB HB3 sing N N 274 PHE CG CD1 doub Y N 275 PHE CG CD2 sing Y N 276 PHE CD1 CE1 sing Y N 277 PHE CD1 HD1 sing N N 278 PHE CD2 CE2 doub Y N 279 PHE CD2 HD2 sing N N 280 PHE CE1 CZ doub Y N 281 PHE CE1 HE1 sing N N 282 PHE CE2 CZ sing Y N 283 PHE CE2 HE2 sing N N 284 PHE CZ HZ sing N N 285 PHE OXT HXT sing N N 286 PRO N CA sing N N 287 PRO N CD sing N N 288 PRO N H sing N N 289 PRO CA C sing N N 290 PRO CA CB sing N N 291 PRO CA HA sing N N 292 PRO C O doub N N 293 PRO C OXT sing N N 294 PRO CB CG sing N N 295 PRO CB HB2 sing N N 296 PRO CB HB3 sing N N 297 PRO CG CD sing N N 298 PRO CG HG2 sing N N 299 PRO CG HG3 sing N N 300 PRO CD HD2 sing N N 301 PRO CD HD3 sing N N 302 PRO OXT HXT sing N N 303 SER N CA sing N N 304 SER N H sing N N 305 SER N H2 sing N N 306 SER CA C sing N N 307 SER CA CB sing N N 308 SER CA HA sing N N 309 SER C O doub N N 310 SER C OXT sing N N 311 SER CB OG sing N N 312 SER CB HB2 sing N N 313 SER CB HB3 sing N N 314 SER OG HG sing N N 315 SER OXT HXT sing N N 316 THR N CA sing N N 317 THR N H sing N N 318 THR N H2 sing N N 319 THR CA C sing N N 320 THR CA CB sing N N 321 THR CA HA sing N N 322 THR C O doub N N 323 THR C OXT sing N N 324 THR CB OG1 sing N N 325 THR CB CG2 sing N N 326 THR CB HB sing N N 327 THR OG1 HG1 sing N N 328 THR CG2 HG21 sing N N 329 THR CG2 HG22 sing N N 330 THR CG2 HG23 sing N N 331 THR OXT HXT sing N N 332 TRP N CA sing N N 333 TRP N H sing N N 334 TRP N H2 sing N N 335 TRP CA C sing N N 336 TRP CA CB sing N N 337 TRP CA HA sing N N 338 TRP C O doub N N 339 TRP C OXT sing N N 340 TRP CB CG sing N N 341 TRP CB HB2 sing N N 342 TRP CB HB3 sing N N 343 TRP CG CD1 doub Y N 344 TRP CG CD2 sing Y N 345 TRP CD1 NE1 sing Y N 346 TRP CD1 HD1 sing N N 347 TRP CD2 CE2 doub Y N 348 TRP CD2 CE3 sing Y N 349 TRP NE1 CE2 sing Y N 350 TRP NE1 HE1 sing N N 351 TRP CE2 CZ2 sing Y N 352 TRP CE3 CZ3 doub Y N 353 TRP CE3 HE3 sing N N 354 TRP CZ2 CH2 doub Y N 355 TRP CZ2 HZ2 sing N N 356 TRP CZ3 CH2 sing Y N 357 TRP CZ3 HZ3 sing N N 358 TRP CH2 HH2 sing N N 359 TRP OXT HXT sing N N 360 TYR N CA sing N N 361 TYR N H sing N N 362 TYR N H2 sing N N 363 TYR CA C sing N N 364 TYR CA CB sing N N 365 TYR CA HA sing N N 366 TYR C O doub N N 367 TYR C OXT sing N N 368 TYR CB CG sing N N 369 TYR CB HB2 sing N N 370 TYR CB HB3 sing N N 371 TYR CG CD1 doub Y N 372 TYR CG CD2 sing Y N 373 TYR CD1 CE1 sing Y N 374 TYR CD1 HD1 sing N N 375 TYR CD2 CE2 doub Y N 376 TYR CD2 HD2 sing N N 377 TYR CE1 CZ doub Y N 378 TYR CE1 HE1 sing N N 379 TYR CE2 CZ sing Y N 380 TYR CE2 HE2 sing N N 381 TYR CZ OH sing N N 382 TYR OH HH sing N N 383 TYR OXT HXT sing N N 384 VAL N CA sing N N 385 VAL N H sing N N 386 VAL N H2 sing N N 387 VAL CA C sing N N 388 VAL CA CB sing N N 389 VAL CA HA sing N N 390 VAL C O doub N N 391 VAL C OXT sing N N 392 VAL CB CG1 sing N N 393 VAL CB CG2 sing N N 394 VAL CB HB sing N N 395 VAL CG1 HG11 sing N N 396 VAL CG1 HG12 sing N N 397 VAL CG1 HG13 sing N N 398 VAL CG2 HG21 sing N N 399 VAL CG2 HG22 sing N N 400 VAL CG2 HG23 sing N N 401 VAL OXT HXT sing N N 402 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 62075118 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2fha _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9VOM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005451 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005451 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005451 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE H MG N O S # loop_ #