data_9VP4 # _entry.id 9VP4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.408 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VP4 pdb_00009vp4 10.2210/pdb9vp4/pdb WWPDB D_1300061117 ? ? EMDB EMD-65236 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-12-24 ? 2 'EM metadata' 1 0 2025-12-24 ? 3 'Additional map' 1 0 2025-12-24 1 4 FSC 1 0 2025-12-24 ? 5 'Half map' 1 0 2025-12-24 1 6 'Half map' 1 0 2025-12-24 2 7 Image 1 0 2025-12-24 ? 8 Mask 1 0 2025-12-24 1 9 'Primary map' 1 0 2025-12-24 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'EM metadata' repository 'Initial release' ? ? 3 3 'Additional map' repository 'Initial release' ? ? 4 4 FSC repository 'Initial release' ? ? 5 5 'Half map' repository 'Initial release' ? ? 6 6 'Half map' repository 'Initial release' ? ? 7 7 Image repository 'Initial release' ? ? 8 8 Mask repository 'Initial release' ? ? 9 9 'Primary map' repository 'Initial release' ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VP4 _pdbx_database_status.recvd_initial_deposition_date 2025-07-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'CryoEM structure of cyclised H-pilus (D69R)' _pdbx_database_related.db_id EMD-65236 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_contact_author.id 2 _pdbx_contact_author.email konstantinos.beis@imperial.ac.uk _pdbx_contact_author.name_first Konstantinos _pdbx_contact_author.name_last Beis _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5727-4721 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ishimoto, N.' 1 0000-0001-8976-8582 'Beis, K.' 2 0000-0001-5727-4721 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Surface electrostatic potential affects mating pilus functionality' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, S.' 1 ? primary 'Ishimoto, N.' 2 ? primary 'Wong, J.' 3 ? primary 'David, S.' 4 ? primary 'Beis, K.' 5 ? primary 'Frankel, G.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Pilin 7644.048 1 ? D69R ? ? 2 non-polymer syn 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE 722.970 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSDDGAFGDIWAYMSEALTGAPGKIIACGMLFSVAYFGVVKPNLGLALVSALMMLVMANGEKIISSFLRAGIPL _entity_poly.pdbx_seq_one_letter_code_can GSDDGAFGDIWAYMSEALTGAPGKIIACGMLFSVAYFGVVKPNLGLALVSALMMLVMANGEKIISSFLRAGIPL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE _pdbx_entity_nonpoly.comp_id LHG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 ASP n 1 5 GLY n 1 6 ALA n 1 7 PHE n 1 8 GLY n 1 9 ASP n 1 10 ILE n 1 11 TRP n 1 12 ALA n 1 13 TYR n 1 14 MET n 1 15 SER n 1 16 GLU n 1 17 ALA n 1 18 LEU n 1 19 THR n 1 20 GLY n 1 21 ALA n 1 22 PRO n 1 23 GLY n 1 24 LYS n 1 25 ILE n 1 26 ILE n 1 27 ALA n 1 28 CYS n 1 29 GLY n 1 30 MET n 1 31 LEU n 1 32 PHE n 1 33 SER n 1 34 VAL n 1 35 ALA n 1 36 TYR n 1 37 PHE n 1 38 GLY n 1 39 VAL n 1 40 VAL n 1 41 LYS n 1 42 PRO n 1 43 ASN n 1 44 LEU n 1 45 GLY n 1 46 LEU n 1 47 ALA n 1 48 LEU n 1 49 VAL n 1 50 SER n 1 51 ALA n 1 52 LEU n 1 53 MET n 1 54 MET n 1 55 LEU n 1 56 VAL n 1 57 MET n 1 58 ALA n 1 59 ASN n 1 60 GLY n 1 61 GLU n 1 62 LYS n 1 63 ILE n 1 64 ILE n 1 65 SER n 1 66 SER n 1 67 PHE n 1 68 LEU n 1 69 ARG n 1 70 ALA n 1 71 GLY n 1 72 ILE n 1 73 PRO n 1 74 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 74 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'trhA, HCM1.67' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica subsp. enterica serovar Typhi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 90370 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LHG non-polymer . 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE ? 'C38 H75 O10 P' 722.970 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 ? ? ? A . n A 1 71 GLY 71 71 ? ? ? A . n A 1 72 ILE 72 72 ? ? ? A . n A 1 73 PRO 73 73 ? ? ? A . n A 1 74 LEU 74 74 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id LHG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id LHG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id LHG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 101 _pdbx_nonpoly_scheme.pdb_mon_id LHG _pdbx_nonpoly_scheme.auth_mon_id LHG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9VP4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VP4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VP4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VP4 _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.89 _refine.ls_d_res_low ? _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work ? _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'REAL-SPACE (WEIGHTED MAP SUM AT ATOM CENTERS)' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.002 ? 558 ? f_bond_d ? ? ? 'ELECTRON MICROSCOPY' ? 0.364 ? 741 ? f_angle_d ? ? ? 'ELECTRON MICROSCOPY' ? 11.490 ? 106 ? f_dihedral_angle_d ? ? ? 'ELECTRON MICROSCOPY' ? 0.033 ? 81 ? f_chiral_restr ? ? ? 'ELECTRON MICROSCOPY' ? 0.005 ? 85 ? f_plane_restr ? ? ? # _struct.entry_id 9VP4 _struct.title 'CryoEM structure of cyclised H-pilus (D69R)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VP4 _struct_keywords.text 'pilus, conjugation, filament, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q935P5_SALTI _struct_ref.pdbx_db_accession Q935P5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GSDDGAFGDIWAYMSEALTGAPGKIIACGMLFSVAYFGVVKPNLGLALVSALMMLVMANGEKIISSFLDAGIPL _struct_ref.pdbx_align_begin 44 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VP4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q935P5 _struct_ref_seq.db_align_beg 44 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 117 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 74 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9VP4 _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 69 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q935P5 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 112 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 69 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 104-meric _pdbx_struct_assembly.oligomeric_count 104 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression ;1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55,56,57,58,59,60,61,62,63,64,65,66,67,68,69,70,71,72,73,74,75,76,77,78,79,80,81,82,83,84,85,86,87,88,89,90,91,92,93,94,95,96,97,98,99,100,101,102,103,104 ; _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' ? ? -0.15643400 -0.98768800 0.00000000 327.14169 0.98768800 -0.15643400 0.00000000 25.74661 0.00000000 0.00000000 1.00000000 -110.34000 2 'point symmetry operation' ? ? -0.98768800 -0.15643400 0.00000000 327.14169 0.15643400 -0.98768800 0.00000000 279.40540 0.00000000 0.00000000 1.00000000 -110.34000 3 'point symmetry operation' ? ? -0.45399000 0.89100700 0.00000000 85.89785 -0.89100700 -0.45399000 0.00000000 357.79028 0.00000000 0.00000000 1.00000000 -110.34000 4 'point symmetry operation' ? ? 0.70710700 0.70710700 0.00000000 -63.19905 -0.70710700 0.70710700 0.00000000 152.57600 0.00000000 0.00000000 1.00000000 -110.34000 5 'point symmetry operation' ? ? 0.89100700 -0.45399000 0.00000000 85.89785 0.45399000 0.89100700 0.00000000 -52.63827 0.00000000 0.00000000 1.00000000 -110.34000 6 'point symmetry operation' ? ? -0.61566100 -0.78801100 0.00000000 366.74271 0.78801100 -0.61566100 0.00000000 126.27964 0.00000000 0.00000000 1.00000000 -98.08000 7 'point symmetry operation' ? ? -0.93969300 0.34202000 0.00000000 243.76648 -0.34202000 -0.93969300 0.00000000 348.13462 0.00000000 0.00000000 1.00000000 -98.08000 8 'point symmetry operation' ? ? 0.03489900 0.99939100 0.00000000 -5.23188 -0.99939100 0.03489900 0.00000000 299.73424 0.00000000 0.00000000 1.00000000 -98.08000 9 'point symmetry operation' ? ? 0.96126200 0.27563700 0.00000000 -36.14511 -0.27563700 0.96126200 0.00000000 47.96618 0.00000000 0.00000000 1.00000000 -98.08000 10 'point symmetry operation' ? ? 0.55919300 -0.82903800 0.00000000 193.74783 0.82903800 0.55919300 0.00000000 -59.23466 0.00000000 0.00000000 1.00000000 -98.08000 11 'point symmetry operation' ? ? -0.92050500 -0.39073100 0.00000000 352.63915 0.39073100 -0.92050500 0.00000000 233.40676 0.00000000 0.00000000 1.00000000 -85.82000 12 'point symmetry operation' ? ? -0.65605900 0.75471000 0.00000000 137.52430 -0.75471000 -0.65605900 0.00000000 367.82544 0.00000000 0.00000000 1.00000000 -85.82000 13 'point symmetry operation' ? ? 0.51503800 0.85716700 0.00000000 -56.78961 -0.85716700 0.51503800 0.00000000 204.77672 0.00000000 0.00000000 1.00000000 -85.82000 14 'point symmetry operation' ? ? 0.97437000 -0.22495100 0.00000000 38.23265 0.22495100 0.97437000 0.00000000 -30.41162 0.00000000 0.00000000 1.00000000 -85.82000 15 'point symmetry operation' ? ? 0.08715600 -0.99619500 0.00000000 291.27354 0.99619500 0.08715600 0.00000000 -12.71728 0.00000000 0.00000000 1.00000000 -85.82000 16 'point symmetry operation' ? ? -0.99452200 0.10452800 0.00000000 288.36765 -0.10452800 -0.99452200 0.00000000 320.26472 0.00000000 0.00000000 1.00000000 -73.56000 17 'point symmetry operation' ? ? -0.20791200 0.97814800 0.00000000 35.05649 -0.97814800 -0.20791200 0.00000000 333.54019 0.00000000 0.00000000 1.00000000 -73.56000 18 'point symmetry operation' ? ? 0.86602500 0.50000000 0.00000000 -55.84669 -0.50000000 0.86602500 0.00000000 96.72931 0.00000000 0.00000000 1.00000000 -73.56000 19 'point symmetry operation' ? ? 0.74314500 -0.66913100 0.00000000 141.28321 0.66913100 0.74314500 0.00000000 -62.90334 0.00000000 0.00000000 1.00000000 -73.56000 20 'point symmetry operation' ? ? -0.40673700 -0.91354500 0.00000000 354.01937 0.91354500 -0.40673700 0.00000000 75.24914 0.00000000 0.00000000 1.00000000 -73.56000 21 'point symmetry operation' ? ? -0.81915200 0.57357600 0.00000000 190.04495 -0.57357600 -0.81915200 0.00000000 365.07295 0.00000000 0.00000000 1.00000000 -61.30000 22 'point symmetry operation' ? ? 0.29237200 0.95630500 0.00000000 -37.94206 -0.95630500 0.29237200 0.00000000 253.87626 0.00000000 0.00000000 1.00000000 -61.30000 23 'point symmetry operation' ? ? 0.99984800 0.01745200 0.00000000 -2.63958 -0.01745200 0.99984800 0.00000000 2.68606 0.00000000 0.00000000 1.00000000 -61.30000 24 'point symmetry operation' ? ? 0.32556800 -0.94551900 0.00000000 247.16556 0.94551900 0.32556800 0.00000000 -41.36133 0.00000000 0.00000000 1.00000000 -61.30000 25 'point symmetry operation' ? ? -0.79863600 -0.60181500 0.00000000 366.25115 0.60181500 -0.79863600 0.00000000 182.60609 0.00000000 0.00000000 1.00000000 -61.30000 26 'point symmetry operation' ? ? -0.43837100 0.89879400 0.00000000 82.32652 -0.89879400 -0.43837100 0.00000000 356.59533 0.00000000 0.00000000 1.00000000 -49.04000 27 'point symmetry operation' ? ? 0.71934000 0.69465800 0.00000000 -63.16619 -0.69465800 0.71934000 0.00000000 148.81021 0.00000000 0.00000000 1.00000000 -49.04000 28 'point symmetry operation' ? ? 0.88294800 -0.46947200 0.00000000 89.48948 0.46947200 0.88294800 0.00000000 -53.77071 0.00000000 0.00000000 1.00000000 -49.04000 29 'point symmetry operation' ? ? -0.17364800 -0.98480800 0.00000000 329.32858 0.98480800 -0.17364800 0.00000000 28.81252 0.00000000 0.00000000 1.00000000 -49.04000 30 'point symmetry operation' ? ? -0.99026800 -0.13917300 0.00000000 324.90163 0.13917300 -0.99026800 0.00000000 282.43268 0.00000000 0.00000000 1.00000000 -49.04000 31 'point symmetry operation' ? ? 0.05233600 0.99863000 0.00000000 -7.77611 -0.99863000 0.05233600 0.00000000 296.95770 0.00000000 0.00000000 1.00000000 -36.78000 32 'point symmetry operation' ? ? 0.96592600 0.25881900 0.00000000 -34.29067 -0.25881900 0.96592600 0.00000000 44.68848 0.00000000 0.00000000 1.00000000 -36.78000 33 'point symmetry operation' ? ? 0.54463900 -0.83867100 0.00000000 197.43816 0.83867100 0.54463900 0.00000000 -58.48385 0.00000000 0.00000000 1.00000000 -36.78000 34 'point symmetry operation' ? ? -0.62932000 -0.77714600 0.00000000 367.16902 0.77714600 -0.62932000 0.00000000 130.02137 0.00000000 0.00000000 1.00000000 -36.78000 35 'point symmetry operation' ? ? -0.93358000 0.35836800 0.00000000 240.33963 -0.35836800 -0.93358000 0.00000000 349.69633 0.00000000 0.00000000 1.00000000 -36.78000 36 'point symmetry operation' ? ? 0.52991900 0.84804800 0.00000000 -57.66875 -0.84804800 0.52991900 0.00000000 201.11483 0.00000000 0.00000000 1.00000000 -24.52000 37 'point symmetry operation' ? ? 0.97029600 -0.24192200 0.00000000 41.44364 0.24192200 0.97029600 0.00000000 -32.37932 0.00000000 0.00000000 1.00000000 -24.52000 38 'point symmetry operation' ? ? 0.06975600 -0.99756400 0.00000000 294.13718 0.99756400 0.06975600 0.00000000 -10.27150 0.00000000 0.00000000 1.00000000 -24.52000 39 'point symmetry operation' ? ? -0.92718400 -0.37460700 0.00000000 351.19799 0.37460700 -0.92718400 0.00000000 236.88604 0.00000000 0.00000000 1.00000000 -24.52000 40 'point symmetry operation' ? ? -0.64278800 0.76604400 0.00000000 133.76997 -0.76604400 -0.64278800 0.00000000 367.52997 0.00000000 0.00000000 1.00000000 -24.52000 41 'point symmetry operation' ? ? 0.87462000 0.48481000 0.00000000 -54.84029 -0.48481000 0.87462000 0.00000000 93.10034 0.00000000 0.00000000 1.00000000 -12.26000 42 'point symmetry operation' ? ? 0.73135400 -0.68199800 0.00000000 145.04556 0.68199800 0.73135400 0.00000000 -63.06761 0.00000000 0.00000000 1.00000000 -12.26000 43 'point symmetry operation' ? ? -0.42261800 -0.90630800 0.00000000 355.33823 0.90630800 -0.42261800 0.00000000 78.77659 0.00000000 0.00000000 1.00000000 -12.26000 44 'point symmetry operation' ? ? -0.99254600 0.12186900 0.00000000 285.42039 -0.12186900 -0.99254600 0.00000000 322.60907 0.00000000 0.00000000 1.00000000 -12.26000 45 'point symmetry operation' ? ? -0.19080900 0.98162700 0.00000000 31.91613 -0.98162700 -0.19080900 0.00000000 331.46163 0.00000000 0.00000000 1.00000000 -12.26000 46 'point symmetry operation' ? ? 0.30901700 -0.95105700 0.00000000 250.53583 0.95105700 0.30901700 0.00000000 -39.68098 0.00000000 0.00000000 1.00000000 0.00000 47 'point symmetry operation' ? ? -0.80901700 -0.58778500 0.00000000 365.69451 0.58778500 -0.80901700 0.00000000 186.33066 0.00000000 0.00000000 1.00000000 0.00000 48 'point symmetry operation' ? ? -0.80901700 0.58778500 0.00000000 186.33066 -0.58778500 -0.80901700 0.00000000 365.69451 0.00000000 0.00000000 1.00000000 0.00000 49 'point symmetry operation' ? ? 0.30901700 0.95105700 0.00000000 -39.68098 -0.95105700 0.30901700 0.00000000 250.53583 0.00000000 0.00000000 1.00000000 0.00000 50 'point symmetry operation' ? ? 0.87462000 -0.48481000 0.00000000 93.10034 0.48481000 0.87462000 0.00000000 -54.84029 0.00000000 0.00000000 1.00000000 12.26000 51 'point symmetry operation' ? ? -0.19080900 -0.98162700 0.00000000 331.46163 0.98162700 -0.19080900 0.00000000 31.91613 0.00000000 0.00000000 1.00000000 12.26000 52 'point symmetry operation' ? ? -0.99254600 -0.12186900 0.00000000 322.60907 0.12186900 -0.99254600 0.00000000 285.42039 0.00000000 0.00000000 1.00000000 12.26000 53 'point symmetry operation' ? ? -0.42261800 0.90630800 0.00000000 78.77659 -0.90630800 -0.42261800 0.00000000 355.33823 0.00000000 0.00000000 1.00000000 12.26000 54 'point symmetry operation' ? ? 0.73135400 0.68199800 0.00000000 -63.06761 -0.68199800 0.73135400 0.00000000 145.04556 0.00000000 0.00000000 1.00000000 12.26000 55 'point symmetry operation' ? ? 0.52991900 -0.84804800 0.00000000 201.11483 0.84804800 0.52991900 0.00000000 -57.66875 0.00000000 0.00000000 1.00000000 24.52000 56 'point symmetry operation' ? ? -0.64278800 -0.76604400 0.00000000 367.52997 0.76604400 -0.64278800 0.00000000 133.76997 0.00000000 0.00000000 1.00000000 24.52000 57 'point symmetry operation' ? ? -0.92718400 0.37460700 0.00000000 236.88604 -0.37460700 -0.92718400 0.00000000 351.19799 0.00000000 0.00000000 1.00000000 24.52000 58 'point symmetry operation' ? ? 0.06975600 0.99756400 0.00000000 -10.27150 -0.99756400 0.06975600 0.00000000 294.13718 0.00000000 0.00000000 1.00000000 24.52000 59 'point symmetry operation' ? ? 0.97029600 0.24192200 0.00000000 -32.37932 -0.24192200 0.97029600 0.00000000 41.44364 0.00000000 0.00000000 1.00000000 24.52000 60 'point symmetry operation' ? ? 0.05233600 -0.99863000 0.00000000 296.95770 0.99863000 0.05233600 0.00000000 -7.77611 0.00000000 0.00000000 1.00000000 36.78000 61 'point symmetry operation' ? ? -0.93358000 -0.35836800 0.00000000 349.69633 0.35836800 -0.93358000 0.00000000 240.33963 0.00000000 0.00000000 1.00000000 36.78000 62 'point symmetry operation' ? ? -0.62932000 0.77714600 0.00000000 130.02137 -0.77714600 -0.62932000 0.00000000 367.16902 0.00000000 0.00000000 1.00000000 36.78000 63 'point symmetry operation' ? ? 0.54463900 0.83867100 0.00000000 -58.48385 -0.83867100 0.54463900 0.00000000 197.43816 0.00000000 0.00000000 1.00000000 36.78000 64 'point symmetry operation' ? ? 0.96592600 -0.25881900 0.00000000 44.68848 0.25881900 0.96592600 0.00000000 -34.29067 0.00000000 0.00000000 1.00000000 36.78000 65 'point symmetry operation' ? ? -0.43837100 -0.89879400 0.00000000 356.59533 0.89879400 -0.43837100 0.00000000 82.32652 0.00000000 0.00000000 1.00000000 49.04000 66 'point symmetry operation' ? ? -0.99026800 0.13917300 0.00000000 282.43268 -0.13917300 -0.99026800 0.00000000 324.90163 0.00000000 0.00000000 1.00000000 49.04000 67 'point symmetry operation' ? ? -0.17364800 0.98480800 0.00000000 28.81252 -0.98480800 -0.17364800 0.00000000 329.32858 0.00000000 0.00000000 1.00000000 49.04000 68 'point symmetry operation' ? ? 0.88294800 0.46947200 0.00000000 -53.77071 -0.46947200 0.88294800 0.00000000 89.48948 0.00000000 0.00000000 1.00000000 49.04000 69 'point symmetry operation' ? ? 0.71934000 -0.69465800 0.00000000 148.81021 0.69465800 0.71934000 0.00000000 -63.16619 0.00000000 0.00000000 1.00000000 49.04000 70 'point symmetry operation' ? ? -0.81915200 -0.57357600 0.00000000 365.07295 0.57357600 -0.81915200 0.00000000 190.04495 0.00000000 0.00000000 1.00000000 61.30000 71 'point symmetry operation' ? ? -0.79863600 0.60181500 0.00000000 182.60609 -0.60181500 -0.79863600 0.00000000 366.25115 0.00000000 0.00000000 1.00000000 61.30000 72 'point symmetry operation' ? ? 0.32556800 0.94551900 0.00000000 -41.36133 -0.94551900 0.32556800 0.00000000 247.16556 0.00000000 0.00000000 1.00000000 61.30000 73 'point symmetry operation' ? ? 0.99984800 -0.01745200 0.00000000 2.68606 0.01745200 0.99984800 0.00000000 -2.63958 0.00000000 0.00000000 1.00000000 61.30000 74 'point symmetry operation' ? ? 0.29237200 -0.95630500 0.00000000 253.87626 0.95630500 0.29237200 0.00000000 -37.94206 0.00000000 0.00000000 1.00000000 61.30000 75 'point symmetry operation' ? ? -0.99452200 -0.10452800 0.00000000 320.26472 0.10452800 -0.99452200 0.00000000 288.36765 0.00000000 0.00000000 1.00000000 73.56000 76 'point symmetry operation' ? ? -0.40673700 0.91354500 0.00000000 75.24914 -0.91354500 -0.40673700 0.00000000 354.01937 0.00000000 0.00000000 1.00000000 73.56000 77 'point symmetry operation' ? ? 0.74314500 0.66913100 0.00000000 -62.90334 -0.66913100 0.74314500 0.00000000 141.28321 0.00000000 0.00000000 1.00000000 73.56000 78 'point symmetry operation' ? ? 0.86602500 -0.50000000 0.00000000 96.72931 0.50000000 0.86602500 0.00000000 -55.84669 0.00000000 0.00000000 1.00000000 73.56000 79 'point symmetry operation' ? ? -0.20791200 -0.97814800 0.00000000 333.54019 0.97814800 -0.20791200 0.00000000 35.05649 0.00000000 0.00000000 1.00000000 73.56000 80 'point symmetry operation' ? ? -0.92050500 0.39073100 0.00000000 233.40676 -0.39073100 -0.92050500 0.00000000 352.63915 0.00000000 0.00000000 1.00000000 85.82000 81 'point symmetry operation' ? ? 0.08715600 0.99619500 0.00000000 -12.71728 -0.99619500 0.08715600 0.00000000 291.27354 0.00000000 0.00000000 1.00000000 85.82000 82 'point symmetry operation' ? ? 0.97437000 0.22495100 0.00000000 -30.41162 -0.22495100 0.97437000 0.00000000 38.23265 0.00000000 0.00000000 1.00000000 85.82000 83 'point symmetry operation' ? ? 0.51503800 -0.85716700 0.00000000 204.77672 0.85716700 0.51503800 0.00000000 -56.78961 0.00000000 0.00000000 1.00000000 85.82000 84 'point symmetry operation' ? ? -0.65605900 -0.75471000 0.00000000 367.82544 0.75471000 -0.65605900 0.00000000 137.52430 0.00000000 0.00000000 1.00000000 85.82000 85 'point symmetry operation' ? ? -0.61566100 0.78801100 0.00000000 126.27964 -0.78801100 -0.61566100 0.00000000 366.74271 0.00000000 0.00000000 1.00000000 98.08000 86 'point symmetry operation' ? ? 0.55919300 0.82903800 0.00000000 -59.23466 -0.82903800 0.55919300 0.00000000 193.74783 0.00000000 0.00000000 1.00000000 98.08000 87 'point symmetry operation' ? ? 0.96126200 -0.27563700 0.00000000 47.96618 0.27563700 0.96126200 0.00000000 -36.14511 0.00000000 0.00000000 1.00000000 98.08000 88 'point symmetry operation' ? ? 0.03489900 -0.99939100 0.00000000 299.73424 0.99939100 0.03489900 0.00000000 -5.23188 0.00000000 0.00000000 1.00000000 98.08000 89 'point symmetry operation' ? ? -0.93969300 -0.34202000 0.00000000 348.13462 0.34202000 -0.93969300 0.00000000 243.76648 0.00000000 0.00000000 1.00000000 98.08000 90 'point symmetry operation' ? ? -0.15643400 0.98768800 0.00000000 25.74661 -0.98768800 -0.15643400 0.00000000 327.14169 0.00000000 0.00000000 1.00000000 110.34000 91 'point symmetry operation' ? ? 0.89100700 0.45399000 0.00000000 -52.63827 -0.45399000 0.89100700 0.00000000 85.89785 0.00000000 0.00000000 1.00000000 110.34000 92 'point symmetry operation' ? ? 0.70710700 -0.70710700 0.00000000 152.57600 0.70710700 0.70710700 0.00000000 -63.19905 0.00000000 0.00000000 1.00000000 110.34000 93 'point symmetry operation' ? ? -0.45399000 -0.89100700 0.00000000 357.79028 0.89100700 -0.45399000 0.00000000 85.89785 0.00000000 0.00000000 1.00000000 110.34000 94 'point symmetry operation' ? ? -0.98768800 0.15643400 0.00000000 279.40540 -0.15643400 -0.98768800 0.00000000 327.14169 0.00000000 0.00000000 1.00000000 110.34000 95 'point symmetry operation' ? ? 0.34202000 0.93969300 0.00000000 -42.98261 -0.93969300 0.34202000 0.00000000 243.76648 0.00000000 0.00000000 1.00000000 122.60000 96 'point symmetry operation' ? ? 0.99939100 -0.03489900 0.00000000 5.41777 0.03489900 0.99939100 0.00000000 -5.23188 0.00000000 0.00000000 1.00000000 122.60000 97 'point symmetry operation' ? ? 0.27563700 -0.96126200 0.00000000 257.18583 0.96126200 0.27563700 0.00000000 -36.14511 0.00000000 0.00000000 1.00000000 122.60000 98 'point symmetry operation' ? ? -0.82903800 -0.55919300 0.00000000 364.38667 0.55919300 -0.82903800 0.00000000 193.74783 0.00000000 0.00000000 1.00000000 122.60000 99 'point symmetry operation' ? ? -0.78801100 0.61566100 0.00000000 178.87237 -0.61566100 -0.78801100 0.00000000 366.74271 0.00000000 0.00000000 1.00000000 122.60000 100 'point symmetry operation' ? ? 0.75471000 0.65605900 0.00000000 -62.67343 -0.65605900 0.75471000 0.00000000 137.52430 0.00000000 0.00000000 1.00000000 134.86000 101 'point symmetry operation' ? ? 0.85716700 -0.51503800 0.00000000 100.37529 0.51503800 0.85716700 0.00000000 -56.78961 0.00000000 0.00000000 1.00000000 134.86000 102 'point symmetry operation' ? ? -0.22495100 -0.97437000 0.00000000 335.56363 0.97437000 -0.22495100 0.00000000 38.23265 0.00000000 0.00000000 1.00000000 134.86000 103 'point symmetry operation' ? ? -0.99619500 -0.08715600 0.00000000 317.86929 0.08715600 -0.99619500 0.00000000 291.27354 0.00000000 0.00000000 1.00000000 134.86000 104 'point symmetry operation' ? ? -0.39073100 0.92050500 0.00000000 71.74525 -0.92050500 -0.39073100 0.00000000 352.63915 0.00000000 0.00000000 1.00000000 134.86000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 7 ? THR A 19 ? PHE A 7 THR A 19 1 ? 13 HELX_P HELX_P2 AA2 GLY A 20 ? GLY A 38 ? GLY A 20 GLY A 38 1 ? 19 HELX_P HELX_P3 AA3 LEU A 44 ? ASN A 59 ? LEU A 44 ASN A 59 1 ? 16 HELX_P HELX_P4 AA4 ASN A 59 ? LEU A 68 ? ASN A 59 LEU A 68 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLY _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id ARG _struct_conn.ptnr2_label_seq_id 69 _struct_conn.ptnr2_label_atom_id C _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLY _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id ARG _struct_conn.ptnr2_auth_seq_id 69 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.330 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id GLY _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id ARG _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 69 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id GLY _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id ARG _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 69 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom N _pdbx_modification_feature.modified_residue_id_linking_atom C _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # _pdbx_entry_details.entry_id 9VP4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 N _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 69 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 9VP4 _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 9VP4 _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.89 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 695564 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages 1 _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type HELICAL # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 8.0 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type 'ORGANELLE OR CELLULAR COMPONENT' _em_entity_assembly.name 'H-Pilus (D69R)' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 9VP4 _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'TFS GLACIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 200 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_min 800 _em_imaging.nominal_defocus_max 1800 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN _em_imaging.objective_aperture ? _em_imaging.microscope_serial_number ? _em_imaging.microscope_version ? # _em_vitrification.entry_id 9VP4 _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 9VP4 _em_experiment.id 1 _em_experiment.reconstruction_method HELICAL _em_experiment.aggregation_state FILAMENT _em_experiment.entity_assembly_id 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 70 ? A ALA 70 2 1 Y 1 A GLY 71 ? A GLY 71 3 1 Y 1 A ILE 72 ? A ILE 72 4 1 Y 1 A PRO 73 ? A PRO 73 5 1 Y 1 A LEU 74 ? A LEU 74 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LHG O1 O N N 161 LHG C1 C N N 162 LHG C2 C N S 163 LHG O2 O N N 164 LHG C3 C N N 165 LHG O3 O N N 166 LHG P P N S 167 LHG O4 O N N 168 LHG O5 O N N 169 LHG O6 O N N 170 LHG C4 C N N 171 LHG C5 C N R 172 LHG C6 C N N 173 LHG O7 O N N 174 LHG C7 C N N 175 LHG O9 O N N 176 LHG C8 C N N 177 LHG C9 C N N 178 LHG C10 C N N 179 LHG O8 O N N 180 LHG C23 C N N 181 LHG O10 O N N 182 LHG C24 C N N 183 LHG C11 C N N 184 LHG C12 C N N 185 LHG C13 C N N 186 LHG C14 C N N 187 LHG C15 C N N 188 LHG C16 C N N 189 LHG C17 C N N 190 LHG C18 C N N 191 LHG C19 C N N 192 LHG C20 C N N 193 LHG C21 C N N 194 LHG C22 C N N 195 LHG C25 C N N 196 LHG C26 C N N 197 LHG C27 C N N 198 LHG C28 C N N 199 LHG C29 C N N 200 LHG C30 C N N 201 LHG C31 C N N 202 LHG C32 C N N 203 LHG C33 C N N 204 LHG C34 C N N 205 LHG C35 C N N 206 LHG C36 C N N 207 LHG C37 C N N 208 LHG C38 C N N 209 LHG HO1 H N N 210 LHG HC11 H N N 211 LHG HC12 H N N 212 LHG HC2 H N N 213 LHG H02 H N N 214 LHG HC31 H N N 215 LHG HC32 H N N 216 LHG HO4 H N N 217 LHG HC41 H N N 218 LHG HC42 H N N 219 LHG HC5 H N N 220 LHG HC61 H N N 221 LHG HC62 H N N 222 LHG HC81 H N N 223 LHG HC82 H N N 224 LHG HC91 H N N 225 LHG HC92 H N N 226 LHG H101 H N N 227 LHG H102 H N N 228 LHG H241 H N N 229 LHG H242 H N N 230 LHG H111 H N N 231 LHG H112 H N N 232 LHG H121 H N N 233 LHG H122 H N N 234 LHG H131 H N N 235 LHG H132 H N N 236 LHG H141 H N N 237 LHG H142 H N N 238 LHG H151 H N N 239 LHG H152 H N N 240 LHG H161 H N N 241 LHG H162 H N N 242 LHG H171 H N N 243 LHG H172 H N N 244 LHG H181 H N N 245 LHG H182 H N N 246 LHG H191 H N N 247 LHG H192 H N N 248 LHG H201 H N N 249 LHG H202 H N N 250 LHG H211 H N N 251 LHG H212 H N N 252 LHG H221 H N N 253 LHG H222 H N N 254 LHG H223 H N N 255 LHG H251 H N N 256 LHG H252 H N N 257 LHG H261 H N N 258 LHG H262 H N N 259 LHG H271 H N N 260 LHG H272 H N N 261 LHG H281 H N N 262 LHG H282 H N N 263 LHG H291 H N N 264 LHG H292 H N N 265 LHG H301 H N N 266 LHG H302 H N N 267 LHG H311 H N N 268 LHG H312 H N N 269 LHG H321 H N N 270 LHG H322 H N N 271 LHG H331 H N N 272 LHG H332 H N N 273 LHG H341 H N N 274 LHG H342 H N N 275 LHG H351 H N N 276 LHG H352 H N N 277 LHG H361 H N N 278 LHG H362 H N N 279 LHG H371 H N N 280 LHG H372 H N N 281 LHG H381 H N N 282 LHG H382 H N N 283 LHG H383 H N N 284 LYS N N N N 285 LYS CA C N S 286 LYS C C N N 287 LYS O O N N 288 LYS CB C N N 289 LYS CG C N N 290 LYS CD C N N 291 LYS CE C N N 292 LYS NZ N N N 293 LYS OXT O N N 294 LYS H H N N 295 LYS H2 H N N 296 LYS HA H N N 297 LYS HB2 H N N 298 LYS HB3 H N N 299 LYS HG2 H N N 300 LYS HG3 H N N 301 LYS HD2 H N N 302 LYS HD3 H N N 303 LYS HE2 H N N 304 LYS HE3 H N N 305 LYS HZ1 H N N 306 LYS HZ2 H N N 307 LYS HZ3 H N N 308 LYS HXT H N N 309 MET N N N N 310 MET CA C N S 311 MET C C N N 312 MET O O N N 313 MET CB C N N 314 MET CG C N N 315 MET SD S N N 316 MET CE C N N 317 MET OXT O N N 318 MET H H N N 319 MET H2 H N N 320 MET HA H N N 321 MET HB2 H N N 322 MET HB3 H N N 323 MET HG2 H N N 324 MET HG3 H N N 325 MET HE1 H N N 326 MET HE2 H N N 327 MET HE3 H N N 328 MET HXT H N N 329 PHE N N N N 330 PHE CA C N S 331 PHE C C N N 332 PHE O O N N 333 PHE CB C N N 334 PHE CG C Y N 335 PHE CD1 C Y N 336 PHE CD2 C Y N 337 PHE CE1 C Y N 338 PHE CE2 C Y N 339 PHE CZ C Y N 340 PHE OXT O N N 341 PHE H H N N 342 PHE H2 H N N 343 PHE HA H N N 344 PHE HB2 H N N 345 PHE HB3 H N N 346 PHE HD1 H N N 347 PHE HD2 H N N 348 PHE HE1 H N N 349 PHE HE2 H N N 350 PHE HZ H N N 351 PHE HXT H N N 352 PRO N N N N 353 PRO CA C N S 354 PRO C C N N 355 PRO O O N N 356 PRO CB C N N 357 PRO CG C N N 358 PRO CD C N N 359 PRO OXT O N N 360 PRO H H N N 361 PRO HA H N N 362 PRO HB2 H N N 363 PRO HB3 H N N 364 PRO HG2 H N N 365 PRO HG3 H N N 366 PRO HD2 H N N 367 PRO HD3 H N N 368 PRO HXT H N N 369 SER N N N N 370 SER CA C N S 371 SER C C N N 372 SER O O N N 373 SER CB C N N 374 SER OG O N N 375 SER OXT O N N 376 SER H H N N 377 SER H2 H N N 378 SER HA H N N 379 SER HB2 H N N 380 SER HB3 H N N 381 SER HG H N N 382 SER HXT H N N 383 THR N N N N 384 THR CA C N S 385 THR C C N N 386 THR O O N N 387 THR CB C N R 388 THR OG1 O N N 389 THR CG2 C N N 390 THR OXT O N N 391 THR H H N N 392 THR H2 H N N 393 THR HA H N N 394 THR HB H N N 395 THR HG1 H N N 396 THR HG21 H N N 397 THR HG22 H N N 398 THR HG23 H N N 399 THR HXT H N N 400 TRP N N N N 401 TRP CA C N S 402 TRP C C N N 403 TRP O O N N 404 TRP CB C N N 405 TRP CG C Y N 406 TRP CD1 C Y N 407 TRP CD2 C Y N 408 TRP NE1 N Y N 409 TRP CE2 C Y N 410 TRP CE3 C Y N 411 TRP CZ2 C Y N 412 TRP CZ3 C Y N 413 TRP CH2 C Y N 414 TRP OXT O N N 415 TRP H H N N 416 TRP H2 H N N 417 TRP HA H N N 418 TRP HB2 H N N 419 TRP HB3 H N N 420 TRP HD1 H N N 421 TRP HE1 H N N 422 TRP HE3 H N N 423 TRP HZ2 H N N 424 TRP HZ3 H N N 425 TRP HH2 H N N 426 TRP HXT H N N 427 TYR N N N N 428 TYR CA C N S 429 TYR C C N N 430 TYR O O N N 431 TYR CB C N N 432 TYR CG C Y N 433 TYR CD1 C Y N 434 TYR CD2 C Y N 435 TYR CE1 C Y N 436 TYR CE2 C Y N 437 TYR CZ C Y N 438 TYR OH O N N 439 TYR OXT O N N 440 TYR H H N N 441 TYR H2 H N N 442 TYR HA H N N 443 TYR HB2 H N N 444 TYR HB3 H N N 445 TYR HD1 H N N 446 TYR HD2 H N N 447 TYR HE1 H N N 448 TYR HE2 H N N 449 TYR HH H N N 450 TYR HXT H N N 451 VAL N N N N 452 VAL CA C N S 453 VAL C C N N 454 VAL O O N N 455 VAL CB C N N 456 VAL CG1 C N N 457 VAL CG2 C N N 458 VAL OXT O N N 459 VAL H H N N 460 VAL H2 H N N 461 VAL HA H N N 462 VAL HB H N N 463 VAL HG11 H N N 464 VAL HG12 H N N 465 VAL HG13 H N N 466 VAL HG21 H N N 467 VAL HG22 H N N 468 VAL HG23 H N N 469 VAL HXT H N N 470 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 ILE N CA sing N N 110 ILE N H sing N N 111 ILE N H2 sing N N 112 ILE CA C sing N N 113 ILE CA CB sing N N 114 ILE CA HA sing N N 115 ILE C O doub N N 116 ILE C OXT sing N N 117 ILE CB CG1 sing N N 118 ILE CB CG2 sing N N 119 ILE CB HB sing N N 120 ILE CG1 CD1 sing N N 121 ILE CG1 HG12 sing N N 122 ILE CG1 HG13 sing N N 123 ILE CG2 HG21 sing N N 124 ILE CG2 HG22 sing N N 125 ILE CG2 HG23 sing N N 126 ILE CD1 HD11 sing N N 127 ILE CD1 HD12 sing N N 128 ILE CD1 HD13 sing N N 129 ILE OXT HXT sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 LHG O1 C1 sing N N 152 LHG O1 HO1 sing N N 153 LHG C1 C2 sing N N 154 LHG C1 HC11 sing N N 155 LHG C1 HC12 sing N N 156 LHG C2 O2 sing N N 157 LHG C2 C3 sing N N 158 LHG C2 HC2 sing N N 159 LHG O2 H02 sing N N 160 LHG C3 O3 sing N N 161 LHG C3 HC31 sing N N 162 LHG C3 HC32 sing N N 163 LHG O3 P sing N N 164 LHG P O4 sing N N 165 LHG P O5 doub N N 166 LHG P O6 sing N N 167 LHG O4 HO4 sing N N 168 LHG O6 C4 sing N N 169 LHG C4 C5 sing N N 170 LHG C4 HC41 sing N N 171 LHG C4 HC42 sing N N 172 LHG C5 C6 sing N N 173 LHG C5 O7 sing N N 174 LHG C5 HC5 sing N N 175 LHG C6 O8 sing N N 176 LHG C6 HC61 sing N N 177 LHG C6 HC62 sing N N 178 LHG O7 C7 sing N N 179 LHG C7 O9 doub N N 180 LHG C7 C8 sing N N 181 LHG C8 C9 sing N N 182 LHG C8 HC81 sing N N 183 LHG C8 HC82 sing N N 184 LHG C9 C10 sing N N 185 LHG C9 HC91 sing N N 186 LHG C9 HC92 sing N N 187 LHG C10 C11 sing N N 188 LHG C10 H101 sing N N 189 LHG C10 H102 sing N N 190 LHG O8 C23 sing N N 191 LHG C23 O10 doub N N 192 LHG C23 C24 sing N N 193 LHG C24 C25 sing N N 194 LHG C24 H241 sing N N 195 LHG C24 H242 sing N N 196 LHG C11 C12 sing N N 197 LHG C11 H111 sing N N 198 LHG C11 H112 sing N N 199 LHG C12 C13 sing N N 200 LHG C12 H121 sing N N 201 LHG C12 H122 sing N N 202 LHG C13 C14 sing N N 203 LHG C13 H131 sing N N 204 LHG C13 H132 sing N N 205 LHG C14 C15 sing N N 206 LHG C14 H141 sing N N 207 LHG C14 H142 sing N N 208 LHG C15 C16 sing N N 209 LHG C15 H151 sing N N 210 LHG C15 H152 sing N N 211 LHG C16 C17 sing N N 212 LHG C16 H161 sing N N 213 LHG C16 H162 sing N N 214 LHG C17 C18 sing N N 215 LHG C17 H171 sing N N 216 LHG C17 H172 sing N N 217 LHG C18 C19 sing N N 218 LHG C18 H181 sing N N 219 LHG C18 H182 sing N N 220 LHG C19 C20 sing N N 221 LHG C19 H191 sing N N 222 LHG C19 H192 sing N N 223 LHG C20 C21 sing N N 224 LHG C20 H201 sing N N 225 LHG C20 H202 sing N N 226 LHG C21 C22 sing N N 227 LHG C21 H211 sing N N 228 LHG C21 H212 sing N N 229 LHG C22 H221 sing N N 230 LHG C22 H222 sing N N 231 LHG C22 H223 sing N N 232 LHG C25 C26 sing N N 233 LHG C25 H251 sing N N 234 LHG C25 H252 sing N N 235 LHG C26 C27 sing N N 236 LHG C26 H261 sing N N 237 LHG C26 H262 sing N N 238 LHG C27 C28 sing N N 239 LHG C27 H271 sing N N 240 LHG C27 H272 sing N N 241 LHG C28 C29 sing N N 242 LHG C28 H281 sing N N 243 LHG C28 H282 sing N N 244 LHG C29 C30 sing N N 245 LHG C29 H291 sing N N 246 LHG C29 H292 sing N N 247 LHG C30 C31 sing N N 248 LHG C30 H301 sing N N 249 LHG C30 H302 sing N N 250 LHG C31 C32 sing N N 251 LHG C31 H311 sing N N 252 LHG C31 H312 sing N N 253 LHG C32 C33 sing N N 254 LHG C32 H321 sing N N 255 LHG C32 H322 sing N N 256 LHG C33 C34 sing N N 257 LHG C33 H331 sing N N 258 LHG C33 H332 sing N N 259 LHG C34 C35 sing N N 260 LHG C34 H341 sing N N 261 LHG C34 H342 sing N N 262 LHG C35 C36 sing N N 263 LHG C35 H351 sing N N 264 LHG C35 H352 sing N N 265 LHG C36 C37 sing N N 266 LHG C36 H361 sing N N 267 LHG C36 H362 sing N N 268 LHG C37 C38 sing N N 269 LHG C37 H371 sing N N 270 LHG C37 H372 sing N N 271 LHG C38 H381 sing N N 272 LHG C38 H382 sing N N 273 LHG C38 H383 sing N N 274 LYS N CA sing N N 275 LYS N H sing N N 276 LYS N H2 sing N N 277 LYS CA C sing N N 278 LYS CA CB sing N N 279 LYS CA HA sing N N 280 LYS C O doub N N 281 LYS C OXT sing N N 282 LYS CB CG sing N N 283 LYS CB HB2 sing N N 284 LYS CB HB3 sing N N 285 LYS CG CD sing N N 286 LYS CG HG2 sing N N 287 LYS CG HG3 sing N N 288 LYS CD CE sing N N 289 LYS CD HD2 sing N N 290 LYS CD HD3 sing N N 291 LYS CE NZ sing N N 292 LYS CE HE2 sing N N 293 LYS CE HE3 sing N N 294 LYS NZ HZ1 sing N N 295 LYS NZ HZ2 sing N N 296 LYS NZ HZ3 sing N N 297 LYS OXT HXT sing N N 298 MET N CA sing N N 299 MET N H sing N N 300 MET N H2 sing N N 301 MET CA C sing N N 302 MET CA CB sing N N 303 MET CA HA sing N N 304 MET C O doub N N 305 MET C OXT sing N N 306 MET CB CG sing N N 307 MET CB HB2 sing N N 308 MET CB HB3 sing N N 309 MET CG SD sing N N 310 MET CG HG2 sing N N 311 MET CG HG3 sing N N 312 MET SD CE sing N N 313 MET CE HE1 sing N N 314 MET CE HE2 sing N N 315 MET CE HE3 sing N N 316 MET OXT HXT sing N N 317 PHE N CA sing N N 318 PHE N H sing N N 319 PHE N H2 sing N N 320 PHE CA C sing N N 321 PHE CA CB sing N N 322 PHE CA HA sing N N 323 PHE C O doub N N 324 PHE C OXT sing N N 325 PHE CB CG sing N N 326 PHE CB HB2 sing N N 327 PHE CB HB3 sing N N 328 PHE CG CD1 doub Y N 329 PHE CG CD2 sing Y N 330 PHE CD1 CE1 sing Y N 331 PHE CD1 HD1 sing N N 332 PHE CD2 CE2 doub Y N 333 PHE CD2 HD2 sing N N 334 PHE CE1 CZ doub Y N 335 PHE CE1 HE1 sing N N 336 PHE CE2 CZ sing Y N 337 PHE CE2 HE2 sing N N 338 PHE CZ HZ sing N N 339 PHE OXT HXT sing N N 340 PRO N CA sing N N 341 PRO N CD sing N N 342 PRO N H sing N N 343 PRO CA C sing N N 344 PRO CA CB sing N N 345 PRO CA HA sing N N 346 PRO C O doub N N 347 PRO C OXT sing N N 348 PRO CB CG sing N N 349 PRO CB HB2 sing N N 350 PRO CB HB3 sing N N 351 PRO CG CD sing N N 352 PRO CG HG2 sing N N 353 PRO CG HG3 sing N N 354 PRO CD HD2 sing N N 355 PRO CD HD3 sing N N 356 PRO OXT HXT sing N N 357 SER N CA sing N N 358 SER N H sing N N 359 SER N H2 sing N N 360 SER CA C sing N N 361 SER CA CB sing N N 362 SER CA HA sing N N 363 SER C O doub N N 364 SER C OXT sing N N 365 SER CB OG sing N N 366 SER CB HB2 sing N N 367 SER CB HB3 sing N N 368 SER OG HG sing N N 369 SER OXT HXT sing N N 370 THR N CA sing N N 371 THR N H sing N N 372 THR N H2 sing N N 373 THR CA C sing N N 374 THR CA CB sing N N 375 THR CA HA sing N N 376 THR C O doub N N 377 THR C OXT sing N N 378 THR CB OG1 sing N N 379 THR CB CG2 sing N N 380 THR CB HB sing N N 381 THR OG1 HG1 sing N N 382 THR CG2 HG21 sing N N 383 THR CG2 HG22 sing N N 384 THR CG2 HG23 sing N N 385 THR OXT HXT sing N N 386 TRP N CA sing N N 387 TRP N H sing N N 388 TRP N H2 sing N N 389 TRP CA C sing N N 390 TRP CA CB sing N N 391 TRP CA HA sing N N 392 TRP C O doub N N 393 TRP C OXT sing N N 394 TRP CB CG sing N N 395 TRP CB HB2 sing N N 396 TRP CB HB3 sing N N 397 TRP CG CD1 doub Y N 398 TRP CG CD2 sing Y N 399 TRP CD1 NE1 sing Y N 400 TRP CD1 HD1 sing N N 401 TRP CD2 CE2 doub Y N 402 TRP CD2 CE3 sing Y N 403 TRP NE1 CE2 sing Y N 404 TRP NE1 HE1 sing N N 405 TRP CE2 CZ2 sing Y N 406 TRP CE3 CZ3 doub Y N 407 TRP CE3 HE3 sing N N 408 TRP CZ2 CH2 doub Y N 409 TRP CZ2 HZ2 sing N N 410 TRP CZ3 CH2 sing Y N 411 TRP CZ3 HZ3 sing N N 412 TRP CH2 HH2 sing N N 413 TRP OXT HXT sing N N 414 TYR N CA sing N N 415 TYR N H sing N N 416 TYR N H2 sing N N 417 TYR CA C sing N N 418 TYR CA CB sing N N 419 TYR CA HA sing N N 420 TYR C O doub N N 421 TYR C OXT sing N N 422 TYR CB CG sing N N 423 TYR CB HB2 sing N N 424 TYR CB HB3 sing N N 425 TYR CG CD1 doub Y N 426 TYR CG CD2 sing Y N 427 TYR CD1 CE1 sing Y N 428 TYR CD1 HD1 sing N N 429 TYR CD2 CE2 doub Y N 430 TYR CD2 HD2 sing N N 431 TYR CE1 CZ doub Y N 432 TYR CE1 HE1 sing N N 433 TYR CE2 CZ sing Y N 434 TYR CE2 HE2 sing N N 435 TYR CZ OH sing N N 436 TYR OH HH sing N N 437 TYR OXT HXT sing N N 438 VAL N CA sing N N 439 VAL N H sing N N 440 VAL N H2 sing N N 441 VAL CA C sing N N 442 VAL CA CB sing N N 443 VAL CA HA sing N N 444 VAL C O doub N N 445 VAL C OXT sing N N 446 VAL CB CG1 sing N N 447 VAL CB CG2 sing N N 448 VAL CB HB sing N N 449 VAL CG1 HG11 sing N N 450 VAL CG1 HG12 sing N N 451 VAL CG1 HG13 sing N N 452 VAL CG2 HG21 sing N N 453 VAL CG2 HG22 sing N N 454 VAL CG2 HG23 sing N N 455 VAL OXT HXT sing N N 456 # _em_admin.current_status REL _em_admin.deposition_date 2025-07-02 _em_admin.deposition_site PDBJ _em_admin.entry_id 9VP4 _em_admin.last_update 2025-12-24 _em_admin.map_release_date 2025-12-24 _em_admin.title 'CryoEM structure of cyclised H-pilus (D69R)' # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units KILODALTONS/NANOMETER _em_entity_assembly_molwt.value 7.1 # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 90370 _em_entity_assembly_naturalsource.organism 'Salmonella enterica subsp. enterica serovar Typhi' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? _em_entity_assembly_naturalsource.details ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.details ? _em_helical_entity.axial_symmetry C5 _em_helical_entity.angular_rotation_per_subunit 29.00 _em_helical_entity.axial_rise_per_subunit 12.26 # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 46.0 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'FEI FALCON IV (4k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version _em_software.reference_DOI 'PARTICLE SELECTION' ? 1 1 ? ? cryoSPARC ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 EPU ? ? MASKING ? 3 ? ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? cryoSPARC ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? ? 'MODEL FITTING' ? 7 ? 1 ? 'UCSF ChimeraX' ? ? 'MODEL FITTING' ? 8 ? 1 ? Coot ? ? OTHER ? 9 ? ? ? ? ? ? 'MODEL REFINEMENT' ? 10 ? 1 ? PHENIX 1.20.1_4487 ? 'INITIAL EULER ASSIGNMENT' ? 11 1 ? ? cryoSPARC ? ? 'FINAL EULER ASSIGNMENT' ? 12 1 ? ? cryoSPARC ? ? CLASSIFICATION ? 13 1 ? ? ? ? ? RECONSTRUCTION ? 14 1 ? ? cryoSPARC ? ? 'VOLUME SELECTION' ? 15 1 1 1 ? ? ? 'SERIES ALIGNMENT' ? 16 1 1 1 ? ? ? 'MOLECULAR REPLACEMENT' ? 17 1 1 1 ? ? ? 'LATTICE DISTORTION CORRECTION' ? 18 1 1 1 ? ? ? 'SYMMETRY DETERMINATION' ? 19 1 1 1 ? ? ? 'CRYSTALLOGRAPHY MERGING' ? 20 1 1 1 ? ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 9VP4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ #