data_9VYB # _entry.id 9VYB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VYB pdb_00009vyb 10.2210/pdb9vyb/pdb WWPDB D_1300061805 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-27 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VYB _pdbx_database_status.recvd_initial_deposition_date 2025-07-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9VX7 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email hyojungkim@woosuk.ac.kr _pdbx_contact_author.name_first 'HYO JUNG' _pdbx_contact_author.name_last KIM _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5214-3036 # _audit_author.name 'Kim, H.J.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0001-5214-3036 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Antitoxin Phd at 2.0 Angstroms resolution' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, H.J.' 1 0000-0001-5214-3036 primary 'Kim, H.J.' 2 0000-0001-5214-3036 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Addiction module antidote' 7396.568 2 ? ? ? 'Antitoxin Phd' 2 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Antitoxin Phd' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MMEIKERKLRKVGNSVVMTLSKEFLESIGATATDTVYVDEEKLKDIIVKKNMSEHLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MMEIKERKLRKVGNSVVMTLSKEFLESIGATATDTVYVDEEKLKDIIVKKNMSEHLEHHHHHH _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 GLU n 1 4 ILE n 1 5 LYS n 1 6 GLU n 1 7 ARG n 1 8 LYS n 1 9 LEU n 1 10 ARG n 1 11 LYS n 1 12 VAL n 1 13 GLY n 1 14 ASN n 1 15 SER n 1 16 VAL n 1 17 VAL n 1 18 MET n 1 19 THR n 1 20 LEU n 1 21 SER n 1 22 LYS n 1 23 GLU n 1 24 PHE n 1 25 LEU n 1 26 GLU n 1 27 SER n 1 28 ILE n 1 29 GLY n 1 30 ALA n 1 31 THR n 1 32 ALA n 1 33 THR n 1 34 ASP n 1 35 THR n 1 36 VAL n 1 37 TYR n 1 38 VAL n 1 39 ASP n 1 40 GLU n 1 41 GLU n 1 42 LYS n 1 43 LEU n 1 44 LYS n 1 45 ASP n 1 46 ILE n 1 47 ILE n 1 48 VAL n 1 49 LYS n 1 50 LYS n 1 51 ASN n 1 52 MET n 1 53 SER n 1 54 GLU n 1 55 HIS n 1 56 LEU n 1 57 GLU n 1 58 HIS n 1 59 HIS n 1 60 HIS n 1 61 HIS n 1 62 HIS n 1 63 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 63 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EF_0380 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecalis (strain ATCC 700802 / V583)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226185 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 ILE 4 3 3 ILE ILE A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 ARG 7 6 6 ARG ARG A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 ASN 14 13 13 ASN ASN A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 MET 18 17 17 MET MET A . n A 1 19 THR 19 18 18 THR THR A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 SER 21 20 20 SER SER A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 PHE 24 23 23 PHE PHE A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 SER 27 26 26 SER SER A . n A 1 28 ILE 28 27 27 ILE ILE A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 ALA 30 29 29 ALA ALA A . n A 1 31 THR 31 30 30 THR THR A . n A 1 32 ALA 32 31 31 ALA ALA A . n A 1 33 THR 33 32 32 THR THR A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 THR 35 34 34 THR THR A . n A 1 36 VAL 36 35 35 VAL VAL A . n A 1 37 TYR 37 36 36 TYR TYR A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 LYS 44 43 43 LYS LYS A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ILE 46 45 45 ILE ILE A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 MET 52 51 ? ? ? A . n A 1 53 SER 53 52 ? ? ? A . n A 1 54 GLU 54 53 ? ? ? A . n A 1 55 HIS 55 54 ? ? ? A . n A 1 56 LEU 56 55 ? ? ? A . n A 1 57 GLU 57 56 ? ? ? A . n A 1 58 HIS 58 57 ? ? ? A . n A 1 59 HIS 59 58 ? ? ? A . n A 1 60 HIS 60 59 ? ? ? A . n A 1 61 HIS 61 60 ? ? ? A . n A 1 62 HIS 62 61 ? ? ? A . n A 1 63 HIS 63 62 ? ? ? A . n B 1 1 MET 1 0 0 MET MET B . n B 1 2 MET 2 1 1 MET MET B . n B 1 3 GLU 3 2 2 GLU GLU B . n B 1 4 ILE 4 3 3 ILE ILE B . n B 1 5 LYS 5 4 4 LYS LYS B . n B 1 6 GLU 6 5 5 GLU GLU B . n B 1 7 ARG 7 6 6 ARG ARG B . n B 1 8 LYS 8 7 7 LYS LYS B . n B 1 9 LEU 9 8 8 LEU LEU B . n B 1 10 ARG 10 9 9 ARG ARG B . n B 1 11 LYS 11 10 10 LYS LYS B . n B 1 12 VAL 12 11 11 VAL VAL B . n B 1 13 GLY 13 12 12 GLY GLY B . n B 1 14 ASN 14 13 13 ASN ASN B . n B 1 15 SER 15 14 14 SER SER B . n B 1 16 VAL 16 15 15 VAL VAL B . n B 1 17 VAL 17 16 16 VAL VAL B . n B 1 18 MET 18 17 17 MET MET B . n B 1 19 THR 19 18 18 THR THR B . n B 1 20 LEU 20 19 19 LEU LEU B . n B 1 21 SER 21 20 20 SER SER B . n B 1 22 LYS 22 21 21 LYS LYS B . n B 1 23 GLU 23 22 22 GLU GLU B . n B 1 24 PHE 24 23 23 PHE PHE B . n B 1 25 LEU 25 24 24 LEU LEU B . n B 1 26 GLU 26 25 25 GLU GLU B . n B 1 27 SER 27 26 26 SER SER B . n B 1 28 ILE 28 27 27 ILE ILE B . n B 1 29 GLY 29 28 28 GLY GLY B . n B 1 30 ALA 30 29 29 ALA ALA B . n B 1 31 THR 31 30 30 THR THR B . n B 1 32 ALA 32 31 31 ALA ALA B . n B 1 33 THR 33 32 32 THR THR B . n B 1 34 ASP 34 33 33 ASP ASP B . n B 1 35 THR 35 34 34 THR THR B . n B 1 36 VAL 36 35 35 VAL VAL B . n B 1 37 TYR 37 36 36 TYR TYR B . n B 1 38 VAL 38 37 37 VAL VAL B . n B 1 39 ASP 39 38 38 ASP ASP B . n B 1 40 GLU 40 39 39 GLU GLU B . n B 1 41 GLU 41 40 40 GLU GLU B . n B 1 42 LYS 42 41 41 LYS LYS B . n B 1 43 LEU 43 42 42 LEU LEU B . n B 1 44 LYS 44 43 43 LYS LYS B . n B 1 45 ASP 45 44 44 ASP ASP B . n B 1 46 ILE 46 45 45 ILE ILE B . n B 1 47 ILE 47 46 46 ILE ILE B . n B 1 48 VAL 48 47 47 VAL VAL B . n B 1 49 LYS 49 48 48 LYS LYS B . n B 1 50 LYS 50 49 49 LYS LYS B . n B 1 51 ASN 51 50 50 ASN ASN B . n B 1 52 MET 52 51 51 MET MET B . n B 1 53 SER 53 52 ? ? ? B . n B 1 54 GLU 54 53 ? ? ? B . n B 1 55 HIS 55 54 ? ? ? B . n B 1 56 LEU 56 55 ? ? ? B . n B 1 57 GLU 57 56 ? ? ? B . n B 1 58 HIS 58 57 ? ? ? B . n B 1 59 HIS 59 58 ? ? ? B . n B 1 60 HIS 60 59 ? ? ? B . n B 1 61 HIS 61 60 ? ? ? B . n B 1 62 HIS 62 61 ? ? ? B . n B 1 63 HIS 63 62 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 15 HOH HOH A . C 2 HOH 2 102 14 HOH HOH A . C 2 HOH 3 103 5 HOH HOH A . C 2 HOH 4 104 18 HOH HOH A . C 2 HOH 5 105 7 HOH HOH A . C 2 HOH 6 106 10 HOH HOH A . C 2 HOH 7 107 3 HOH HOH A . C 2 HOH 8 108 6 HOH HOH A . C 2 HOH 9 109 9 HOH HOH A . C 2 HOH 10 110 17 HOH HOH A . C 2 HOH 11 111 19 HOH HOH A . D 2 HOH 1 101 16 HOH HOH B . D 2 HOH 2 102 2 HOH HOH B . D 2 HOH 3 103 1 HOH HOH B . D 2 HOH 4 104 11 HOH HOH B . D 2 HOH 5 105 8 HOH HOH B . D 2 HOH 6 106 13 HOH HOH B . D 2 HOH 7 107 4 HOH HOH B . D 2 HOH 8 108 12 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9VYB _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.370 _cell.length_a_esd ? _cell.length_b 47.760 _cell.length_b_esd ? _cell.length_c 48.350 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VYB _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VYB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.12M Ethylene glycols, 0.1M Buffer System 3, 30 % v/v Precipitant Mix 2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 273 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-09-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9VYB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.12 _reflns.d_resolution_low 26.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6172 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.12 _reflns_shell.d_res_low 2.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 8.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 494 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.978 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 11.02 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -3.53 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -7.49 _refine.B_iso_max ? _refine.B_iso_mean 33.969 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.915 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VYB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.12 _refine.ls_d_res_low 26.98 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5863 _refine.ls_number_reflns_R_free 309 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.92 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23561 _refine.ls_R_factor_R_free 0.26946 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23378 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.061 _refine.pdbx_overall_ESU_R_Free 0.046 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.876 _refine.overall_SU_ML 0.131 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.12 _refine_hist.d_res_low 26.98 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 837 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 818 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 816 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 857 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.637 1.648 1087 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 1.291 1.598 1992 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.172 5.000 101 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 35.494 24.118 34 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 17.570 15.000 188 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 30.479 15.000 4 ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.083 0.200 115 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 849 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 139 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? 2.953 3.259 410 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 2.948 3.247 409 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 4.467 4.843 509 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 4.465 4.859 510 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 4.131 3.867 406 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 4.128 3.881 407 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 6.371 5.575 579 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 8.242 37.618 850 ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? 8.237 37.727 851 ? r_long_range_B_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.120 _refine_ls_shell.d_res_low 2.175 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_R_work 409 _refine_ls_shell.percent_reflns_obs 99.54 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.460 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.210 # _struct.entry_id 9VYB _struct.title 'Antitoxin Phd' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VYB _struct_keywords.text 'Phd, ANTITOXIN' _struct_keywords.pdbx_keywords ANTITOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q838Q6_ENTFA _struct_ref.pdbx_db_accession Q838Q6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MEIKERKLRKVGNSVVMTLSKEFLESIGATATDTVYVDEEKLKDIIVKKNMSEH _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9VYB A 2 ? 55 ? Q838Q6 1 ? 54 ? 1 54 2 1 9VYB B 2 ? 55 ? Q838Q6 1 ? 54 ? 1 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9VYB MET A 1 ? UNP Q838Q6 ? ? 'initiating methionine' 0 1 1 9VYB LEU A 56 ? UNP Q838Q6 ? ? 'expression tag' 55 2 1 9VYB GLU A 57 ? UNP Q838Q6 ? ? 'expression tag' 56 3 1 9VYB HIS A 58 ? UNP Q838Q6 ? ? 'expression tag' 57 4 1 9VYB HIS A 59 ? UNP Q838Q6 ? ? 'expression tag' 58 5 1 9VYB HIS A 60 ? UNP Q838Q6 ? ? 'expression tag' 59 6 1 9VYB HIS A 61 ? UNP Q838Q6 ? ? 'expression tag' 60 7 1 9VYB HIS A 62 ? UNP Q838Q6 ? ? 'expression tag' 61 8 1 9VYB HIS A 63 ? UNP Q838Q6 ? ? 'expression tag' 62 9 2 9VYB MET B 1 ? UNP Q838Q6 ? ? 'initiating methionine' 0 10 2 9VYB LEU B 56 ? UNP Q838Q6 ? ? 'expression tag' 55 11 2 9VYB GLU B 57 ? UNP Q838Q6 ? ? 'expression tag' 56 12 2 9VYB HIS B 58 ? UNP Q838Q6 ? ? 'expression tag' 57 13 2 9VYB HIS B 59 ? UNP Q838Q6 ? ? 'expression tag' 58 14 2 9VYB HIS B 60 ? UNP Q838Q6 ? ? 'expression tag' 59 15 2 9VYB HIS B 61 ? UNP Q838Q6 ? ? 'expression tag' 60 16 2 9VYB HIS B 62 ? UNP Q838Q6 ? ? 'expression tag' 61 17 2 9VYB HIS B 63 ? UNP Q838Q6 ? ? 'expression tag' 62 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4830 ? 1 MORE -38 ? 1 'SSA (A^2)' 6590 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 21 ? GLY A 29 ? SER A 20 GLY A 28 1 ? 9 HELX_P HELX_P2 AA2 ASP A 39 ? LYS A 44 ? ASP A 38 LYS A 43 1 ? 6 HELX_P HELX_P3 AA3 SER B 21 ? ILE B 28 ? SER B 20 ILE B 27 1 ? 8 HELX_P HELX_P4 AA4 ASP B 39 ? ILE B 46 ? ASP B 38 ILE B 45 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 5 ? LYS A 8 ? LYS A 4 LYS A 7 AA1 2 THR B 35 ? VAL B 38 ? THR B 34 VAL B 37 AA1 3 ILE A 47 ? LYS A 49 ? ILE A 46 LYS A 48 AA2 1 ARG A 10 ? VAL A 12 ? ARG A 9 VAL A 11 AA2 2 SER A 15 ? LEU A 20 ? SER A 14 LEU A 19 AA2 3 SER B 15 ? LEU B 20 ? SER B 14 LEU B 19 AA2 4 ARG B 10 ? VAL B 12 ? ARG B 9 VAL B 11 AA3 1 LYS B 5 ? LYS B 8 ? LYS B 4 LYS B 7 AA3 2 THR A 35 ? VAL A 38 ? THR A 34 VAL A 37 AA3 3 ILE B 47 ? LYS B 49 ? ILE B 46 LYS B 48 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 5 ? N LYS A 4 O VAL B 38 ? O VAL B 37 AA1 2 3 O TYR B 37 ? O TYR B 36 N VAL A 48 ? N VAL A 47 AA2 1 2 N VAL A 12 ? N VAL A 11 O SER A 15 ? O SER A 14 AA2 2 3 N LEU A 20 ? N LEU A 19 O VAL B 16 ? O VAL B 15 AA2 3 4 O SER B 15 ? O SER B 14 N VAL B 12 ? N VAL B 11 AA3 1 2 O LYS B 5 ? O LYS B 4 N VAL A 38 ? N VAL A 37 AA3 2 3 N TYR A 37 ? N TYR A 36 O VAL B 48 ? O VAL B 47 # _pdbx_entry_details.entry_id 9VYB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 32 ? ? 83.72 -18.00 2 1 THR B 32 ? ? 89.35 -19.68 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 51 ? A MET 52 2 1 Y 1 A SER 52 ? A SER 53 3 1 Y 1 A GLU 53 ? A GLU 54 4 1 Y 1 A HIS 54 ? A HIS 55 5 1 Y 1 A LEU 55 ? A LEU 56 6 1 Y 1 A GLU 56 ? A GLU 57 7 1 Y 1 A HIS 57 ? A HIS 58 8 1 Y 1 A HIS 58 ? A HIS 59 9 1 Y 1 A HIS 59 ? A HIS 60 10 1 Y 1 A HIS 60 ? A HIS 61 11 1 Y 1 A HIS 61 ? A HIS 62 12 1 Y 1 A HIS 62 ? A HIS 63 13 1 Y 1 B SER 52 ? B SER 53 14 1 Y 1 B GLU 53 ? B GLU 54 15 1 Y 1 B HIS 54 ? B HIS 55 16 1 Y 1 B LEU 55 ? B LEU 56 17 1 Y 1 B GLU 56 ? B GLU 57 18 1 Y 1 B HIS 57 ? B HIS 58 19 1 Y 1 B HIS 58 ? B HIS 59 20 1 Y 1 B HIS 59 ? B HIS 60 21 1 Y 1 B HIS 60 ? B HIS 61 22 1 Y 1 B HIS 61 ? B HIS 62 23 1 Y 1 B HIS 62 ? B HIS 63 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 HOH O O N N 124 HOH H1 H N N 125 HOH H2 H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 SER N N N N 239 SER CA C N S 240 SER C C N N 241 SER O O N N 242 SER CB C N N 243 SER OG O N N 244 SER OXT O N N 245 SER H H N N 246 SER H2 H N N 247 SER HA H N N 248 SER HB2 H N N 249 SER HB3 H N N 250 SER HG H N N 251 SER HXT H N N 252 THR N N N N 253 THR CA C N S 254 THR C C N N 255 THR O O N N 256 THR CB C N R 257 THR OG1 O N N 258 THR CG2 C N N 259 THR OXT O N N 260 THR H H N N 261 THR H2 H N N 262 THR HA H N N 263 THR HB H N N 264 THR HG1 H N N 265 THR HG21 H N N 266 THR HG22 H N N 267 THR HG23 H N N 268 THR HXT H N N 269 TYR N N N N 270 TYR CA C N S 271 TYR C C N N 272 TYR O O N N 273 TYR CB C N N 274 TYR CG C Y N 275 TYR CD1 C Y N 276 TYR CD2 C Y N 277 TYR CE1 C Y N 278 TYR CE2 C Y N 279 TYR CZ C Y N 280 TYR OH O N N 281 TYR OXT O N N 282 TYR H H N N 283 TYR H2 H N N 284 TYR HA H N N 285 TYR HB2 H N N 286 TYR HB3 H N N 287 TYR HD1 H N N 288 TYR HD2 H N N 289 TYR HE1 H N N 290 TYR HE2 H N N 291 TYR HH H N N 292 TYR HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 HOH O H1 sing N N 118 HOH O H2 sing N N 119 ILE N CA sing N N 120 ILE N H sing N N 121 ILE N H2 sing N N 122 ILE CA C sing N N 123 ILE CA CB sing N N 124 ILE CA HA sing N N 125 ILE C O doub N N 126 ILE C OXT sing N N 127 ILE CB CG1 sing N N 128 ILE CB CG2 sing N N 129 ILE CB HB sing N N 130 ILE CG1 CD1 sing N N 131 ILE CG1 HG12 sing N N 132 ILE CG1 HG13 sing N N 133 ILE CG2 HG21 sing N N 134 ILE CG2 HG22 sing N N 135 ILE CG2 HG23 sing N N 136 ILE CD1 HD11 sing N N 137 ILE CD1 HD12 sing N N 138 ILE CD1 HD13 sing N N 139 ILE OXT HXT sing N N 140 LEU N CA sing N N 141 LEU N H sing N N 142 LEU N H2 sing N N 143 LEU CA C sing N N 144 LEU CA CB sing N N 145 LEU CA HA sing N N 146 LEU C O doub N N 147 LEU C OXT sing N N 148 LEU CB CG sing N N 149 LEU CB HB2 sing N N 150 LEU CB HB3 sing N N 151 LEU CG CD1 sing N N 152 LEU CG CD2 sing N N 153 LEU CG HG sing N N 154 LEU CD1 HD11 sing N N 155 LEU CD1 HD12 sing N N 156 LEU CD1 HD13 sing N N 157 LEU CD2 HD21 sing N N 158 LEU CD2 HD22 sing N N 159 LEU CD2 HD23 sing N N 160 LEU OXT HXT sing N N 161 LYS N CA sing N N 162 LYS N H sing N N 163 LYS N H2 sing N N 164 LYS CA C sing N N 165 LYS CA CB sing N N 166 LYS CA HA sing N N 167 LYS C O doub N N 168 LYS C OXT sing N N 169 LYS CB CG sing N N 170 LYS CB HB2 sing N N 171 LYS CB HB3 sing N N 172 LYS CG CD sing N N 173 LYS CG HG2 sing N N 174 LYS CG HG3 sing N N 175 LYS CD CE sing N N 176 LYS CD HD2 sing N N 177 LYS CD HD3 sing N N 178 LYS CE NZ sing N N 179 LYS CE HE2 sing N N 180 LYS CE HE3 sing N N 181 LYS NZ HZ1 sing N N 182 LYS NZ HZ2 sing N N 183 LYS NZ HZ3 sing N N 184 LYS OXT HXT sing N N 185 MET N CA sing N N 186 MET N H sing N N 187 MET N H2 sing N N 188 MET CA C sing N N 189 MET CA CB sing N N 190 MET CA HA sing N N 191 MET C O doub N N 192 MET C OXT sing N N 193 MET CB CG sing N N 194 MET CB HB2 sing N N 195 MET CB HB3 sing N N 196 MET CG SD sing N N 197 MET CG HG2 sing N N 198 MET CG HG3 sing N N 199 MET SD CE sing N N 200 MET CE HE1 sing N N 201 MET CE HE2 sing N N 202 MET CE HE3 sing N N 203 MET OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 SER N CA sing N N 228 SER N H sing N N 229 SER N H2 sing N N 230 SER CA C sing N N 231 SER CA CB sing N N 232 SER CA HA sing N N 233 SER C O doub N N 234 SER C OXT sing N N 235 SER CB OG sing N N 236 SER CB HB2 sing N N 237 SER CB HB3 sing N N 238 SER OG HG sing N N 239 SER OXT HXT sing N N 240 THR N CA sing N N 241 THR N H sing N N 242 THR N H2 sing N N 243 THR CA C sing N N 244 THR CA CB sing N N 245 THR CA HA sing N N 246 THR C O doub N N 247 THR C OXT sing N N 248 THR CB OG1 sing N N 249 THR CB CG2 sing N N 250 THR CB HB sing N N 251 THR OG1 HG1 sing N N 252 THR CG2 HG21 sing N N 253 THR CG2 HG22 sing N N 254 THR CG2 HG23 sing N N 255 THR OXT HXT sing N N 256 TYR N CA sing N N 257 TYR N H sing N N 258 TYR N H2 sing N N 259 TYR CA C sing N N 260 TYR CA CB sing N N 261 TYR CA HA sing N N 262 TYR C O doub N N 263 TYR C OXT sing N N 264 TYR CB CG sing N N 265 TYR CB HB2 sing N N 266 TYR CB HB3 sing N N 267 TYR CG CD1 doub Y N 268 TYR CG CD2 sing Y N 269 TYR CD1 CE1 sing Y N 270 TYR CD1 HD1 sing N N 271 TYR CD2 CE2 doub Y N 272 TYR CD2 HD2 sing N N 273 TYR CE1 CZ doub Y N 274 TYR CE1 HE1 sing N N 275 TYR CE2 CZ sing Y N 276 TYR CE2 HE2 sing N N 277 TYR CZ OH sing N N 278 TYR OH HH sing N N 279 TYR OXT HXT sing N N 280 VAL N CA sing N N 281 VAL N H sing N N 282 VAL N H2 sing N N 283 VAL CA C sing N N 284 VAL CA CB sing N N 285 VAL CA HA sing N N 286 VAL C O doub N N 287 VAL C OXT sing N N 288 VAL CB CG1 sing N N 289 VAL CB CG2 sing N N 290 VAL CB HB sing N N 291 VAL CG1 HG11 sing N N 292 VAL CG1 HG12 sing N N 293 VAL CG1 HG13 sing N N 294 VAL CG2 HG21 sing N N 295 VAL CG2 HG22 sing N N 296 VAL CG2 HG23 sing N N 297 VAL OXT HXT sing N N 298 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9VYB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022538 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020938 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020683 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #