data_9WPP # _entry.id 9WPP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9WPP pdb_00009wpp 10.2210/pdb9wpp/pdb WWPDB D_1300063327 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9WPP _pdbx_database_status.recvd_initial_deposition_date 2025-09-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email yesheng@buaa.edu.cn _pdbx_contact_author.name_first Sheng _pdbx_contact_author.name_last Ye _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1097-7283 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, K.' 1 0009-0003-9549-4794 'Lyu, Z.' 2 0009-0007-2346-4819 'Ye, S.' 3 0000-0002-1097-7283 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of the SARS-CoV-2 spike protein HR1 in complex with a designed peptide inhibitor dP-S2FI-0087 at 3.1 angstrom resolution ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, K.' 1 0009-0003-9549-4794 primary 'Lyu, Z.' 2 0009-0007-2346-4819 primary 'Ye, S.' 3 0000-0002-1097-7283 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;Spike protein S2' ; 8297.260 2 ? ? ? HR1 2 polymer man dP-S2FI-0087 3650.229 2 ? ? ? ? 3 water nat water 18.015 8 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE A,C ? 2 'polypeptide(L)' no no IGISGINASVINIRAQIAAIQTLAAALEESLIDLGK IGISGINASVINIRAQIAAIQTLAAALEESLIDLGK B,D ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLN n 1 3 ASN n 1 4 VAL n 1 5 LEU n 1 6 TYR n 1 7 GLU n 1 8 ASN n 1 9 GLN n 1 10 LYS n 1 11 LEU n 1 12 ILE n 1 13 ALA n 1 14 ASN n 1 15 GLN n 1 16 PHE n 1 17 ASN n 1 18 SER n 1 19 ALA n 1 20 ILE n 1 21 GLY n 1 22 LYS n 1 23 ILE n 1 24 GLN n 1 25 ASP n 1 26 SER n 1 27 LEU n 1 28 SER n 1 29 SER n 1 30 THR n 1 31 ALA n 1 32 SER n 1 33 ALA n 1 34 LEU n 1 35 GLY n 1 36 LYS n 1 37 LEU n 1 38 GLN n 1 39 ASP n 1 40 VAL n 1 41 VAL n 1 42 ASN n 1 43 GLN n 1 44 ASN n 1 45 ALA n 1 46 GLN n 1 47 ALA n 1 48 LEU n 1 49 ASN n 1 50 THR n 1 51 LEU n 1 52 VAL n 1 53 LYS n 1 54 GLN n 1 55 LEU n 1 56 SER n 1 57 SER n 1 58 ASN n 1 59 PHE n 1 60 GLY n 1 61 ALA n 1 62 ILE n 1 63 SER n 1 64 SER n 1 65 VAL n 1 66 LEU n 1 67 ASN n 1 68 ASP n 1 69 ILE n 1 70 LEU n 1 71 SER n 1 72 ARG n 1 73 LEU n 1 74 ASP n 1 75 LYS n 1 76 VAL n 1 77 GLU n 2 1 ILE n 2 2 GLY n 2 3 ILE n 2 4 SER n 2 5 GLY n 2 6 ILE n 2 7 ASN n 2 8 ALA n 2 9 SER n 2 10 VAL n 2 11 ILE n 2 12 ASN n 2 13 ILE n 2 14 ARG n 2 15 ALA n 2 16 GLN n 2 17 ILE n 2 18 ALA n 2 19 ALA n 2 20 ILE n 2 21 GLN n 2 22 THR n 2 23 LEU n 2 24 ALA n 2 25 ALA n 2 26 ALA n 2 27 LEU n 2 28 GLU n 2 29 GLU n 2 30 SER n 2 31 LEU n 2 32 ILE n 2 33 ASP n 2 34 LEU n 2 35 GLY n 2 36 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 77 '2019-nCoV, SARS-CoV-2' ? 'S, 2' ? ? ? ? ? ? 'SARS-CoV-2 pseudovirus' 3092168 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 36 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 912 ? ? ? A . n A 1 2 GLN 2 913 ? ? ? A . n A 1 3 ASN 3 914 914 ASN ASN A . n A 1 4 VAL 4 915 915 VAL VAL A . n A 1 5 LEU 5 916 916 LEU LEU A . n A 1 6 TYR 6 917 917 TYR TYR A . n A 1 7 GLU 7 918 918 GLU GLU A . n A 1 8 ASN 8 919 919 ASN ASN A . n A 1 9 GLN 9 920 920 GLN GLN A . n A 1 10 LYS 10 921 921 LYS LYS A . n A 1 11 LEU 11 922 922 LEU LEU A . n A 1 12 ILE 12 923 923 ILE ILE A . n A 1 13 ALA 13 924 924 ALA ALA A . n A 1 14 ASN 14 925 925 ASN ASN A . n A 1 15 GLN 15 926 926 GLN GLN A . n A 1 16 PHE 16 927 927 PHE PHE A . n A 1 17 ASN 17 928 928 ASN ASN A . n A 1 18 SER 18 929 929 SER SER A . n A 1 19 ALA 19 930 930 ALA ALA A . n A 1 20 ILE 20 931 931 ILE ILE A . n A 1 21 GLY 21 932 932 GLY GLY A . n A 1 22 LYS 22 933 933 LYS LYS A . n A 1 23 ILE 23 934 934 ILE ILE A . n A 1 24 GLN 24 935 935 GLN GLN A . n A 1 25 ASP 25 936 936 ASP ASP A . n A 1 26 SER 26 937 937 SER SER A . n A 1 27 LEU 27 938 938 LEU LEU A . n A 1 28 SER 28 939 939 SER SER A . n A 1 29 SER 29 940 940 SER SER A . n A 1 30 THR 30 941 941 THR THR A . n A 1 31 ALA 31 942 942 ALA ALA A . n A 1 32 SER 32 943 943 SER SER A . n A 1 33 ALA 33 944 944 ALA ALA A . n A 1 34 LEU 34 945 945 LEU LEU A . n A 1 35 GLY 35 946 946 GLY GLY A . n A 1 36 LYS 36 947 947 LYS LYS A . n A 1 37 LEU 37 948 948 LEU LEU A . n A 1 38 GLN 38 949 949 GLN GLN A . n A 1 39 ASP 39 950 950 ASP ASP A . n A 1 40 VAL 40 951 951 VAL VAL A . n A 1 41 VAL 41 952 952 VAL VAL A . n A 1 42 ASN 42 953 953 ASN ASN A . n A 1 43 GLN 43 954 954 GLN GLN A . n A 1 44 ASN 44 955 955 ASN ASN A . n A 1 45 ALA 45 956 956 ALA ALA A . n A 1 46 GLN 46 957 957 GLN GLN A . n A 1 47 ALA 47 958 958 ALA ALA A . n A 1 48 LEU 48 959 959 LEU LEU A . n A 1 49 ASN 49 960 960 ASN ASN A . n A 1 50 THR 50 961 961 THR THR A . n A 1 51 LEU 51 962 962 LEU LEU A . n A 1 52 VAL 52 963 963 VAL VAL A . n A 1 53 LYS 53 964 964 LYS LYS A . n A 1 54 GLN 54 965 965 GLN GLN A . n A 1 55 LEU 55 966 966 LEU LEU A . n A 1 56 SER 56 967 967 SER SER A . n A 1 57 SER 57 968 968 SER SER A . n A 1 58 ASN 58 969 969 ASN ASN A . n A 1 59 PHE 59 970 970 PHE PHE A . n A 1 60 GLY 60 971 971 GLY GLY A . n A 1 61 ALA 61 972 972 ALA ALA A . n A 1 62 ILE 62 973 973 ILE ILE A . n A 1 63 SER 63 974 974 SER SER A . n A 1 64 SER 64 975 975 SER SER A . n A 1 65 VAL 65 976 976 VAL VAL A . n A 1 66 LEU 66 977 977 LEU LEU A . n A 1 67 ASN 67 978 978 ASN ASN A . n A 1 68 ASP 68 979 979 ASP ASP A . n A 1 69 ILE 69 980 980 ILE ILE A . n A 1 70 LEU 70 981 981 LEU LEU A . n A 1 71 SER 71 982 982 SER SER A . n A 1 72 ARG 72 983 983 ARG ARG A . n A 1 73 LEU 73 984 984 LEU LEU A . n A 1 74 ASP 74 985 985 ASP ASP A . n A 1 75 LYS 75 986 986 LYS LYS A . n A 1 76 VAL 76 987 987 VAL VAL A . n A 1 77 GLU 77 988 988 GLU GLU A . n B 2 1 ILE 1 1167 ? ? ? B . n B 2 2 GLY 2 1168 ? ? ? B . n B 2 3 ILE 3 1169 1169 ILE ILE B . n B 2 4 SER 4 1170 1170 SER SER B . n B 2 5 GLY 5 1171 1171 GLY GLY B . n B 2 6 ILE 6 1172 1172 ILE ILE B . n B 2 7 ASN 7 1173 1173 ASN ASN B . n B 2 8 ALA 8 1174 1174 ALA ALA B . n B 2 9 SER 9 1175 1175 SER SER B . n B 2 10 VAL 10 1176 1176 VAL VAL B . n B 2 11 ILE 11 1177 1177 ILE ILE B . n B 2 12 ASN 12 1178 1178 ASN ASN B . n B 2 13 ILE 13 1179 1179 ILE ILE B . n B 2 14 ARG 14 1180 1180 ARG ARG B . n B 2 15 ALA 15 1181 1181 ALA ALA B . n B 2 16 GLN 16 1182 1182 GLN GLN B . n B 2 17 ILE 17 1183 1183 ILE ILE B . n B 2 18 ALA 18 1184 1184 ALA ALA B . n B 2 19 ALA 19 1185 1185 ALA ALA B . n B 2 20 ILE 20 1186 1186 ILE ILE B . n B 2 21 GLN 21 1187 1187 GLN GLN B . n B 2 22 THR 22 1188 1188 THR THR B . n B 2 23 LEU 23 1189 1189 LEU LEU B . n B 2 24 ALA 24 1190 1190 ALA ALA B . n B 2 25 ALA 25 1191 1191 ALA ALA B . n B 2 26 ALA 26 1192 1192 ALA ALA B . n B 2 27 LEU 27 1193 1193 LEU LEU B . n B 2 28 GLU 28 1194 1194 GLU GLU B . n B 2 29 GLU 29 1195 1195 GLU GLU B . n B 2 30 SER 30 1196 1196 SER SER B . n B 2 31 LEU 31 1197 1197 LEU LEU B . n B 2 32 ILE 32 1198 1198 ILE ILE B . n B 2 33 ASP 33 1199 1199 ASP ASP B . n B 2 34 LEU 34 1200 1200 LEU LEU B . n B 2 35 GLY 35 1201 ? ? ? B . n B 2 36 LYS 36 1202 ? ? ? B . n C 1 1 THR 1 912 ? ? ? C . n C 1 2 GLN 2 913 ? ? ? C . n C 1 3 ASN 3 914 914 ASN ASN C . n C 1 4 VAL 4 915 915 VAL VAL C . n C 1 5 LEU 5 916 916 LEU LEU C . n C 1 6 TYR 6 917 917 TYR TYR C . n C 1 7 GLU 7 918 918 GLU GLU C . n C 1 8 ASN 8 919 919 ASN ASN C . n C 1 9 GLN 9 920 920 GLN GLN C . n C 1 10 LYS 10 921 921 LYS LYS C . n C 1 11 LEU 11 922 922 LEU LEU C . n C 1 12 ILE 12 923 923 ILE ILE C . n C 1 13 ALA 13 924 924 ALA ALA C . n C 1 14 ASN 14 925 925 ASN ASN C . n C 1 15 GLN 15 926 926 GLN GLN C . n C 1 16 PHE 16 927 927 PHE PHE C . n C 1 17 ASN 17 928 928 ASN ASN C . n C 1 18 SER 18 929 929 SER SER C . n C 1 19 ALA 19 930 930 ALA ALA C . n C 1 20 ILE 20 931 931 ILE ILE C . n C 1 21 GLY 21 932 932 GLY GLY C . n C 1 22 LYS 22 933 933 LYS LYS C . n C 1 23 ILE 23 934 934 ILE ILE C . n C 1 24 GLN 24 935 935 GLN GLN C . n C 1 25 ASP 25 936 936 ASP ASP C . n C 1 26 SER 26 937 937 SER SER C . n C 1 27 LEU 27 938 938 LEU LEU C . n C 1 28 SER 28 939 939 SER SER C . n C 1 29 SER 29 940 940 SER SER C . n C 1 30 THR 30 941 941 THR THR C . n C 1 31 ALA 31 942 942 ALA ALA C . n C 1 32 SER 32 943 943 SER SER C . n C 1 33 ALA 33 944 944 ALA ALA C . n C 1 34 LEU 34 945 945 LEU LEU C . n C 1 35 GLY 35 946 946 GLY GLY C . n C 1 36 LYS 36 947 947 LYS LYS C . n C 1 37 LEU 37 948 948 LEU LEU C . n C 1 38 GLN 38 949 949 GLN GLN C . n C 1 39 ASP 39 950 950 ASP ASP C . n C 1 40 VAL 40 951 951 VAL VAL C . n C 1 41 VAL 41 952 952 VAL VAL C . n C 1 42 ASN 42 953 953 ASN ASN C . n C 1 43 GLN 43 954 954 GLN GLN C . n C 1 44 ASN 44 955 955 ASN ASN C . n C 1 45 ALA 45 956 956 ALA ALA C . n C 1 46 GLN 46 957 957 GLN GLN C . n C 1 47 ALA 47 958 958 ALA ALA C . n C 1 48 LEU 48 959 959 LEU LEU C . n C 1 49 ASN 49 960 960 ASN ASN C . n C 1 50 THR 50 961 961 THR THR C . n C 1 51 LEU 51 962 962 LEU LEU C . n C 1 52 VAL 52 963 963 VAL VAL C . n C 1 53 LYS 53 964 964 LYS LYS C . n C 1 54 GLN 54 965 965 GLN GLN C . n C 1 55 LEU 55 966 966 LEU LEU C . n C 1 56 SER 56 967 967 SER SER C . n C 1 57 SER 57 968 968 SER SER C . n C 1 58 ASN 58 969 969 ASN ASN C . n C 1 59 PHE 59 970 970 PHE PHE C . n C 1 60 GLY 60 971 971 GLY GLY C . n C 1 61 ALA 61 972 972 ALA ALA C . n C 1 62 ILE 62 973 973 ILE ILE C . n C 1 63 SER 63 974 974 SER SER C . n C 1 64 SER 64 975 975 SER SER C . n C 1 65 VAL 65 976 976 VAL VAL C . n C 1 66 LEU 66 977 977 LEU LEU C . n C 1 67 ASN 67 978 978 ASN ASN C . n C 1 68 ASP 68 979 979 ASP ASP C . n C 1 69 ILE 69 980 980 ILE ILE C . n C 1 70 LEU 70 981 981 LEU LEU C . n C 1 71 SER 71 982 982 SER SER C . n C 1 72 ARG 72 983 983 ARG ARG C . n C 1 73 LEU 73 984 984 LEU LEU C . n C 1 74 ASP 74 985 985 ASP ASP C . n C 1 75 LYS 75 986 986 LYS LYS C . n C 1 76 VAL 76 987 987 VAL VAL C . n C 1 77 GLU 77 988 988 GLU GLU C . n D 2 1 ILE 1 1167 ? ? ? D . n D 2 2 GLY 2 1168 ? ? ? D . n D 2 3 ILE 3 1169 1169 ILE ILE D . n D 2 4 SER 4 1170 1170 SER SER D . n D 2 5 GLY 5 1171 1171 GLY GLY D . n D 2 6 ILE 6 1172 1172 ILE ILE D . n D 2 7 ASN 7 1173 1173 ASN ASN D . n D 2 8 ALA 8 1174 1174 ALA ALA D . n D 2 9 SER 9 1175 1175 SER SER D . n D 2 10 VAL 10 1176 1176 VAL VAL D . n D 2 11 ILE 11 1177 1177 ILE ILE D . n D 2 12 ASN 12 1178 1178 ASN ASN D . n D 2 13 ILE 13 1179 1179 ILE ILE D . n D 2 14 ARG 14 1180 1180 ARG ARG D . n D 2 15 ALA 15 1181 1181 ALA ALA D . n D 2 16 GLN 16 1182 1182 GLN GLN D . n D 2 17 ILE 17 1183 1183 ILE ILE D . n D 2 18 ALA 18 1184 1184 ALA ALA D . n D 2 19 ALA 19 1185 1185 ALA ALA D . n D 2 20 ILE 20 1186 1186 ILE ILE D . n D 2 21 GLN 21 1187 1187 GLN GLN D . n D 2 22 THR 22 1188 1188 THR THR D . n D 2 23 LEU 23 1189 1189 LEU LEU D . n D 2 24 ALA 24 1190 1190 ALA ALA D . n D 2 25 ALA 25 1191 1191 ALA ALA D . n D 2 26 ALA 26 1192 1192 ALA ALA D . n D 2 27 LEU 27 1193 1193 LEU LEU D . n D 2 28 GLU 28 1194 1194 GLU GLU D . n D 2 29 GLU 29 1195 1195 GLU GLU D . n D 2 30 SER 30 1196 1196 SER SER D . n D 2 31 LEU 31 1197 1197 LEU LEU D . n D 2 32 ILE 32 1198 1198 ILE ILE D . n D 2 33 ASP 33 1199 1199 ASP ASP D . n D 2 34 LEU 34 1200 1200 LEU LEU D . n D 2 35 GLY 35 1201 ? ? ? D . n D 2 36 LYS 36 1202 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 1001 6 HOH HOH A . E 3 HOH 2 1002 4 HOH HOH A . E 3 HOH 3 1003 8 HOH HOH A . E 3 HOH 4 1004 2 HOH HOH A . F 3 HOH 1 1301 3 HOH HOH B . F 3 HOH 2 1302 5 HOH HOH B . G 3 HOH 1 1001 1 HOH HOH C . H 3 HOH 1 1301 7 HOH HOH D . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? . ? 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9WPP _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.073 _cell.length_a_esd ? _cell.length_b 46.073 _cell.length_b_esd ? _cell.length_c 309.817 _cell.length_c_esd ? _cell.volume 569546.070 _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9WPP _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall 'R 3' _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9WPP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MES monohydrate pH 6.5,Polyethylene glycol 20,000,Glycerol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU AFC-6R' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-08-06 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-X' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 67.62 _reflns.entry_id 9WPP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.8 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5983 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 55 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.80 2.88 ? ? ? ? ? ? 463 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? ? ? 0.53 ? ? ? ? ? ? ? ? ? 2.88 2.98 ? ? ? ? ? ? 459 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 ? ? ? ? ? 0.372 ? ? ? ? ? ? ? ? ? 2.98 3.08 ? ? ? ? ? ? 519 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 ? ? ? ? ? 0.714 ? ? ? ? ? ? ? ? ? 3.08 3.21 ? ? ? ? ? ? 493 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 ? ? ? ? ? 0.358 ? ? ? ? ? ? ? ? ? 3.21 3.35 ? ? ? ? ? ? 497 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 ? ? ? ? ? 0.276 ? ? ? ? ? ? ? ? ? 3.35 3.53 ? ? ? ? ? ? 521 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 ? ? ? ? ? 0.22 ? ? ? ? ? ? ? ? ? 3.53 3.75 ? ? ? ? ? ? 485 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 ? ? ? ? ? 0.121 ? ? ? ? ? ? ? ? ? 3.75 4.04 ? ? ? ? ? ? 513 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 ? ? ? ? ? 0.091 ? ? ? ? ? ? ? ? ? 4.04 4.44 ? ? ? ? ? ? 520 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 ? ? ? ? ? 0.054 ? ? ? ? ? ? ? ? ? 4.44 5.09 ? ? ? ? ? ? 504 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 ? ? ? ? ? 0.047 ? ? ? ? ? ? ? ? ? 5.09 6.41 ? ? ? ? ? ? 506 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 ? ? ? ? ? 0.051 ? ? ? ? ? ? ? ? ? 6.41 50 ? ? ? ? ? ? 503 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 ? ? ? ? ? 0.04 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 78.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9WPP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.10 _refine.ls_d_res_low 35.47 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4428 _refine.ls_number_reflns_R_free 222 _refine.ls_number_reflns_R_work 4206 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.77 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3009 _refine.ls_R_factor_R_free 0.3528 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2982 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.97 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.8972 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3240 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.10 _refine_hist.d_res_low 35.47 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 1602 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1594 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0012 ? 1596 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.3447 ? 2160 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0310 ? 280 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0011 ? 280 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 3.1311 ? 218 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.10 3.91 . . 114 2121 99.38 . . . . 0.3146 . . . . . . . . . . . . . . . 0.3359 'X-RAY DIFFRACTION' 3.91 35.47 . . 108 2085 98.16 . . . . 0.2895 . . . . . . . . . . . . . . . 0.3621 # _struct.entry_id 9WPP _struct.title ;Crystal structure of the SARS-CoV-2 spike protein HR1 in complex with a designed peptide inhibitor dP-S2FI-0087 at 3.1 angstrom resolution ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9WPP _struct_keywords.text 'SARS-CoV-2, complex, fusion core, ANTIVIRAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SPIKE_SARS2 P0DTC2 ? 1 TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE 912 2 PDB 9WPP 9WPP ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9WPP A 1 ? 77 ? P0DTC2 912 ? 988 ? 912 988 2 2 9WPP B 1 ? 36 ? 9WPP 1167 ? 1202 ? 1167 1202 3 1 9WPP C 1 ? 77 ? P0DTC2 912 ? 988 ? 912 988 4 2 9WPP D 1 ? 36 ? 9WPP 1167 ? 1202 ? 1167 1202 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA hexameric 6 2 author_and_software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 16640 ? 1 MORE -164 ? 1 'SSA (A^2)' 15200 ? 2 'ABSA (A^2)' 16970 ? 2 MORE -161 ? 2 'SSA (A^2)' 14210 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,4 A,B,E,F 2 1,3,5 C,D,G,H # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 2 'gel filtration' ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 46.0730000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 23.0365000000 -0.8660254038 -0.5000000000 0.0000000000 39.9003884286 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 3 ? GLU A 77 ? ASN A 914 GLU A 988 1 ? 75 HELX_P HELX_P2 AA2 ILE B 13 ? LEU B 27 ? ILE B 1179 LEU B 1193 1 ? 15 HELX_P HELX_P3 AA3 GLU B 28 ? LEU B 31 ? GLU B 1194 LEU B 1197 5 ? 4 HELX_P HELX_P4 AA4 VAL C 4 ? GLU C 77 ? VAL C 915 GLU C 988 1 ? 74 HELX_P HELX_P5 AA5 ILE D 13 ? LEU D 27 ? ILE D 1179 LEU D 1193 1 ? 15 HELX_P HELX_P6 AA6 GLU D 28 ? LEU D 31 ? GLU D 1194 LEU D 1197 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9WPP _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x+1/3,y+2/3,z+2/3 5 -y+1/3,x-y+2/3,z+2/3 6 -x+y+1/3,-x+2/3,z+2/3 7 x+2/3,y+1/3,z+1/3 8 -y+2/3,x-y+1/3,z+1/3 9 -x+y+2/3,-x+1/3,z+1/3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 912 ? A THR 1 2 1 Y 1 A GLN 913 ? A GLN 2 3 1 Y 1 B ILE 1167 ? B ILE 1 4 1 Y 1 B GLY 1168 ? B GLY 2 5 1 Y 1 B GLY 1201 ? B GLY 35 6 1 Y 1 B LYS 1202 ? B LYS 36 7 1 Y 1 C THR 912 ? C THR 1 8 1 Y 1 C GLN 913 ? C GLN 2 9 1 Y 1 D ILE 1167 ? D ILE 1 10 1 Y 1 D GLY 1168 ? D GLY 2 11 1 Y 1 D GLY 1201 ? D GLY 35 12 1 Y 1 D LYS 1202 ? D LYS 36 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 SER N N N N 218 SER CA C N S 219 SER C C N N 220 SER O O N N 221 SER CB C N N 222 SER OG O N N 223 SER OXT O N N 224 SER H H N N 225 SER H2 H N N 226 SER HA H N N 227 SER HB2 H N N 228 SER HB3 H N N 229 SER HG H N N 230 SER HXT H N N 231 THR N N N N 232 THR CA C N S 233 THR C C N N 234 THR O O N N 235 THR CB C N R 236 THR OG1 O N N 237 THR CG2 C N N 238 THR OXT O N N 239 THR H H N N 240 THR H2 H N N 241 THR HA H N N 242 THR HB H N N 243 THR HG1 H N N 244 THR HG21 H N N 245 THR HG22 H N N 246 THR HG23 H N N 247 THR HXT H N N 248 TYR N N N N 249 TYR CA C N S 250 TYR C C N N 251 TYR O O N N 252 TYR CB C N N 253 TYR CG C Y N 254 TYR CD1 C Y N 255 TYR CD2 C Y N 256 TYR CE1 C Y N 257 TYR CE2 C Y N 258 TYR CZ C Y N 259 TYR OH O N N 260 TYR OXT O N N 261 TYR H H N N 262 TYR H2 H N N 263 TYR HA H N N 264 TYR HB2 H N N 265 TYR HB3 H N N 266 TYR HD1 H N N 267 TYR HD2 H N N 268 TYR HE1 H N N 269 TYR HE2 H N N 270 TYR HH H N N 271 TYR HXT H N N 272 VAL N N N N 273 VAL CA C N S 274 VAL C C N N 275 VAL O O N N 276 VAL CB C N N 277 VAL CG1 C N N 278 VAL CG2 C N N 279 VAL OXT O N N 280 VAL H H N N 281 VAL H2 H N N 282 VAL HA H N N 283 VAL HB H N N 284 VAL HG11 H N N 285 VAL HG12 H N N 286 VAL HG13 H N N 287 VAL HG21 H N N 288 VAL HG22 H N N 289 VAL HG23 H N N 290 VAL HXT H N N 291 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 PHE N CA sing N N 184 PHE N H sing N N 185 PHE N H2 sing N N 186 PHE CA C sing N N 187 PHE CA CB sing N N 188 PHE CA HA sing N N 189 PHE C O doub N N 190 PHE C OXT sing N N 191 PHE CB CG sing N N 192 PHE CB HB2 sing N N 193 PHE CB HB3 sing N N 194 PHE CG CD1 doub Y N 195 PHE CG CD2 sing Y N 196 PHE CD1 CE1 sing Y N 197 PHE CD1 HD1 sing N N 198 PHE CD2 CE2 doub Y N 199 PHE CD2 HD2 sing N N 200 PHE CE1 CZ doub Y N 201 PHE CE1 HE1 sing N N 202 PHE CE2 CZ sing Y N 203 PHE CE2 HE2 sing N N 204 PHE CZ HZ sing N N 205 PHE OXT HXT sing N N 206 SER N CA sing N N 207 SER N H sing N N 208 SER N H2 sing N N 209 SER CA C sing N N 210 SER CA CB sing N N 211 SER CA HA sing N N 212 SER C O doub N N 213 SER C OXT sing N N 214 SER CB OG sing N N 215 SER CB HB2 sing N N 216 SER CB HB3 sing N N 217 SER OG HG sing N N 218 SER OXT HXT sing N N 219 THR N CA sing N N 220 THR N H sing N N 221 THR N H2 sing N N 222 THR CA C sing N N 223 THR CA CB sing N N 224 THR CA HA sing N N 225 THR C O doub N N 226 THR C OXT sing N N 227 THR CB OG1 sing N N 228 THR CB CG2 sing N N 229 THR CB HB sing N N 230 THR OG1 HG1 sing N N 231 THR CG2 HG21 sing N N 232 THR CG2 HG22 sing N N 233 THR CG2 HG23 sing N N 234 THR OXT HXT sing N N 235 TYR N CA sing N N 236 TYR N H sing N N 237 TYR N H2 sing N N 238 TYR CA C sing N N 239 TYR CA CB sing N N 240 TYR CA HA sing N N 241 TYR C O doub N N 242 TYR C OXT sing N N 243 TYR CB CG sing N N 244 TYR CB HB2 sing N N 245 TYR CB HB3 sing N N 246 TYR CG CD1 doub Y N 247 TYR CG CD2 sing Y N 248 TYR CD1 CE1 sing Y N 249 TYR CD1 HD1 sing N N 250 TYR CD2 CE2 doub Y N 251 TYR CD2 HD2 sing N N 252 TYR CE1 CZ doub Y N 253 TYR CE1 HE1 sing N N 254 TYR CE2 CZ sing Y N 255 TYR CE2 HE2 sing N N 256 TYR CZ OH sing N N 257 TYR OH HH sing N N 258 TYR OXT HXT sing N N 259 VAL N CA sing N N 260 VAL N H sing N N 261 VAL N H2 sing N N 262 VAL CA C sing N N 263 VAL CA CB sing N N 264 VAL CA HA sing N N 265 VAL C O doub N N 266 VAL C OXT sing N N 267 VAL CB CG1 sing N N 268 VAL CB CG2 sing N N 269 VAL CB HB sing N N 270 VAL CG1 HG11 sing N N 271 VAL CG1 HG12 sing N N 272 VAL CG1 HG13 sing N N 273 VAL CG2 HG21 sing N N 274 VAL CG2 HG22 sing N N 275 VAL CG2 HG23 sing N N 276 VAL OXT HXT sing N N 277 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6lxt _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'R 3 :H' _space_group.name_Hall 'R 3' _space_group.IT_number 146 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9WPP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021705 _atom_sites.fract_transf_matrix[1][2] 0.012531 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025062 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003228 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #