data_9WS5 # _entry.id 9WS5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9WS5 pdb_00009ws5 10.2210/pdb9ws5/pdb WWPDB D_1300063587 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9WS5 _pdbx_database_status.recvd_initial_deposition_date 2025-09-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 zhixinwang@mail.tsinghua.edu.cn Zhi-Xin Wang ? 'principal investigator/group leader' 0000-0003-4656-2941 3 jiaweiwu@suda.edu.cn Jia-Wei Wu ? 'principal investigator/group leader' 0000-0003-0273-1686 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, F.Y.' 1 ? 'Hu, H.-F.' 2 ? 'Wang, J.' 3 ? 'Luo, Z.P.' 4 ? 'Wu, J.-W.' 5 ? 'Wang, Z.-X.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Kinetic and structural insights into the autoactivation of PAK2 kinase domain: A research paradigm for studying self-activating enzyme ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, F.Y.' 1 ? primary 'Hu, H.-F.' 2 ? primary 'Wang, J.' 3 ? primary 'Luo, Z.P.' 4 ? primary 'Wu, J.-W.' 5 ? primary 'Wang, Z.-X.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PAK-2p34 36234.871 1 ? D368N ? ? 2 non-polymer syn 'CITRIC ACID' 192.124 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Serine/threonine-protein kinase PAK 2,p34,C-t-PAK2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSQDLEVLFQGPHMADLTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQIN LQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHA NQVIHRNIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEP PYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMK SNR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSQDLEVLFQGPHMADLTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQIN LQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHA NQVIHRNIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEP PYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMK SNR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CITRIC ACID' CIT 3 'SULFATE ION' SO4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLN n 1 13 ASP n 1 14 LEU n 1 15 GLU n 1 16 VAL n 1 17 LEU n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 PRO n 1 22 HIS n 1 23 MET n 1 24 ALA n 1 25 ASP n 1 26 LEU n 1 27 THR n 1 28 ASP n 1 29 GLU n 1 30 GLU n 1 31 ILE n 1 32 MET n 1 33 GLU n 1 34 LYS n 1 35 LEU n 1 36 ARG n 1 37 THR n 1 38 ILE n 1 39 VAL n 1 40 SER n 1 41 ILE n 1 42 GLY n 1 43 ASP n 1 44 PRO n 1 45 LYS n 1 46 LYS n 1 47 LYS n 1 48 TYR n 1 49 THR n 1 50 ARG n 1 51 TYR n 1 52 GLU n 1 53 LYS n 1 54 ILE n 1 55 GLY n 1 56 GLN n 1 57 GLY n 1 58 ALA n 1 59 SER n 1 60 GLY n 1 61 THR n 1 62 VAL n 1 63 PHE n 1 64 THR n 1 65 ALA n 1 66 THR n 1 67 ASP n 1 68 VAL n 1 69 ALA n 1 70 LEU n 1 71 GLY n 1 72 GLN n 1 73 GLU n 1 74 VAL n 1 75 ALA n 1 76 ILE n 1 77 LYS n 1 78 GLN n 1 79 ILE n 1 80 ASN n 1 81 LEU n 1 82 GLN n 1 83 LYS n 1 84 GLN n 1 85 PRO n 1 86 LYS n 1 87 LYS n 1 88 GLU n 1 89 LEU n 1 90 ILE n 1 91 ILE n 1 92 ASN n 1 93 GLU n 1 94 ILE n 1 95 LEU n 1 96 VAL n 1 97 MET n 1 98 LYS n 1 99 GLU n 1 100 LEU n 1 101 LYS n 1 102 ASN n 1 103 PRO n 1 104 ASN n 1 105 ILE n 1 106 VAL n 1 107 ASN n 1 108 PHE n 1 109 LEU n 1 110 ASP n 1 111 SER n 1 112 TYR n 1 113 LEU n 1 114 VAL n 1 115 GLY n 1 116 ASP n 1 117 GLU n 1 118 LEU n 1 119 PHE n 1 120 VAL n 1 121 VAL n 1 122 MET n 1 123 GLU n 1 124 TYR n 1 125 LEU n 1 126 ALA n 1 127 GLY n 1 128 GLY n 1 129 SER n 1 130 LEU n 1 131 THR n 1 132 ASP n 1 133 VAL n 1 134 VAL n 1 135 THR n 1 136 GLU n 1 137 THR n 1 138 CYS n 1 139 MET n 1 140 ASP n 1 141 GLU n 1 142 ALA n 1 143 GLN n 1 144 ILE n 1 145 ALA n 1 146 ALA n 1 147 VAL n 1 148 CYS n 1 149 ARG n 1 150 GLU n 1 151 CYS n 1 152 LEU n 1 153 GLN n 1 154 ALA n 1 155 LEU n 1 156 GLU n 1 157 PHE n 1 158 LEU n 1 159 HIS n 1 160 ALA n 1 161 ASN n 1 162 GLN n 1 163 VAL n 1 164 ILE n 1 165 HIS n 1 166 ARG n 1 167 ASN n 1 168 ILE n 1 169 LYS n 1 170 SER n 1 171 ASP n 1 172 ASN n 1 173 VAL n 1 174 LEU n 1 175 LEU n 1 176 GLY n 1 177 MET n 1 178 GLU n 1 179 GLY n 1 180 SER n 1 181 VAL n 1 182 LYS n 1 183 LEU n 1 184 THR n 1 185 ASP n 1 186 PHE n 1 187 GLY n 1 188 PHE n 1 189 CYS n 1 190 ALA n 1 191 GLN n 1 192 ILE n 1 193 THR n 1 194 PRO n 1 195 GLU n 1 196 GLN n 1 197 SER n 1 198 LYS n 1 199 ARG n 1 200 SER n 1 201 THR n 1 202 MET n 1 203 VAL n 1 204 GLY n 1 205 THR n 1 206 PRO n 1 207 TYR n 1 208 TRP n 1 209 MET n 1 210 ALA n 1 211 PRO n 1 212 GLU n 1 213 VAL n 1 214 VAL n 1 215 THR n 1 216 ARG n 1 217 LYS n 1 218 ALA n 1 219 TYR n 1 220 GLY n 1 221 PRO n 1 222 LYS n 1 223 VAL n 1 224 ASP n 1 225 ILE n 1 226 TRP n 1 227 SER n 1 228 LEU n 1 229 GLY n 1 230 ILE n 1 231 MET n 1 232 ALA n 1 233 ILE n 1 234 GLU n 1 235 MET n 1 236 VAL n 1 237 GLU n 1 238 GLY n 1 239 GLU n 1 240 PRO n 1 241 PRO n 1 242 TYR n 1 243 LEU n 1 244 ASN n 1 245 GLU n 1 246 ASN n 1 247 PRO n 1 248 LEU n 1 249 ARG n 1 250 ALA n 1 251 LEU n 1 252 TYR n 1 253 LEU n 1 254 ILE n 1 255 ALA n 1 256 THR n 1 257 ASN n 1 258 GLY n 1 259 THR n 1 260 PRO n 1 261 GLU n 1 262 LEU n 1 263 GLN n 1 264 ASN n 1 265 PRO n 1 266 GLU n 1 267 LYS n 1 268 LEU n 1 269 SER n 1 270 PRO n 1 271 ILE n 1 272 PHE n 1 273 ARG n 1 274 ASP n 1 275 PHE n 1 276 LEU n 1 277 ASN n 1 278 ARG n 1 279 CYS n 1 280 LEU n 1 281 GLU n 1 282 MET n 1 283 ASP n 1 284 VAL n 1 285 GLU n 1 286 LYS n 1 287 ARG n 1 288 GLY n 1 289 SER n 1 290 ALA n 1 291 LYS n 1 292 GLU n 1 293 LEU n 1 294 LEU n 1 295 GLN n 1 296 HIS n 1 297 PRO n 1 298 PHE n 1 299 LEU n 1 300 LYS n 1 301 LEU n 1 302 ALA n 1 303 LYS n 1 304 PRO n 1 305 LEU n 1 306 SER n 1 307 SER n 1 308 LEU n 1 309 THR n 1 310 PRO n 1 311 LEU n 1 312 ILE n 1 313 MET n 1 314 ALA n 1 315 ALA n 1 316 LYS n 1 317 GLU n 1 318 ALA n 1 319 MET n 1 320 LYS n 1 321 SER n 1 322 ASN n 1 323 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 323 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PAK2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 202 ? ? ? A . n A 1 2 GLY 2 203 ? ? ? A . n A 1 3 SER 3 204 ? ? ? A . n A 1 4 SER 4 205 ? ? ? A . n A 1 5 HIS 5 206 ? ? ? A . n A 1 6 HIS 6 207 ? ? ? A . n A 1 7 HIS 7 208 ? ? ? A . n A 1 8 HIS 8 209 ? ? ? A . n A 1 9 HIS 9 210 ? ? ? A . n A 1 10 HIS 10 211 ? ? ? A . n A 1 11 SER 11 212 ? ? ? A . n A 1 12 GLN 12 213 ? ? ? A . n A 1 13 ASP 13 214 ? ? ? A . n A 1 14 LEU 14 215 ? ? ? A . n A 1 15 GLU 15 216 ? ? ? A . n A 1 16 VAL 16 217 ? ? ? A . n A 1 17 LEU 17 218 ? ? ? A . n A 1 18 PHE 18 219 ? ? ? A . n A 1 19 GLN 19 220 ? ? ? A . n A 1 20 GLY 20 221 ? ? ? A . n A 1 21 PRO 21 222 ? ? ? A . n A 1 22 HIS 22 223 ? ? ? A . n A 1 23 MET 23 224 ? ? ? A . n A 1 24 ALA 24 225 ? ? ? A . n A 1 25 ASP 25 226 226 ASP ASP A . n A 1 26 LEU 26 227 227 LEU LEU A . n A 1 27 THR 27 228 228 THR THR A . n A 1 28 ASP 28 229 229 ASP ASP A . n A 1 29 GLU 29 230 230 GLU GLU A . n A 1 30 GLU 30 231 231 GLU GLU A . n A 1 31 ILE 31 232 232 ILE ILE A . n A 1 32 MET 32 233 233 MET MET A . n A 1 33 GLU 33 234 234 GLU GLU A . n A 1 34 LYS 34 235 235 LYS LYS A . n A 1 35 LEU 35 236 236 LEU LEU A . n A 1 36 ARG 36 237 237 ARG ARG A . n A 1 37 THR 37 238 238 THR THR A . n A 1 38 ILE 38 239 239 ILE ILE A . n A 1 39 VAL 39 240 240 VAL VAL A . n A 1 40 SER 40 241 241 SER SER A . n A 1 41 ILE 41 242 242 ILE ILE A . n A 1 42 GLY 42 243 243 GLY GLY A . n A 1 43 ASP 43 244 244 ASP ASP A . n A 1 44 PRO 44 245 245 PRO PRO A . n A 1 45 LYS 45 246 246 LYS LYS A . n A 1 46 LYS 46 247 247 LYS LYS A . n A 1 47 LYS 47 248 248 LYS LYS A . n A 1 48 TYR 48 249 249 TYR TYR A . n A 1 49 THR 49 250 250 THR THR A . n A 1 50 ARG 50 251 251 ARG ARG A . n A 1 51 TYR 51 252 252 TYR TYR A . n A 1 52 GLU 52 253 253 GLU GLU A . n A 1 53 LYS 53 254 254 LYS LYS A . n A 1 54 ILE 54 255 255 ILE ILE A . n A 1 55 GLY 55 256 256 GLY GLY A . n A 1 56 GLN 56 257 257 GLN GLN A . n A 1 57 GLY 57 258 258 GLY GLY A . n A 1 58 ALA 58 259 259 ALA ALA A . n A 1 59 SER 59 260 260 SER SER A . n A 1 60 GLY 60 261 261 GLY GLY A . n A 1 61 THR 61 262 262 THR THR A . n A 1 62 VAL 62 263 263 VAL VAL A . n A 1 63 PHE 63 264 264 PHE PHE A . n A 1 64 THR 64 265 265 THR THR A . n A 1 65 ALA 65 266 266 ALA ALA A . n A 1 66 THR 66 267 267 THR THR A . n A 1 67 ASP 67 268 268 ASP ASP A . n A 1 68 VAL 68 269 269 VAL VAL A . n A 1 69 ALA 69 270 270 ALA ALA A . n A 1 70 LEU 70 271 271 LEU LEU A . n A 1 71 GLY 71 272 272 GLY GLY A . n A 1 72 GLN 72 273 273 GLN GLN A . n A 1 73 GLU 73 274 274 GLU GLU A . n A 1 74 VAL 74 275 275 VAL VAL A . n A 1 75 ALA 75 276 276 ALA ALA A . n A 1 76 ILE 76 277 277 ILE ILE A . n A 1 77 LYS 77 278 278 LYS LYS A . n A 1 78 GLN 78 279 279 GLN GLN A . n A 1 79 ILE 79 280 280 ILE ILE A . n A 1 80 ASN 80 281 281 ASN ASN A . n A 1 81 LEU 81 282 282 LEU LEU A . n A 1 82 GLN 82 283 283 GLN GLN A . n A 1 83 LYS 83 284 284 LYS LYS A . n A 1 84 GLN 84 285 285 GLN GLN A . n A 1 85 PRO 85 286 286 PRO PRO A . n A 1 86 LYS 86 287 287 LYS LYS A . n A 1 87 LYS 87 288 288 LYS LYS A . n A 1 88 GLU 88 289 289 GLU GLU A . n A 1 89 LEU 89 290 290 LEU LEU A . n A 1 90 ILE 90 291 291 ILE ILE A . n A 1 91 ILE 91 292 292 ILE ILE A . n A 1 92 ASN 92 293 293 ASN ASN A . n A 1 93 GLU 93 294 294 GLU GLU A . n A 1 94 ILE 94 295 295 ILE ILE A . n A 1 95 LEU 95 296 296 LEU LEU A . n A 1 96 VAL 96 297 297 VAL VAL A . n A 1 97 MET 97 298 298 MET MET A . n A 1 98 LYS 98 299 299 LYS LYS A . n A 1 99 GLU 99 300 300 GLU GLU A . n A 1 100 LEU 100 301 301 LEU LEU A . n A 1 101 LYS 101 302 302 LYS LYS A . n A 1 102 ASN 102 303 303 ASN ASN A . n A 1 103 PRO 103 304 304 PRO PRO A . n A 1 104 ASN 104 305 305 ASN ASN A . n A 1 105 ILE 105 306 306 ILE ILE A . n A 1 106 VAL 106 307 307 VAL VAL A . n A 1 107 ASN 107 308 308 ASN ASN A . n A 1 108 PHE 108 309 309 PHE PHE A . n A 1 109 LEU 109 310 310 LEU LEU A . n A 1 110 ASP 110 311 311 ASP ASP A . n A 1 111 SER 111 312 312 SER SER A . n A 1 112 TYR 112 313 313 TYR TYR A . n A 1 113 LEU 113 314 314 LEU LEU A . n A 1 114 VAL 114 315 315 VAL VAL A . n A 1 115 GLY 115 316 316 GLY GLY A . n A 1 116 ASP 116 317 317 ASP ASP A . n A 1 117 GLU 117 318 318 GLU GLU A . n A 1 118 LEU 118 319 319 LEU LEU A . n A 1 119 PHE 119 320 320 PHE PHE A . n A 1 120 VAL 120 321 321 VAL VAL A . n A 1 121 VAL 121 322 322 VAL VAL A . n A 1 122 MET 122 323 323 MET MET A . n A 1 123 GLU 123 324 324 GLU GLU A . n A 1 124 TYR 124 325 325 TYR TYR A . n A 1 125 LEU 125 326 326 LEU LEU A . n A 1 126 ALA 126 327 327 ALA ALA A . n A 1 127 GLY 127 328 328 GLY GLY A . n A 1 128 GLY 128 329 329 GLY GLY A . n A 1 129 SER 129 330 330 SER SER A . n A 1 130 LEU 130 331 331 LEU LEU A . n A 1 131 THR 131 332 332 THR THR A . n A 1 132 ASP 132 333 333 ASP ASP A . n A 1 133 VAL 133 334 334 VAL VAL A . n A 1 134 VAL 134 335 335 VAL VAL A . n A 1 135 THR 135 336 336 THR THR A . n A 1 136 GLU 136 337 337 GLU GLU A . n A 1 137 THR 137 338 338 THR THR A . n A 1 138 CYS 138 339 339 CYS CYS A . n A 1 139 MET 139 340 340 MET MET A . n A 1 140 ASP 140 341 341 ASP ASP A . n A 1 141 GLU 141 342 342 GLU GLU A . n A 1 142 ALA 142 343 343 ALA ALA A . n A 1 143 GLN 143 344 344 GLN GLN A . n A 1 144 ILE 144 345 345 ILE ILE A . n A 1 145 ALA 145 346 346 ALA ALA A . n A 1 146 ALA 146 347 347 ALA ALA A . n A 1 147 VAL 147 348 348 VAL VAL A . n A 1 148 CYS 148 349 349 CYS CYS A . n A 1 149 ARG 149 350 350 ARG ARG A . n A 1 150 GLU 150 351 351 GLU GLU A . n A 1 151 CYS 151 352 352 CYS CYS A . n A 1 152 LEU 152 353 353 LEU LEU A . n A 1 153 GLN 153 354 354 GLN GLN A . n A 1 154 ALA 154 355 355 ALA ALA A . n A 1 155 LEU 155 356 356 LEU LEU A . n A 1 156 GLU 156 357 357 GLU GLU A . n A 1 157 PHE 157 358 358 PHE PHE A . n A 1 158 LEU 158 359 359 LEU LEU A . n A 1 159 HIS 159 360 360 HIS HIS A . n A 1 160 ALA 160 361 361 ALA ALA A . n A 1 161 ASN 161 362 362 ASN ASN A . n A 1 162 GLN 162 363 363 GLN GLN A . n A 1 163 VAL 163 364 364 VAL VAL A . n A 1 164 ILE 164 365 365 ILE ILE A . n A 1 165 HIS 165 366 366 HIS HIS A . n A 1 166 ARG 166 367 367 ARG ARG A . n A 1 167 ASN 167 368 368 ASN ASN A . n A 1 168 ILE 168 369 369 ILE ILE A . n A 1 169 LYS 169 370 370 LYS LYS A . n A 1 170 SER 170 371 371 SER SER A . n A 1 171 ASP 171 372 372 ASP ASP A . n A 1 172 ASN 172 373 373 ASN ASN A . n A 1 173 VAL 173 374 374 VAL VAL A . n A 1 174 LEU 174 375 375 LEU LEU A . n A 1 175 LEU 175 376 376 LEU LEU A . n A 1 176 GLY 176 377 377 GLY GLY A . n A 1 177 MET 177 378 378 MET MET A . n A 1 178 GLU 178 379 379 GLU GLU A . n A 1 179 GLY 179 380 380 GLY GLY A . n A 1 180 SER 180 381 381 SER SER A . n A 1 181 VAL 181 382 382 VAL VAL A . n A 1 182 LYS 182 383 383 LYS LYS A . n A 1 183 LEU 183 384 384 LEU LEU A . n A 1 184 THR 184 385 385 THR THR A . n A 1 185 ASP 185 386 386 ASP ASP A . n A 1 186 PHE 186 387 387 PHE PHE A . n A 1 187 GLY 187 388 388 GLY GLY A . n A 1 188 PHE 188 389 389 PHE PHE A . n A 1 189 CYS 189 390 390 CYS CYS A . n A 1 190 ALA 190 391 391 ALA ALA A . n A 1 191 GLN 191 392 392 GLN GLN A . n A 1 192 ILE 192 393 393 ILE ILE A . n A 1 193 THR 193 394 ? ? ? A . n A 1 194 PRO 194 395 ? ? ? A . n A 1 195 GLU 195 396 ? ? ? A . n A 1 196 GLN 196 397 ? ? ? A . n A 1 197 SER 197 398 ? ? ? A . n A 1 198 LYS 198 399 ? ? ? A . n A 1 199 ARG 199 400 ? ? ? A . n A 1 200 SER 200 401 ? ? ? A . n A 1 201 THR 201 402 ? ? ? A . n A 1 202 MET 202 403 ? ? ? A . n A 1 203 VAL 203 404 ? ? ? A . n A 1 204 GLY 204 405 ? ? ? A . n A 1 205 THR 205 406 ? ? ? A . n A 1 206 PRO 206 407 ? ? ? A . n A 1 207 TYR 207 408 ? ? ? A . n A 1 208 TRP 208 409 ? ? ? A . n A 1 209 MET 209 410 ? ? ? A . n A 1 210 ALA 210 411 ? ? ? A . n A 1 211 PRO 211 412 ? ? ? A . n A 1 212 GLU 212 413 ? ? ? A . n A 1 213 VAL 213 414 ? ? ? A . n A 1 214 VAL 214 415 ? ? ? A . n A 1 215 THR 215 416 ? ? ? A . n A 1 216 ARG 216 417 ? ? ? A . n A 1 217 LYS 217 418 ? ? ? A . n A 1 218 ALA 218 419 ? ? ? A . n A 1 219 TYR 219 420 ? ? ? A . n A 1 220 GLY 220 421 421 GLY GLY A . n A 1 221 PRO 221 422 422 PRO PRO A . n A 1 222 LYS 222 423 423 LYS LYS A . n A 1 223 VAL 223 424 424 VAL VAL A . n A 1 224 ASP 224 425 425 ASP ASP A . n A 1 225 ILE 225 426 426 ILE ILE A . n A 1 226 TRP 226 427 427 TRP TRP A . n A 1 227 SER 227 428 428 SER SER A . n A 1 228 LEU 228 429 429 LEU LEU A . n A 1 229 GLY 229 430 430 GLY GLY A . n A 1 230 ILE 230 431 431 ILE ILE A . n A 1 231 MET 231 432 432 MET MET A . n A 1 232 ALA 232 433 433 ALA ALA A . n A 1 233 ILE 233 434 434 ILE ILE A . n A 1 234 GLU 234 435 435 GLU GLU A . n A 1 235 MET 235 436 436 MET MET A . n A 1 236 VAL 236 437 437 VAL VAL A . n A 1 237 GLU 237 438 438 GLU GLU A . n A 1 238 GLY 238 439 439 GLY GLY A . n A 1 239 GLU 239 440 440 GLU GLU A . n A 1 240 PRO 240 441 441 PRO PRO A . n A 1 241 PRO 241 442 442 PRO PRO A . n A 1 242 TYR 242 443 443 TYR TYR A . n A 1 243 LEU 243 444 444 LEU LEU A . n A 1 244 ASN 244 445 445 ASN ASN A . n A 1 245 GLU 245 446 446 GLU GLU A . n A 1 246 ASN 246 447 447 ASN ASN A . n A 1 247 PRO 247 448 448 PRO PRO A . n A 1 248 LEU 248 449 449 LEU LEU A . n A 1 249 ARG 249 450 450 ARG ARG A . n A 1 250 ALA 250 451 451 ALA ALA A . n A 1 251 LEU 251 452 452 LEU LEU A . n A 1 252 TYR 252 453 453 TYR TYR A . n A 1 253 LEU 253 454 454 LEU LEU A . n A 1 254 ILE 254 455 455 ILE ILE A . n A 1 255 ALA 255 456 456 ALA ALA A . n A 1 256 THR 256 457 457 THR THR A . n A 1 257 ASN 257 458 458 ASN ASN A . n A 1 258 GLY 258 459 459 GLY GLY A . n A 1 259 THR 259 460 460 THR THR A . n A 1 260 PRO 260 461 461 PRO PRO A . n A 1 261 GLU 261 462 462 GLU GLU A . n A 1 262 LEU 262 463 463 LEU LEU A . n A 1 263 GLN 263 464 464 GLN GLN A . n A 1 264 ASN 264 465 465 ASN ASN A . n A 1 265 PRO 265 466 466 PRO PRO A . n A 1 266 GLU 266 467 467 GLU GLU A . n A 1 267 LYS 267 468 468 LYS LYS A . n A 1 268 LEU 268 469 469 LEU LEU A . n A 1 269 SER 269 470 470 SER SER A . n A 1 270 PRO 270 471 471 PRO PRO A . n A 1 271 ILE 271 472 472 ILE ILE A . n A 1 272 PHE 272 473 473 PHE PHE A . n A 1 273 ARG 273 474 474 ARG ARG A . n A 1 274 ASP 274 475 475 ASP ASP A . n A 1 275 PHE 275 476 476 PHE PHE A . n A 1 276 LEU 276 477 477 LEU LEU A . n A 1 277 ASN 277 478 478 ASN ASN A . n A 1 278 ARG 278 479 479 ARG ARG A . n A 1 279 CYS 279 480 480 CYS CYS A . n A 1 280 LEU 280 481 481 LEU LEU A . n A 1 281 GLU 281 482 482 GLU GLU A . n A 1 282 MET 282 483 483 MET MET A . n A 1 283 ASP 283 484 484 ASP ASP A . n A 1 284 VAL 284 485 485 VAL VAL A . n A 1 285 GLU 285 486 486 GLU GLU A . n A 1 286 LYS 286 487 487 LYS LYS A . n A 1 287 ARG 287 488 488 ARG ARG A . n A 1 288 GLY 288 489 489 GLY GLY A . n A 1 289 SER 289 490 490 SER SER A . n A 1 290 ALA 290 491 491 ALA ALA A . n A 1 291 LYS 291 492 492 LYS LYS A . n A 1 292 GLU 292 493 493 GLU GLU A . n A 1 293 LEU 293 494 494 LEU LEU A . n A 1 294 LEU 294 495 495 LEU LEU A . n A 1 295 GLN 295 496 496 GLN GLN A . n A 1 296 HIS 296 497 497 HIS HIS A . n A 1 297 PRO 297 498 498 PRO PRO A . n A 1 298 PHE 298 499 499 PHE PHE A . n A 1 299 LEU 299 500 500 LEU LEU A . n A 1 300 LYS 300 501 501 LYS LYS A . n A 1 301 LEU 301 502 502 LEU LEU A . n A 1 302 ALA 302 503 503 ALA ALA A . n A 1 303 LYS 303 504 504 LYS LYS A . n A 1 304 PRO 304 505 505 PRO PRO A . n A 1 305 LEU 305 506 506 LEU LEU A . n A 1 306 SER 306 507 507 SER SER A . n A 1 307 SER 307 508 508 SER SER A . n A 1 308 LEU 308 509 509 LEU LEU A . n A 1 309 THR 309 510 510 THR THR A . n A 1 310 PRO 310 511 511 PRO PRO A . n A 1 311 LEU 311 512 512 LEU LEU A . n A 1 312 ILE 312 513 513 ILE ILE A . n A 1 313 MET 313 514 514 MET MET A . n A 1 314 ALA 314 515 515 ALA ALA A . n A 1 315 ALA 315 516 516 ALA ALA A . n A 1 316 LYS 316 517 517 LYS LYS A . n A 1 317 GLU 317 518 518 GLU GLU A . n A 1 318 ALA 318 519 519 ALA ALA A . n A 1 319 MET 319 520 520 MET MET A . n A 1 320 LYS 320 521 521 LYS LYS A . n A 1 321 SER 321 522 522 SER SER A . n A 1 322 ASN 322 523 ? ? ? A . n A 1 323 ARG 323 524 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CIT 1 601 1 CIT CIT A . C 2 CIT 1 602 2 CIT CIT A . D 3 SO4 1 603 1 SO4 SO4 A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 449 ? CG ? A LEU 248 CG 2 1 Y 1 A LEU 449 ? CD1 ? A LEU 248 CD1 3 1 Y 1 A LEU 449 ? CD2 ? A LEU 248 CD2 4 1 Y 1 A TYR 453 ? CG ? A TYR 252 CG 5 1 Y 1 A TYR 453 ? CD1 ? A TYR 252 CD1 6 1 Y 1 A TYR 453 ? CD2 ? A TYR 252 CD2 7 1 Y 1 A TYR 453 ? CE1 ? A TYR 252 CE1 8 1 Y 1 A TYR 453 ? CE2 ? A TYR 252 CE2 9 1 Y 1 A TYR 453 ? CZ ? A TYR 252 CZ 10 1 Y 1 A TYR 453 ? OH ? A TYR 252 OH 11 1 Y 1 A LEU 454 ? CG ? A LEU 253 CG 12 1 Y 1 A LEU 454 ? CD1 ? A LEU 253 CD1 13 1 Y 1 A LEU 454 ? CD2 ? A LEU 253 CD2 14 1 Y 1 A ILE 455 ? CG1 ? A ILE 254 CG1 15 1 Y 1 A ILE 455 ? CG2 ? A ILE 254 CG2 16 1 Y 1 A ILE 455 ? CD1 ? A ILE 254 CD1 17 1 Y 1 A THR 457 ? OG1 ? A THR 256 OG1 18 1 Y 1 A THR 457 ? CG2 ? A THR 256 CG2 19 1 Y 1 A ASN 458 ? CG ? A ASN 257 CG 20 1 Y 1 A ASN 458 ? OD1 ? A ASN 257 OD1 21 1 Y 1 A ASN 458 ? ND2 ? A ASN 257 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9WS5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.529 _cell.length_a_esd ? _cell.length_b 97.529 _cell.length_b_esd ? _cell.length_c 144.962 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9WS5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9WS5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Na citrate, pH 6.5, 0.65 M Li2SO4, 0.3 M (NH4)2SO4' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-01 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9WS5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.40 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16624 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.124 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.117 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1631 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.678 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.744 _reflns_shell.pdbx_CC_star 0.924 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -3.698 _refine.aniso_B[1][2] -1.849 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -3.698 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 11.997 _refine.B_iso_max ? _refine.B_iso_mean 82.772 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.941 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9WS5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 46.219 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16599 _refine.ls_number_reflns_R_free 803 _refine.ls_number_reflns_R_work 15796 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.772 _refine.ls_percent_reflns_R_free 4.838 _refine.ls_R_factor_all 0.243 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2628 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2425 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.318 _refine.pdbx_overall_ESU_R_Free 0.235 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 13.582 _refine.overall_SU_ML 0.276 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2084 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2115 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 46.219 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 2142 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2103 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.635 1.837 2894 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.520 1.759 4868 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.694 5.000 268 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.135 5.000 8 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.475 10.000 402 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 14.032 10.000 87 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.071 0.200 338 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2428 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 418 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.240 0.200 475 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.203 0.200 1956 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.186 0.200 1063 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.079 0.200 1146 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 44 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.066 0.200 3 ? r_symmetry_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.327 0.200 13 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.238 0.200 63 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.119 0.200 2 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 8.753 8.119 1078 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 8.725 8.117 1078 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 13.110 14.565 1344 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 13.105 14.566 1345 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 9.165 8.742 1064 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 9.008 8.728 1057 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 14.248 15.808 1550 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 14.269 15.789 1545 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 21.072 96.375 8886 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 21.072 96.372 8887 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.40 2.460 . . 56 1122 98.3306 . . . . 0.437 . . . . . . . . . . . . . . . 0.554 'X-RAY DIFFRACTION' 2.460 2.527 . . 46 1115 100.0000 . . . . 0.404 . . . . . . . . . . . . . . . 0.432 'X-RAY DIFFRACTION' 2.527 2.600 . . 57 1073 100.0000 . . . . 0.385 . . . . . . . . . . . . . . . 0.452 'X-RAY DIFFRACTION' 2.600 2.680 . . 63 1047 99.9100 . . . . 0.372 . . . . . . . . . . . . . . . 0.450 'X-RAY DIFFRACTION' 2.680 2.768 . . 42 1029 100.0000 . . . . 0.307 . . . . . . . . . . . . . . . 0.343 'X-RAY DIFFRACTION' 2.768 2.865 . . 53 994 100.0000 . . . . 0.288 . . . . . . . . . . . . . . . 0.396 'X-RAY DIFFRACTION' 2.865 2.972 . . 57 942 100.0000 . . . . 0.254 . . . . . . . . . . . . . . . 0.270 'X-RAY DIFFRACTION' 2.972 3.093 . . 48 911 100.0000 . . . . 0.244 . . . . . . . . . . . . . . . 0.282 'X-RAY DIFFRACTION' 3.093 3.230 . . 35 911 100.0000 . . . . 0.231 . . . . . . . . . . . . . . . 0.357 'X-RAY DIFFRACTION' 3.230 3.387 . . 36 851 100.0000 . . . . 0.242 . . . . . . . . . . . . . . . 0.294 'X-RAY DIFFRACTION' 3.387 3.569 . . 49 807 100.0000 . . . . 0.226 . . . . . . . . . . . . . . . 0.239 'X-RAY DIFFRACTION' 3.569 3.784 . . 33 781 100.0000 . . . . 0.191 . . . . . . . . . . . . . . . 0.215 'X-RAY DIFFRACTION' 3.784 4.043 . . 47 733 99.8720 . . . . 0.206 . . . . . . . . . . . . . . . 0.226 'X-RAY DIFFRACTION' 4.043 4.365 . . 35 677 99.8597 . . . . 0.186 . . . . . . . . . . . . . . . 0.225 'X-RAY DIFFRACTION' 4.365 4.777 . . 30 634 100.0000 . . . . 0.195 . . . . . . . . . . . . . . . 0.260 'X-RAY DIFFRACTION' 4.777 5.334 . . 37 578 100.0000 . . . . 0.221 . . . . . . . . . . . . . . . 0.199 'X-RAY DIFFRACTION' 5.334 6.145 . . 32 526 100.0000 . . . . 0.285 . . . . . . . . . . . . . . . 0.260 'X-RAY DIFFRACTION' 6.145 7.493 . . 22 452 100.0000 . . . . 0.253 . . . . . . . . . . . . . . . 0.274 'X-RAY DIFFRACTION' 7.493 10.460 . . 15 372 98.9770 . . . . 0.190 . . . . . . . . . . . . . . . 0.173 'X-RAY DIFFRACTION' 10.460 46.219 . . 10 242 97.6744 . . . . 0.271 . . . . . . . . . . . . . . . 0.215 # _struct.entry_id 9WS5 _struct.title 'Crystal structure of PAK2 kinase domain containing D368N mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9WS5 _struct_keywords.text 'kinase fold, inactive conformation, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PAK2_HUMAN _struct_ref.pdbx_db_accession Q13177 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIV NFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDF GFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPE KLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR ; _struct_ref.pdbx_align_begin 228 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9WS5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 27 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 323 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13177 _struct_ref_seq.db_align_beg 228 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 524 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 228 _struct_ref_seq.pdbx_auth_seq_align_end 524 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9WS5 MET A 1 ? UNP Q13177 ? ? 'initiating methionine' 202 1 1 9WS5 GLY A 2 ? UNP Q13177 ? ? 'expression tag' 203 2 1 9WS5 SER A 3 ? UNP Q13177 ? ? 'expression tag' 204 3 1 9WS5 SER A 4 ? UNP Q13177 ? ? 'expression tag' 205 4 1 9WS5 HIS A 5 ? UNP Q13177 ? ? 'expression tag' 206 5 1 9WS5 HIS A 6 ? UNP Q13177 ? ? 'expression tag' 207 6 1 9WS5 HIS A 7 ? UNP Q13177 ? ? 'expression tag' 208 7 1 9WS5 HIS A 8 ? UNP Q13177 ? ? 'expression tag' 209 8 1 9WS5 HIS A 9 ? UNP Q13177 ? ? 'expression tag' 210 9 1 9WS5 HIS A 10 ? UNP Q13177 ? ? 'expression tag' 211 10 1 9WS5 SER A 11 ? UNP Q13177 ? ? 'expression tag' 212 11 1 9WS5 GLN A 12 ? UNP Q13177 ? ? 'expression tag' 213 12 1 9WS5 ASP A 13 ? UNP Q13177 ? ? 'expression tag' 214 13 1 9WS5 LEU A 14 ? UNP Q13177 ? ? 'expression tag' 215 14 1 9WS5 GLU A 15 ? UNP Q13177 ? ? 'expression tag' 216 15 1 9WS5 VAL A 16 ? UNP Q13177 ? ? 'expression tag' 217 16 1 9WS5 LEU A 17 ? UNP Q13177 ? ? 'expression tag' 218 17 1 9WS5 PHE A 18 ? UNP Q13177 ? ? 'expression tag' 219 18 1 9WS5 GLN A 19 ? UNP Q13177 ? ? 'expression tag' 220 19 1 9WS5 GLY A 20 ? UNP Q13177 ? ? 'expression tag' 221 20 1 9WS5 PRO A 21 ? UNP Q13177 ? ? 'expression tag' 222 21 1 9WS5 HIS A 22 ? UNP Q13177 ? ? 'expression tag' 223 22 1 9WS5 MET A 23 ? UNP Q13177 ? ? 'expression tag' 224 23 1 9WS5 ALA A 24 ? UNP Q13177 ? ? 'expression tag' 225 24 1 9WS5 ASP A 25 ? UNP Q13177 ? ? 'expression tag' 226 25 1 9WS5 LEU A 26 ? UNP Q13177 ? ? 'expression tag' 227 26 1 9WS5 ASN A 167 ? UNP Q13177 ASP 368 'engineered mutation' 368 27 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 70 ? 1 MORE -4 ? 1 'SSA (A^2)' 13420 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 27 ? ARG A 36 ? THR A 228 ARG A 237 1 ? 10 HELX_P HELX_P2 AA2 ASP A 43 ? LYS A 47 ? ASP A 244 LYS A 248 1 ? 5 HELX_P HELX_P3 AA3 LYS A 86 ? LEU A 100 ? LYS A 287 LEU A 301 1 ? 15 HELX_P HELX_P4 AA4 SER A 129 ? THR A 137 ? SER A 330 THR A 338 1 ? 9 HELX_P HELX_P5 AA5 ASP A 140 ? ASN A 161 ? ASP A 341 ASN A 362 1 ? 22 HELX_P HELX_P6 AA6 LYS A 169 ? ASP A 171 ? LYS A 370 ASP A 372 5 ? 3 HELX_P HELX_P7 AA7 LYS A 222 ? GLY A 238 ? LYS A 423 GLY A 439 1 ? 17 HELX_P HELX_P8 AA8 PRO A 241 ? ASN A 246 ? PRO A 442 ASN A 447 1 ? 6 HELX_P HELX_P9 AA9 ASN A 246 ? THR A 256 ? ASN A 447 THR A 457 1 ? 11 HELX_P HELX_P10 AB1 GLY A 258 ? ASN A 264 ? GLY A 459 ASN A 465 1 ? 7 HELX_P HELX_P11 AB2 SER A 269 ? LEU A 280 ? SER A 470 LEU A 481 1 ? 12 HELX_P HELX_P12 AB3 SER A 289 ? LEU A 294 ? SER A 490 LEU A 495 1 ? 6 HELX_P HELX_P13 AB4 GLN A 295 ? ALA A 302 ? GLN A 496 ALA A 503 5 ? 8 HELX_P HELX_P14 AB5 PRO A 304 ? SER A 307 ? PRO A 505 SER A 508 5 ? 4 HELX_P HELX_P15 AB6 LEU A 308 ? SER A 321 ? LEU A 509 SER A 522 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 48 ? GLY A 57 ? TYR A 249 GLY A 258 AA1 2 GLY A 60 ? ASP A 67 ? GLY A 261 ASP A 268 AA1 3 GLU A 73 ? ASN A 80 ? GLU A 274 ASN A 281 AA1 4 GLU A 117 ? GLU A 123 ? GLU A 318 GLU A 324 AA1 5 PHE A 108 ? VAL A 114 ? PHE A 309 VAL A 315 AA2 1 VAL A 173 ? LEU A 175 ? VAL A 374 LEU A 376 AA2 2 VAL A 181 ? LEU A 183 ? VAL A 382 LEU A 384 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 49 ? N THR A 250 O THR A 66 ? O THR A 267 AA1 2 3 N THR A 61 ? N THR A 262 O GLN A 78 ? O GLN A 279 AA1 3 4 N ILE A 79 ? N ILE A 280 O LEU A 118 ? O LEU A 319 AA1 4 5 O VAL A 121 ? O VAL A 322 N LEU A 109 ? N LEU A 310 AA2 1 2 N LEU A 174 ? N LEU A 375 O LYS A 182 ? O LYS A 383 # _pdbx_entry_details.entry_id 9WS5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 367 ? ? 81.30 -0.83 2 1 ASN A 368 ? ? -143.41 34.83 3 1 LYS A 423 ? ? 82.69 2.69 4 1 ASN A 458 ? ? 83.95 13.63 5 1 GLU A 467 ? ? 75.23 174.58 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 603 ? D SO4 . 2 1 A SO4 603 ? D SO4 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 202 ? A MET 1 2 1 Y 1 A GLY 203 ? A GLY 2 3 1 Y 1 A SER 204 ? A SER 3 4 1 Y 1 A SER 205 ? A SER 4 5 1 Y 1 A HIS 206 ? A HIS 5 6 1 Y 1 A HIS 207 ? A HIS 6 7 1 Y 1 A HIS 208 ? A HIS 7 8 1 Y 1 A HIS 209 ? A HIS 8 9 1 Y 1 A HIS 210 ? A HIS 9 10 1 Y 1 A HIS 211 ? A HIS 10 11 1 Y 1 A SER 212 ? A SER 11 12 1 Y 1 A GLN 213 ? A GLN 12 13 1 Y 1 A ASP 214 ? A ASP 13 14 1 Y 1 A LEU 215 ? A LEU 14 15 1 Y 1 A GLU 216 ? A GLU 15 16 1 Y 1 A VAL 217 ? A VAL 16 17 1 Y 1 A LEU 218 ? A LEU 17 18 1 Y 1 A PHE 219 ? A PHE 18 19 1 Y 1 A GLN 220 ? A GLN 19 20 1 Y 1 A GLY 221 ? A GLY 20 21 1 Y 1 A PRO 222 ? A PRO 21 22 1 Y 1 A HIS 223 ? A HIS 22 23 1 Y 1 A MET 224 ? A MET 23 24 1 Y 1 A ALA 225 ? A ALA 24 25 1 Y 1 A THR 394 ? A THR 193 26 1 Y 1 A PRO 395 ? A PRO 194 27 1 Y 1 A GLU 396 ? A GLU 195 28 1 Y 1 A GLN 397 ? A GLN 196 29 1 Y 1 A SER 398 ? A SER 197 30 1 Y 1 A LYS 399 ? A LYS 198 31 1 Y 1 A ARG 400 ? A ARG 199 32 1 Y 1 A SER 401 ? A SER 200 33 1 Y 1 A THR 402 ? A THR 201 34 1 Y 1 A MET 403 ? A MET 202 35 1 Y 1 A VAL 404 ? A VAL 203 36 1 Y 1 A GLY 405 ? A GLY 204 37 1 Y 1 A THR 406 ? A THR 205 38 1 Y 1 A PRO 407 ? A PRO 206 39 1 Y 1 A TYR 408 ? A TYR 207 40 1 Y 1 A TRP 409 ? A TRP 208 41 1 Y 1 A MET 410 ? A MET 209 42 1 Y 1 A ALA 411 ? A ALA 210 43 1 Y 1 A PRO 412 ? A PRO 211 44 1 Y 1 A GLU 413 ? A GLU 212 45 1 Y 1 A VAL 414 ? A VAL 213 46 1 Y 1 A VAL 415 ? A VAL 214 47 1 Y 1 A THR 416 ? A THR 215 48 1 Y 1 A ARG 417 ? A ARG 216 49 1 Y 1 A LYS 418 ? A LYS 217 50 1 Y 1 A ALA 419 ? A ALA 218 51 1 Y 1 A TYR 420 ? A TYR 219 52 1 Y 1 A ASN 523 ? A ASN 322 53 1 Y 1 A ARG 524 ? A ARG 323 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CIT C1 C N N 74 CIT O1 O N N 75 CIT O2 O N N 76 CIT C2 C N N 77 CIT C3 C N N 78 CIT O7 O N N 79 CIT C4 C N N 80 CIT C5 C N N 81 CIT O3 O N N 82 CIT O4 O N N 83 CIT C6 C N N 84 CIT O5 O N N 85 CIT O6 O N N 86 CIT HO2 H N N 87 CIT H21 H N N 88 CIT H22 H N N 89 CIT HO7 H N N 90 CIT H41 H N N 91 CIT H42 H N N 92 CIT HO4 H N N 93 CIT HO6 H N N 94 CYS N N N N 95 CYS CA C N R 96 CYS C C N N 97 CYS O O N N 98 CYS CB C N N 99 CYS SG S N N 100 CYS OXT O N N 101 CYS H H N N 102 CYS H2 H N N 103 CYS HA H N N 104 CYS HB2 H N N 105 CYS HB3 H N N 106 CYS HG H N N 107 CYS HXT H N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 SO4 S S N N 322 SO4 O1 O N N 323 SO4 O2 O N N 324 SO4 O3 O N N 325 SO4 O4 O N N 326 THR N N N N 327 THR CA C N S 328 THR C C N N 329 THR O O N N 330 THR CB C N R 331 THR OG1 O N N 332 THR CG2 C N N 333 THR OXT O N N 334 THR H H N N 335 THR H2 H N N 336 THR HA H N N 337 THR HB H N N 338 THR HG1 H N N 339 THR HG21 H N N 340 THR HG22 H N N 341 THR HG23 H N N 342 THR HXT H N N 343 TRP N N N N 344 TRP CA C N S 345 TRP C C N N 346 TRP O O N N 347 TRP CB C N N 348 TRP CG C Y N 349 TRP CD1 C Y N 350 TRP CD2 C Y N 351 TRP NE1 N Y N 352 TRP CE2 C Y N 353 TRP CE3 C Y N 354 TRP CZ2 C Y N 355 TRP CZ3 C Y N 356 TRP CH2 C Y N 357 TRP OXT O N N 358 TRP H H N N 359 TRP H2 H N N 360 TRP HA H N N 361 TRP HB2 H N N 362 TRP HB3 H N N 363 TRP HD1 H N N 364 TRP HE1 H N N 365 TRP HE3 H N N 366 TRP HZ2 H N N 367 TRP HZ3 H N N 368 TRP HH2 H N N 369 TRP HXT H N N 370 TYR N N N N 371 TYR CA C N S 372 TYR C C N N 373 TYR O O N N 374 TYR CB C N N 375 TYR CG C Y N 376 TYR CD1 C Y N 377 TYR CD2 C Y N 378 TYR CE1 C Y N 379 TYR CE2 C Y N 380 TYR CZ C Y N 381 TYR OH O N N 382 TYR OXT O N N 383 TYR H H N N 384 TYR H2 H N N 385 TYR HA H N N 386 TYR HB2 H N N 387 TYR HB3 H N N 388 TYR HD1 H N N 389 TYR HD2 H N N 390 TYR HE1 H N N 391 TYR HE2 H N N 392 TYR HH H N N 393 TYR HXT H N N 394 VAL N N N N 395 VAL CA C N S 396 VAL C C N N 397 VAL O O N N 398 VAL CB C N N 399 VAL CG1 C N N 400 VAL CG2 C N N 401 VAL OXT O N N 402 VAL H H N N 403 VAL H2 H N N 404 VAL HA H N N 405 VAL HB H N N 406 VAL HG11 H N N 407 VAL HG12 H N N 408 VAL HG13 H N N 409 VAL HG21 H N N 410 VAL HG22 H N N 411 VAL HG23 H N N 412 VAL HXT H N N 413 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CIT C1 O1 doub N N 70 CIT C1 O2 sing N N 71 CIT C1 C2 sing N N 72 CIT O2 HO2 sing N N 73 CIT C2 C3 sing N N 74 CIT C2 H21 sing N N 75 CIT C2 H22 sing N N 76 CIT C3 O7 sing N N 77 CIT C3 C4 sing N N 78 CIT C3 C6 sing N N 79 CIT O7 HO7 sing N N 80 CIT C4 C5 sing N N 81 CIT C4 H41 sing N N 82 CIT C4 H42 sing N N 83 CIT C5 O3 doub N N 84 CIT C5 O4 sing N N 85 CIT O4 HO4 sing N N 86 CIT C6 O5 doub N N 87 CIT C6 O6 sing N N 88 CIT O6 HO6 sing N N 89 CYS N CA sing N N 90 CYS N H sing N N 91 CYS N H2 sing N N 92 CYS CA C sing N N 93 CYS CA CB sing N N 94 CYS CA HA sing N N 95 CYS C O doub N N 96 CYS C OXT sing N N 97 CYS CB SG sing N N 98 CYS CB HB2 sing N N 99 CYS CB HB3 sing N N 100 CYS SG HG sing N N 101 CYS OXT HXT sing N N 102 GLN N CA sing N N 103 GLN N H sing N N 104 GLN N H2 sing N N 105 GLN CA C sing N N 106 GLN CA CB sing N N 107 GLN CA HA sing N N 108 GLN C O doub N N 109 GLN C OXT sing N N 110 GLN CB CG sing N N 111 GLN CB HB2 sing N N 112 GLN CB HB3 sing N N 113 GLN CG CD sing N N 114 GLN CG HG2 sing N N 115 GLN CG HG3 sing N N 116 GLN CD OE1 doub N N 117 GLN CD NE2 sing N N 118 GLN NE2 HE21 sing N N 119 GLN NE2 HE22 sing N N 120 GLN OXT HXT sing N N 121 GLU N CA sing N N 122 GLU N H sing N N 123 GLU N H2 sing N N 124 GLU CA C sing N N 125 GLU CA CB sing N N 126 GLU CA HA sing N N 127 GLU C O doub N N 128 GLU C OXT sing N N 129 GLU CB CG sing N N 130 GLU CB HB2 sing N N 131 GLU CB HB3 sing N N 132 GLU CG CD sing N N 133 GLU CG HG2 sing N N 134 GLU CG HG3 sing N N 135 GLU CD OE1 doub N N 136 GLU CD OE2 sing N N 137 GLU OE2 HE2 sing N N 138 GLU OXT HXT sing N N 139 GLY N CA sing N N 140 GLY N H sing N N 141 GLY N H2 sing N N 142 GLY CA C sing N N 143 GLY CA HA2 sing N N 144 GLY CA HA3 sing N N 145 GLY C O doub N N 146 GLY C OXT sing N N 147 GLY OXT HXT sing N N 148 HIS N CA sing N N 149 HIS N H sing N N 150 HIS N H2 sing N N 151 HIS CA C sing N N 152 HIS CA CB sing N N 153 HIS CA HA sing N N 154 HIS C O doub N N 155 HIS C OXT sing N N 156 HIS CB CG sing N N 157 HIS CB HB2 sing N N 158 HIS CB HB3 sing N N 159 HIS CG ND1 sing Y N 160 HIS CG CD2 doub Y N 161 HIS ND1 CE1 doub Y N 162 HIS ND1 HD1 sing N N 163 HIS CD2 NE2 sing Y N 164 HIS CD2 HD2 sing N N 165 HIS CE1 NE2 sing Y N 166 HIS CE1 HE1 sing N N 167 HIS NE2 HE2 sing N N 168 HIS OXT HXT sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 SO4 S O1 doub N N 308 SO4 S O2 doub N N 309 SO4 S O3 sing N N 310 SO4 S O4 sing N N 311 THR N CA sing N N 312 THR N H sing N N 313 THR N H2 sing N N 314 THR CA C sing N N 315 THR CA CB sing N N 316 THR CA HA sing N N 317 THR C O doub N N 318 THR C OXT sing N N 319 THR CB OG1 sing N N 320 THR CB CG2 sing N N 321 THR CB HB sing N N 322 THR OG1 HG1 sing N N 323 THR CG2 HG21 sing N N 324 THR CG2 HG22 sing N N 325 THR CG2 HG23 sing N N 326 THR OXT HXT sing N N 327 TRP N CA sing N N 328 TRP N H sing N N 329 TRP N H2 sing N N 330 TRP CA C sing N N 331 TRP CA CB sing N N 332 TRP CA HA sing N N 333 TRP C O doub N N 334 TRP C OXT sing N N 335 TRP CB CG sing N N 336 TRP CB HB2 sing N N 337 TRP CB HB3 sing N N 338 TRP CG CD1 doub Y N 339 TRP CG CD2 sing Y N 340 TRP CD1 NE1 sing Y N 341 TRP CD1 HD1 sing N N 342 TRP CD2 CE2 doub Y N 343 TRP CD2 CE3 sing Y N 344 TRP NE1 CE2 sing Y N 345 TRP NE1 HE1 sing N N 346 TRP CE2 CZ2 sing Y N 347 TRP CE3 CZ3 doub Y N 348 TRP CE3 HE3 sing N N 349 TRP CZ2 CH2 doub Y N 350 TRP CZ2 HZ2 sing N N 351 TRP CZ3 CH2 sing Y N 352 TRP CZ3 HZ3 sing N N 353 TRP CH2 HH2 sing N N 354 TRP OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Science and Technology (MoST, China)' China ? 1 'National Natural Science Foundation of China (NSFC)' China ? 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9LBF _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9WS5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010253 _atom_sites.fract_transf_matrix[1][2] 0.005920 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011840 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006898 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 0.8669 # loop_ #