data_9X6X # _entry.id 9X6X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9X6X pdb_00009x6x 10.2210/pdb9x6x/pdb WWPDB D_1300064666 ? ? BMRB 36795 ? 10.13018/BMR36795 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-11 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9X6X _pdbx_database_status.recvd_initial_deposition_date 2025-10-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Hsp90a N-terminal domain' _pdbx_database_related.db_id 36795 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 wancj@ustc.edu.cn Chanjuan Wan ? 'principal investigator/group leader' 0000-0002-3345-5138 3 huangcd@ustc.edu.cn Chengdong Huang ? 'principal investigator/group leader' 0000-0002-8997-9459 # _audit_author.name 'Wan, C.J.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-3345-5138 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Phosphorylation regulates Hsp90's ATPase activity ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wan, C.J.' 1 0000-0002-3345-5138 primary 'Huang, C.D.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Heat shock protein HSP 90-alpha' _entity.formula_weight 26730.887 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.4.10 _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Heat shock 86 kDa,HSP 86,HSP86,Heat shock protein family C member 1,Lipopolysaccharide-associated protein 2,LAP-2,LPS-associated protein 2,Renal carcinoma antigen NY-REN-38 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINL IPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQY AWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINL IPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQY AWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 GLU n 1 4 GLU n 1 5 THR n 1 6 GLN n 1 7 THR n 1 8 GLN n 1 9 ASP n 1 10 GLN n 1 11 PRO n 1 12 MET n 1 13 GLU n 1 14 GLU n 1 15 GLU n 1 16 GLU n 1 17 VAL n 1 18 GLU n 1 19 THR n 1 20 PHE n 1 21 ALA n 1 22 PHE n 1 23 GLN n 1 24 ALA n 1 25 GLU n 1 26 ILE n 1 27 ALA n 1 28 GLN n 1 29 LEU n 1 30 MET n 1 31 SER n 1 32 LEU n 1 33 ILE n 1 34 ILE n 1 35 ASN n 1 36 THR n 1 37 PHE n 1 38 TYR n 1 39 SER n 1 40 ASN n 1 41 LYS n 1 42 GLU n 1 43 ILE n 1 44 PHE n 1 45 LEU n 1 46 ARG n 1 47 GLU n 1 48 LEU n 1 49 ILE n 1 50 SER n 1 51 ASN n 1 52 SER n 1 53 SER n 1 54 ASP n 1 55 ALA n 1 56 LEU n 1 57 ASP n 1 58 LYS n 1 59 ILE n 1 60 ARG n 1 61 TYR n 1 62 GLU n 1 63 SER n 1 64 LEU n 1 65 THR n 1 66 ASP n 1 67 PRO n 1 68 SER n 1 69 LYS n 1 70 LEU n 1 71 ASP n 1 72 SER n 1 73 GLY n 1 74 LYS n 1 75 GLU n 1 76 LEU n 1 77 HIS n 1 78 ILE n 1 79 ASN n 1 80 LEU n 1 81 ILE n 1 82 PRO n 1 83 ASN n 1 84 LYS n 1 85 GLN n 1 86 ASP n 1 87 ARG n 1 88 THR n 1 89 LEU n 1 90 THR n 1 91 ILE n 1 92 VAL n 1 93 ASP n 1 94 THR n 1 95 GLY n 1 96 ILE n 1 97 GLY n 1 98 MET n 1 99 THR n 1 100 LYS n 1 101 ALA n 1 102 ASP n 1 103 LEU n 1 104 ILE n 1 105 ASN n 1 106 ASN n 1 107 LEU n 1 108 GLY n 1 109 THR n 1 110 ILE n 1 111 ALA n 1 112 LYS n 1 113 SER n 1 114 GLY n 1 115 THR n 1 116 LYS n 1 117 ALA n 1 118 PHE n 1 119 MET n 1 120 GLU n 1 121 ALA n 1 122 LEU n 1 123 GLN n 1 124 ALA n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 ILE n 1 129 SER n 1 130 MET n 1 131 ILE n 1 132 GLY n 1 133 GLN n 1 134 PHE n 1 135 GLY n 1 136 VAL n 1 137 GLY n 1 138 PHE n 1 139 TYR n 1 140 SER n 1 141 ALA n 1 142 TYR n 1 143 LEU n 1 144 VAL n 1 145 ALA n 1 146 GLU n 1 147 LYS n 1 148 VAL n 1 149 THR n 1 150 VAL n 1 151 ILE n 1 152 THR n 1 153 LYS n 1 154 HIS n 1 155 ASN n 1 156 ASP n 1 157 ASP n 1 158 GLU n 1 159 GLN n 1 160 TYR n 1 161 ALA n 1 162 TRP n 1 163 GLU n 1 164 SER n 1 165 SER n 1 166 ALA n 1 167 GLY n 1 168 GLY n 1 169 SER n 1 170 PHE n 1 171 THR n 1 172 VAL n 1 173 ARG n 1 174 THR n 1 175 ASP n 1 176 THR n 1 177 GLY n 1 178 GLU n 1 179 PRO n 1 180 MET n 1 181 GLY n 1 182 ARG n 1 183 GLY n 1 184 THR n 1 185 LYS n 1 186 VAL n 1 187 ILE n 1 188 LEU n 1 189 HIS n 1 190 LEU n 1 191 LYS n 1 192 GLU n 1 193 ASP n 1 194 GLN n 1 195 THR n 1 196 GLU n 1 197 TYR n 1 198 LEU n 1 199 GLU n 1 200 GLU n 1 201 ARG n 1 202 ARG n 1 203 ILE n 1 204 LYS n 1 205 GLU n 1 206 ILE n 1 207 VAL n 1 208 LYS n 1 209 LYS n 1 210 HIS n 1 211 SER n 1 212 GLN n 1 213 PHE n 1 214 ILE n 1 215 GLY n 1 216 TYR n 1 217 PRO n 1 218 ILE n 1 219 THR n 1 220 LEU n 1 221 PHE n 1 222 VAL n 1 223 GLU n 1 224 LYS n 1 225 GLU n 1 226 ARG n 1 227 ASP n 1 228 LYS n 1 229 GLU n 1 230 VAL n 1 231 SER n 1 232 ASP n 1 233 ASP n 1 234 GLU n 1 235 ALA n 1 236 GLU n 1 237 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 237 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HSP90AA1, HSP90A, HSPC1, HSPCA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 ASP 9 9 ? ? ? A . n A 1 10 GLN 10 10 ? ? ? A . n A 1 11 PRO 11 11 ? ? ? A . n A 1 12 MET 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 GLU 14 14 ? ? ? A . n A 1 15 GLU 15 15 ? ? ? A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 MET 180 180 180 MET MET A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 HIS 189 189 189 HIS HIS A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 GLN 194 194 194 GLN GLN A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 HIS 210 210 210 HIS HIS A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 GLN 212 212 212 GLN GLN A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 PHE 221 221 221 PHE PHE A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 GLU 223 223 ? ? ? A . n A 1 224 LYS 224 224 ? ? ? A . n A 1 225 GLU 225 225 ? ? ? A . n A 1 226 ARG 226 226 ? ? ? A . n A 1 227 ASP 227 227 ? ? ? A . n A 1 228 LYS 228 228 ? ? ? A . n A 1 229 GLU 229 229 ? ? ? A . n A 1 230 VAL 230 230 ? ? ? A . n A 1 231 SER 231 231 ? ? ? A . n A 1 232 ASP 232 232 ? ? ? A . n A 1 233 ASP 233 233 ? ? ? A . n A 1 234 GLU 234 234 ? ? ? A . n A 1 235 ALA 235 235 ? ? ? A . n A 1 236 GLU 236 236 ? ? ? A . n A 1 237 GLU 237 237 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9X6X _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9X6X _struct.title 'Hsp90a N-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9X6X _struct_keywords.text chaperone _struct_keywords.pdbx_keywords CHAPERONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HS90A_HUMAN _struct_ref.pdbx_db_accession P07900 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINL IPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQY AWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9X6X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07900 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 237 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 237 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 23 ? THR A 36 ? GLN A 23 THR A 36 1 ? 14 HELX_P HELX_P2 AA2 GLU A 42 ? ASP A 66 ? GLU A 42 ASP A 66 1 ? 25 HELX_P HELX_P3 AA3 LYS A 69 ? GLY A 73 ? LYS A 69 GLY A 73 5 ? 5 HELX_P HELX_P4 AA4 THR A 99 ? ILE A 104 ? THR A 99 ILE A 104 1 ? 6 HELX_P HELX_P5 AA5 ALA A 111 ? ALA A 124 ? ALA A 111 ALA A 124 1 ? 14 HELX_P HELX_P6 AA6 ASP A 127 ? GLY A 135 ? ASP A 127 GLY A 135 5 ? 9 HELX_P HELX_P7 AA7 TYR A 139 ? LEU A 143 ? TYR A 139 LEU A 143 5 ? 5 HELX_P HELX_P8 AA8 GLU A 192 ? LEU A 198 ? GLU A 192 LEU A 198 5 ? 7 HELX_P HELX_P9 AA9 GLU A 199 ? GLN A 212 ? GLU A 199 GLN A 212 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 18 ? PHE A 20 ? GLU A 18 PHE A 20 AA1 2 PHE A 170 ? ASP A 175 ? PHE A 170 ASP A 175 AA1 3 GLN A 159 ? SER A 164 ? GLN A 159 SER A 164 AA1 4 ALA A 145 ? LYS A 153 ? ALA A 145 LYS A 153 AA1 5 GLY A 183 ? LEU A 190 ? GLY A 183 LEU A 190 AA1 6 THR A 88 ? ASP A 93 ? THR A 88 ASP A 93 AA1 7 ILE A 78 ? ASN A 83 ? ILE A 78 ASN A 83 AA1 8 ILE A 218 ? LEU A 220 ? ILE A 218 LEU A 220 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 20 ? N PHE A 20 O PHE A 170 ? O PHE A 170 AA1 2 3 O THR A 171 ? O THR A 171 N GLU A 163 ? N GLU A 163 AA1 3 4 O TRP A 162 ? O TRP A 162 N VAL A 150 ? N VAL A 150 AA1 4 5 N ILE A 151 ? N ILE A 151 O LYS A 185 ? O LYS A 185 AA1 5 6 O THR A 184 ? O THR A 184 N ASP A 93 ? N ASP A 93 AA1 6 7 O THR A 90 ? O THR A 90 N ILE A 81 ? N ILE A 81 AA1 7 8 N LEU A 80 ? N LEU A 80 O THR A 219 ? O THR A 219 # _pdbx_entry_details.entry_id 9X6X _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 38 ? ? 66.64 126.71 2 1 ARG A 87 ? ? 63.32 73.49 3 1 ASN A 106 ? ? 75.03 -3.96 4 1 LEU A 107 ? ? -174.35 129.95 5 1 THR A 109 ? ? -117.47 -79.27 6 1 ALA A 166 ? ? 63.71 -166.57 7 1 ARG A 182 ? ? -168.08 111.53 8 2 ASN A 40 ? ? -93.90 43.95 9 2 PRO A 67 ? ? -68.97 2.09 10 2 THR A 94 ? ? -98.51 38.47 11 2 ASN A 105 ? ? -79.75 25.02 12 2 ASN A 106 ? ? 68.15 92.73 13 2 LEU A 107 ? ? 75.53 -12.33 14 2 THR A 109 ? ? 49.79 -102.54 15 2 ILE A 110 ? ? -146.19 31.12 16 2 SER A 129 ? ? -79.89 26.74 17 2 PHE A 138 ? ? 35.16 42.47 18 2 ASN A 155 ? ? -37.16 98.61 19 2 ASP A 156 ? ? 56.79 16.49 20 2 SER A 165 ? ? -157.54 -54.71 21 2 ALA A 166 ? ? -172.48 -167.49 22 2 THR A 176 ? ? -143.21 39.38 23 2 GLU A 178 ? ? -144.31 45.04 24 2 PRO A 217 ? ? -59.97 106.05 25 3 THR A 36 ? ? -69.51 90.18 26 3 SER A 39 ? ? -96.28 31.41 27 3 ASN A 40 ? ? -65.77 82.60 28 3 THR A 94 ? ? -101.23 43.15 29 3 ASN A 106 ? ? 65.64 97.34 30 3 LEU A 107 ? ? 73.24 -64.01 31 3 PHE A 138 ? ? -169.58 59.08 32 3 ALA A 166 ? ? 60.33 -135.57 33 3 GLU A 178 ? ? 45.03 86.63 34 3 SER A 211 ? ? 75.92 -18.29 35 3 PRO A 217 ? ? -55.85 108.21 36 4 ASP A 86 ? ? -143.70 14.68 37 4 ARG A 87 ? ? 60.18 61.62 38 4 THR A 94 ? ? -112.02 57.10 39 4 ASN A 106 ? ? 68.05 60.31 40 4 LEU A 107 ? ? 75.60 -56.87 41 4 ALA A 166 ? ? 58.96 -150.34 42 4 THR A 176 ? ? -144.40 28.19 43 4 GLN A 212 ? ? 57.90 12.53 44 4 PHE A 213 ? ? 59.02 18.13 45 4 PRO A 217 ? ? -52.69 105.01 46 5 TYR A 38 ? ? 56.54 113.13 47 5 ASN A 106 ? ? 76.94 97.70 48 5 LYS A 112 ? ? -76.24 -90.25 49 5 ASP A 156 ? ? 72.92 -15.94 50 5 ALA A 166 ? ? 63.77 -166.06 51 5 SER A 211 ? ? 59.96 72.89 52 5 PRO A 217 ? ? -49.76 106.00 53 6 THR A 94 ? ? -103.97 43.60 54 6 THR A 109 ? ? -68.25 -70.28 55 6 GLU A 146 ? ? -136.25 -45.41 56 6 ASP A 156 ? ? 74.30 -5.01 57 6 SER A 165 ? ? -161.11 -61.50 58 6 ALA A 166 ? ? -172.42 -177.84 59 6 GLU A 178 ? ? 64.91 141.62 60 6 GLN A 194 ? ? -106.76 42.66 61 6 PHE A 213 ? ? 58.86 18.61 62 7 VAL A 17 ? ? 63.68 127.86 63 7 THR A 94 ? ? -99.95 43.35 64 7 LEU A 107 ? ? 44.86 22.22 65 7 THR A 109 ? ? -85.77 46.45 66 7 LYS A 112 ? ? -67.18 -70.45 67 7 ALA A 166 ? ? 69.46 -164.98 68 7 THR A 176 ? ? -107.00 53.24 69 7 SER A 211 ? ? 75.05 -13.02 70 7 GLN A 212 ? ? 64.36 -0.92 71 8 THR A 36 ? ? -67.93 92.10 72 8 PHE A 37 ? ? -97.53 34.08 73 8 THR A 94 ? ? -103.52 42.61 74 8 LEU A 107 ? ? 67.26 -72.44 75 8 SER A 165 ? ? -142.53 38.87 76 8 ALA A 166 ? ? 70.43 -173.78 77 9 ARG A 87 ? ? 57.71 72.67 78 9 ASN A 105 ? ? -79.25 24.18 79 9 ASN A 106 ? ? 66.68 85.02 80 9 LEU A 107 ? ? 67.80 -168.07 81 9 ILE A 110 ? ? -64.47 93.34 82 9 ALA A 124 ? ? -154.23 47.37 83 9 ALA A 166 ? ? 64.14 -168.24 84 9 HIS A 210 ? ? -123.37 -51.47 85 9 GLN A 212 ? ? 57.02 13.32 86 9 PRO A 217 ? ? -58.94 107.32 87 10 GLN A 23 ? ? -56.48 177.23 88 10 TYR A 38 ? ? 71.62 153.27 89 10 THR A 94 ? ? -98.02 34.09 90 10 ILE A 96 ? ? 169.46 -48.02 91 10 ASN A 106 ? ? 70.16 71.87 92 10 LEU A 107 ? ? 41.29 78.53 93 10 VAL A 144 ? ? -158.72 79.78 94 10 ALA A 166 ? ? 64.85 -161.37 95 10 THR A 176 ? ? -153.81 34.15 96 10 SER A 211 ? ? -95.32 38.79 # _pdbx_nmr_ensemble.entry_id 9X6X _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'back calculated data agree with experimental NOESY spectrum' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9X6X _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '300 uM [U-100% 15N] Hsp90a NTD, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '300 uM [U-100% 13C; U-100% 15N] Hsp90a NTD, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N13C_sample solution ? 3 '300 uM [U-100% 13C Val,Thr,Leu,Met,Ala,Ile] Hsp90a NTD, 90% H2O/10% D2O' '90% H2O/10% D2O' 13Cmethyl_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Hsp90a NTD' 300 ? uM '[U-100% 15N]' 2 'Hsp90a NTD' 300 ? uM '[U-100% 13C; U-100% 15N]' 3 'Hsp90a NTD' 300 ? uM '[U-100% 13C Val,Thr,Leu,Met,Ala,Ile]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 3 '2D 1H-13C HSQC' 1 isotropic 2 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 3 '3D 1H-13C NOESY' 2 isotropic 4 1 1 '3D 1H-15N NOESY' 1 isotropic 5 1 2 '3D CBCA(CO)NH' 1 isotropic 6 1 2 '3D HNCA' 1 isotropic 7 1 2 '3D HN(CO)CA' 1 isotropic 8 1 2 '3D HNCACB' 1 isotropic # _pdbx_nmr_refine.entry_id 9X6X _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A ASP 9 ? A ASP 9 10 1 Y 1 A GLN 10 ? A GLN 10 11 1 Y 1 A PRO 11 ? A PRO 11 12 1 Y 1 A MET 12 ? A MET 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A GLU 14 ? A GLU 14 15 1 Y 1 A GLU 15 ? A GLU 15 16 1 Y 1 A GLU 223 ? A GLU 223 17 1 Y 1 A LYS 224 ? A LYS 224 18 1 Y 1 A GLU 225 ? A GLU 225 19 1 Y 1 A ARG 226 ? A ARG 226 20 1 Y 1 A ASP 227 ? A ASP 227 21 1 Y 1 A LYS 228 ? A LYS 228 22 1 Y 1 A GLU 229 ? A GLU 229 23 1 Y 1 A VAL 230 ? A VAL 230 24 1 Y 1 A SER 231 ? A SER 231 25 1 Y 1 A ASP 232 ? A ASP 232 26 1 Y 1 A ASP 233 ? A ASP 233 27 1 Y 1 A GLU 234 ? A GLU 234 28 1 Y 1 A ALA 235 ? A ALA 235 29 1 Y 1 A GLU 236 ? A GLU 236 30 1 Y 1 A GLU 237 ? A GLU 237 31 2 Y 1 A MET 1 ? A MET 1 32 2 Y 1 A PRO 2 ? A PRO 2 33 2 Y 1 A GLU 3 ? A GLU 3 34 2 Y 1 A GLU 4 ? A GLU 4 35 2 Y 1 A THR 5 ? A THR 5 36 2 Y 1 A GLN 6 ? A GLN 6 37 2 Y 1 A THR 7 ? A THR 7 38 2 Y 1 A GLN 8 ? A GLN 8 39 2 Y 1 A ASP 9 ? A ASP 9 40 2 Y 1 A GLN 10 ? A GLN 10 41 2 Y 1 A PRO 11 ? A PRO 11 42 2 Y 1 A MET 12 ? A MET 12 43 2 Y 1 A GLU 13 ? A GLU 13 44 2 Y 1 A GLU 14 ? A GLU 14 45 2 Y 1 A GLU 15 ? A GLU 15 46 2 Y 1 A GLU 223 ? A GLU 223 47 2 Y 1 A LYS 224 ? A LYS 224 48 2 Y 1 A GLU 225 ? A GLU 225 49 2 Y 1 A ARG 226 ? A ARG 226 50 2 Y 1 A ASP 227 ? A ASP 227 51 2 Y 1 A LYS 228 ? A LYS 228 52 2 Y 1 A GLU 229 ? A GLU 229 53 2 Y 1 A VAL 230 ? A VAL 230 54 2 Y 1 A SER 231 ? A SER 231 55 2 Y 1 A ASP 232 ? A ASP 232 56 2 Y 1 A ASP 233 ? A ASP 233 57 2 Y 1 A GLU 234 ? A GLU 234 58 2 Y 1 A ALA 235 ? A ALA 235 59 2 Y 1 A GLU 236 ? A GLU 236 60 2 Y 1 A GLU 237 ? A GLU 237 61 3 Y 1 A MET 1 ? A MET 1 62 3 Y 1 A PRO 2 ? A PRO 2 63 3 Y 1 A GLU 3 ? A GLU 3 64 3 Y 1 A GLU 4 ? A GLU 4 65 3 Y 1 A THR 5 ? A THR 5 66 3 Y 1 A GLN 6 ? A GLN 6 67 3 Y 1 A THR 7 ? A THR 7 68 3 Y 1 A GLN 8 ? A GLN 8 69 3 Y 1 A ASP 9 ? A ASP 9 70 3 Y 1 A GLN 10 ? A GLN 10 71 3 Y 1 A PRO 11 ? A PRO 11 72 3 Y 1 A MET 12 ? A MET 12 73 3 Y 1 A GLU 13 ? A GLU 13 74 3 Y 1 A GLU 14 ? A GLU 14 75 3 Y 1 A GLU 15 ? A GLU 15 76 3 Y 1 A GLU 223 ? A GLU 223 77 3 Y 1 A LYS 224 ? A LYS 224 78 3 Y 1 A GLU 225 ? A GLU 225 79 3 Y 1 A ARG 226 ? A ARG 226 80 3 Y 1 A ASP 227 ? A ASP 227 81 3 Y 1 A LYS 228 ? A LYS 228 82 3 Y 1 A GLU 229 ? A GLU 229 83 3 Y 1 A VAL 230 ? A VAL 230 84 3 Y 1 A SER 231 ? A SER 231 85 3 Y 1 A ASP 232 ? A ASP 232 86 3 Y 1 A ASP 233 ? A ASP 233 87 3 Y 1 A GLU 234 ? A GLU 234 88 3 Y 1 A ALA 235 ? A ALA 235 89 3 Y 1 A GLU 236 ? A GLU 236 90 3 Y 1 A GLU 237 ? A GLU 237 91 4 Y 1 A MET 1 ? A MET 1 92 4 Y 1 A PRO 2 ? A PRO 2 93 4 Y 1 A GLU 3 ? A GLU 3 94 4 Y 1 A GLU 4 ? A GLU 4 95 4 Y 1 A THR 5 ? A THR 5 96 4 Y 1 A GLN 6 ? A GLN 6 97 4 Y 1 A THR 7 ? A THR 7 98 4 Y 1 A GLN 8 ? A GLN 8 99 4 Y 1 A ASP 9 ? A ASP 9 100 4 Y 1 A GLN 10 ? A GLN 10 101 4 Y 1 A PRO 11 ? A PRO 11 102 4 Y 1 A MET 12 ? A MET 12 103 4 Y 1 A GLU 13 ? A GLU 13 104 4 Y 1 A GLU 14 ? A GLU 14 105 4 Y 1 A GLU 15 ? A GLU 15 106 4 Y 1 A GLU 223 ? A GLU 223 107 4 Y 1 A LYS 224 ? A LYS 224 108 4 Y 1 A GLU 225 ? A GLU 225 109 4 Y 1 A ARG 226 ? A ARG 226 110 4 Y 1 A ASP 227 ? A ASP 227 111 4 Y 1 A LYS 228 ? A LYS 228 112 4 Y 1 A GLU 229 ? A GLU 229 113 4 Y 1 A VAL 230 ? A VAL 230 114 4 Y 1 A SER 231 ? A SER 231 115 4 Y 1 A ASP 232 ? A ASP 232 116 4 Y 1 A ASP 233 ? A ASP 233 117 4 Y 1 A GLU 234 ? A GLU 234 118 4 Y 1 A ALA 235 ? A ALA 235 119 4 Y 1 A GLU 236 ? A GLU 236 120 4 Y 1 A GLU 237 ? A GLU 237 121 5 Y 1 A MET 1 ? A MET 1 122 5 Y 1 A PRO 2 ? A PRO 2 123 5 Y 1 A GLU 3 ? A GLU 3 124 5 Y 1 A GLU 4 ? A GLU 4 125 5 Y 1 A THR 5 ? A THR 5 126 5 Y 1 A GLN 6 ? A GLN 6 127 5 Y 1 A THR 7 ? A THR 7 128 5 Y 1 A GLN 8 ? A GLN 8 129 5 Y 1 A ASP 9 ? A ASP 9 130 5 Y 1 A GLN 10 ? A GLN 10 131 5 Y 1 A PRO 11 ? A PRO 11 132 5 Y 1 A MET 12 ? A MET 12 133 5 Y 1 A GLU 13 ? A GLU 13 134 5 Y 1 A GLU 14 ? A GLU 14 135 5 Y 1 A GLU 15 ? A GLU 15 136 5 Y 1 A GLU 223 ? A GLU 223 137 5 Y 1 A LYS 224 ? A LYS 224 138 5 Y 1 A GLU 225 ? A GLU 225 139 5 Y 1 A ARG 226 ? A ARG 226 140 5 Y 1 A ASP 227 ? A ASP 227 141 5 Y 1 A LYS 228 ? A LYS 228 142 5 Y 1 A GLU 229 ? A GLU 229 143 5 Y 1 A VAL 230 ? A VAL 230 144 5 Y 1 A SER 231 ? A SER 231 145 5 Y 1 A ASP 232 ? A ASP 232 146 5 Y 1 A ASP 233 ? A ASP 233 147 5 Y 1 A GLU 234 ? A GLU 234 148 5 Y 1 A ALA 235 ? A ALA 235 149 5 Y 1 A GLU 236 ? A GLU 236 150 5 Y 1 A GLU 237 ? A GLU 237 151 6 Y 1 A MET 1 ? A MET 1 152 6 Y 1 A PRO 2 ? A PRO 2 153 6 Y 1 A GLU 3 ? A GLU 3 154 6 Y 1 A GLU 4 ? A GLU 4 155 6 Y 1 A THR 5 ? A THR 5 156 6 Y 1 A GLN 6 ? A GLN 6 157 6 Y 1 A THR 7 ? A THR 7 158 6 Y 1 A GLN 8 ? A GLN 8 159 6 Y 1 A ASP 9 ? A ASP 9 160 6 Y 1 A GLN 10 ? A GLN 10 161 6 Y 1 A PRO 11 ? A PRO 11 162 6 Y 1 A MET 12 ? A MET 12 163 6 Y 1 A GLU 13 ? A GLU 13 164 6 Y 1 A GLU 14 ? A GLU 14 165 6 Y 1 A GLU 15 ? A GLU 15 166 6 Y 1 A GLU 223 ? A GLU 223 167 6 Y 1 A LYS 224 ? A LYS 224 168 6 Y 1 A GLU 225 ? A GLU 225 169 6 Y 1 A ARG 226 ? A ARG 226 170 6 Y 1 A ASP 227 ? A ASP 227 171 6 Y 1 A LYS 228 ? A LYS 228 172 6 Y 1 A GLU 229 ? A GLU 229 173 6 Y 1 A VAL 230 ? A VAL 230 174 6 Y 1 A SER 231 ? A SER 231 175 6 Y 1 A ASP 232 ? A ASP 232 176 6 Y 1 A ASP 233 ? A ASP 233 177 6 Y 1 A GLU 234 ? A GLU 234 178 6 Y 1 A ALA 235 ? A ALA 235 179 6 Y 1 A GLU 236 ? A GLU 236 180 6 Y 1 A GLU 237 ? A GLU 237 181 7 Y 1 A MET 1 ? A MET 1 182 7 Y 1 A PRO 2 ? A PRO 2 183 7 Y 1 A GLU 3 ? A GLU 3 184 7 Y 1 A GLU 4 ? A GLU 4 185 7 Y 1 A THR 5 ? A THR 5 186 7 Y 1 A GLN 6 ? A GLN 6 187 7 Y 1 A THR 7 ? A THR 7 188 7 Y 1 A GLN 8 ? A GLN 8 189 7 Y 1 A ASP 9 ? A ASP 9 190 7 Y 1 A GLN 10 ? A GLN 10 191 7 Y 1 A PRO 11 ? A PRO 11 192 7 Y 1 A MET 12 ? A MET 12 193 7 Y 1 A GLU 13 ? A GLU 13 194 7 Y 1 A GLU 14 ? A GLU 14 195 7 Y 1 A GLU 15 ? A GLU 15 196 7 Y 1 A GLU 223 ? A GLU 223 197 7 Y 1 A LYS 224 ? A LYS 224 198 7 Y 1 A GLU 225 ? A GLU 225 199 7 Y 1 A ARG 226 ? A ARG 226 200 7 Y 1 A ASP 227 ? A ASP 227 201 7 Y 1 A LYS 228 ? A LYS 228 202 7 Y 1 A GLU 229 ? A GLU 229 203 7 Y 1 A VAL 230 ? A VAL 230 204 7 Y 1 A SER 231 ? A SER 231 205 7 Y 1 A ASP 232 ? A ASP 232 206 7 Y 1 A ASP 233 ? A ASP 233 207 7 Y 1 A GLU 234 ? A GLU 234 208 7 Y 1 A ALA 235 ? A ALA 235 209 7 Y 1 A GLU 236 ? A GLU 236 210 7 Y 1 A GLU 237 ? A GLU 237 211 8 Y 1 A MET 1 ? A MET 1 212 8 Y 1 A PRO 2 ? A PRO 2 213 8 Y 1 A GLU 3 ? A GLU 3 214 8 Y 1 A GLU 4 ? A GLU 4 215 8 Y 1 A THR 5 ? A THR 5 216 8 Y 1 A GLN 6 ? A GLN 6 217 8 Y 1 A THR 7 ? A THR 7 218 8 Y 1 A GLN 8 ? A GLN 8 219 8 Y 1 A ASP 9 ? A ASP 9 220 8 Y 1 A GLN 10 ? A GLN 10 221 8 Y 1 A PRO 11 ? A PRO 11 222 8 Y 1 A MET 12 ? A MET 12 223 8 Y 1 A GLU 13 ? A GLU 13 224 8 Y 1 A GLU 14 ? A GLU 14 225 8 Y 1 A GLU 15 ? A GLU 15 226 8 Y 1 A GLU 223 ? A GLU 223 227 8 Y 1 A LYS 224 ? A LYS 224 228 8 Y 1 A GLU 225 ? A GLU 225 229 8 Y 1 A ARG 226 ? A ARG 226 230 8 Y 1 A ASP 227 ? A ASP 227 231 8 Y 1 A LYS 228 ? A LYS 228 232 8 Y 1 A GLU 229 ? A GLU 229 233 8 Y 1 A VAL 230 ? A VAL 230 234 8 Y 1 A SER 231 ? A SER 231 235 8 Y 1 A ASP 232 ? A ASP 232 236 8 Y 1 A ASP 233 ? A ASP 233 237 8 Y 1 A GLU 234 ? A GLU 234 238 8 Y 1 A ALA 235 ? A ALA 235 239 8 Y 1 A GLU 236 ? A GLU 236 240 8 Y 1 A GLU 237 ? A GLU 237 241 9 Y 1 A MET 1 ? A MET 1 242 9 Y 1 A PRO 2 ? A PRO 2 243 9 Y 1 A GLU 3 ? A GLU 3 244 9 Y 1 A GLU 4 ? A GLU 4 245 9 Y 1 A THR 5 ? A THR 5 246 9 Y 1 A GLN 6 ? A GLN 6 247 9 Y 1 A THR 7 ? A THR 7 248 9 Y 1 A GLN 8 ? A GLN 8 249 9 Y 1 A ASP 9 ? A ASP 9 250 9 Y 1 A GLN 10 ? A GLN 10 251 9 Y 1 A PRO 11 ? A PRO 11 252 9 Y 1 A MET 12 ? A MET 12 253 9 Y 1 A GLU 13 ? A GLU 13 254 9 Y 1 A GLU 14 ? A GLU 14 255 9 Y 1 A GLU 15 ? A GLU 15 256 9 Y 1 A GLU 223 ? A GLU 223 257 9 Y 1 A LYS 224 ? A LYS 224 258 9 Y 1 A GLU 225 ? A GLU 225 259 9 Y 1 A ARG 226 ? A ARG 226 260 9 Y 1 A ASP 227 ? A ASP 227 261 9 Y 1 A LYS 228 ? A LYS 228 262 9 Y 1 A GLU 229 ? A GLU 229 263 9 Y 1 A VAL 230 ? A VAL 230 264 9 Y 1 A SER 231 ? A SER 231 265 9 Y 1 A ASP 232 ? A ASP 232 266 9 Y 1 A ASP 233 ? A ASP 233 267 9 Y 1 A GLU 234 ? A GLU 234 268 9 Y 1 A ALA 235 ? A ALA 235 269 9 Y 1 A GLU 236 ? A GLU 236 270 9 Y 1 A GLU 237 ? A GLU 237 271 10 Y 1 A MET 1 ? A MET 1 272 10 Y 1 A PRO 2 ? A PRO 2 273 10 Y 1 A GLU 3 ? A GLU 3 274 10 Y 1 A GLU 4 ? A GLU 4 275 10 Y 1 A THR 5 ? A THR 5 276 10 Y 1 A GLN 6 ? A GLN 6 277 10 Y 1 A THR 7 ? A THR 7 278 10 Y 1 A GLN 8 ? A GLN 8 279 10 Y 1 A ASP 9 ? A ASP 9 280 10 Y 1 A GLN 10 ? A GLN 10 281 10 Y 1 A PRO 11 ? A PRO 11 282 10 Y 1 A MET 12 ? A MET 12 283 10 Y 1 A GLU 13 ? A GLU 13 284 10 Y 1 A GLU 14 ? A GLU 14 285 10 Y 1 A GLU 15 ? A GLU 15 286 10 Y 1 A GLU 223 ? A GLU 223 287 10 Y 1 A LYS 224 ? A LYS 224 288 10 Y 1 A GLU 225 ? A GLU 225 289 10 Y 1 A ARG 226 ? A ARG 226 290 10 Y 1 A ASP 227 ? A ASP 227 291 10 Y 1 A LYS 228 ? A LYS 228 292 10 Y 1 A GLU 229 ? A GLU 229 293 10 Y 1 A VAL 230 ? A VAL 230 294 10 Y 1 A SER 231 ? A SER 231 295 10 Y 1 A ASP 232 ? A ASP 232 296 10 Y 1 A ASP 233 ? A ASP 233 297 10 Y 1 A GLU 234 ? A GLU 234 298 10 Y 1 A ALA 235 ? A ALA 235 299 10 Y 1 A GLU 236 ? A GLU 236 300 10 Y 1 A GLU 237 ? A GLU 237 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 31770807 1 'National Natural Science Foundation of China (NSFC)' China 31971144 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 850 ? # _atom_sites.entry_id 9X6X _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #