data_9XB4 # _entry.id 9XB4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9XB4 pdb_00009xb4 10.2210/pdb9xb4/pdb WWPDB D_1300065017 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9XB4 _pdbx_database_status.recvd_initial_deposition_date 2025-10-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 renyl@mail.ccnu.edu.cn Yanliang Ren ? 'principal investigator/group leader' 0000-0001-8565-2152 3 jianwan@mail.ccnu.edu.cn Jian Wan ? 'principal investigator/group leader' 0000-0003-4172-1392 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cao, H.' 1 ? 'Hu, X.' 2 ? 'Li, W.' 3 ? 'Chang, M.' 4 ? 'Zhang, Y.' 5 ? 'Chu, Y.' 6 ? 'Ren, Y.' 7 ? 'Wan, J.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Inhibiting Mrt4-rRNA interaction with fumaramidmycin-based derivatives as an unexploited antifungal strategy' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cao, H.' 1 ? primary 'Hu, X.' 2 ? primary 'Li, W.' 3 ? primary 'Chang, M.' 4 ? primary 'Zhang, Y.' 5 ? primary 'Chu, Y.' 6 ? primary 'Ren, Y.' 7 ? primary 'Wan, J.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Large ribosomal subunit protein uL10' 31817.770 1 ? L96C ? ? 2 water nat water 18.015 76 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ribosome assembly factor mrt4,mRNA turnover protein 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)PKSKRARVYHLTQVNKKGREAKERLFSNIRETIPKYQHCFVFSVDN(MSE)RNNYLKDVRHELNDCRIFFGKTKL (MSE)ARALGTTPEEEQADGLHRLTRYCTGTVGLLFTNRDPADIESYFSNLSQVDFARAGTVAPRTVTVPPGIVYSTGGE VPPEHDVPVSHTLEPELRRLG(MSE)PVR(MSE)IKGKVCLGDEKGEASEGYTICKEGEVLDSRQTRLLKLFSICLSEFK VSLLGYWSSASGEVTELEAGKTRPKREGNRRQA(MSE)NGDE(MSE)DEDQSSDEDSDGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPKSKRARVYHLTQVNKKGREAKERLFSNIRETIPKYQHCFVFSVDNMRNNYLKDVRHELNDCRIFFGKTKLMARALGTT PEEEQADGLHRLTRYCTGTVGLLFTNRDPADIESYFSNLSQVDFARAGTVAPRTVTVPPGIVYSTGGEVPPEHDVPVSHT LEPELRRLGMPVRMIKGKVCLGDEKGEASEGYTICKEGEVLDSRQTRLLKLFSICLSEFKVSLLGYWSSASGEVTELEAG KTRPKREGNRRQAMNGDEMDEDQSSDEDSDGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 PRO n 1 3 LYS n 1 4 SER n 1 5 LYS n 1 6 ARG n 1 7 ALA n 1 8 ARG n 1 9 VAL n 1 10 TYR n 1 11 HIS n 1 12 LEU n 1 13 THR n 1 14 GLN n 1 15 VAL n 1 16 ASN n 1 17 LYS n 1 18 LYS n 1 19 GLY n 1 20 ARG n 1 21 GLU n 1 22 ALA n 1 23 LYS n 1 24 GLU n 1 25 ARG n 1 26 LEU n 1 27 PHE n 1 28 SER n 1 29 ASN n 1 30 ILE n 1 31 ARG n 1 32 GLU n 1 33 THR n 1 34 ILE n 1 35 PRO n 1 36 LYS n 1 37 TYR n 1 38 GLN n 1 39 HIS n 1 40 CYS n 1 41 PHE n 1 42 VAL n 1 43 PHE n 1 44 SER n 1 45 VAL n 1 46 ASP n 1 47 ASN n 1 48 MSE n 1 49 ARG n 1 50 ASN n 1 51 ASN n 1 52 TYR n 1 53 LEU n 1 54 LYS n 1 55 ASP n 1 56 VAL n 1 57 ARG n 1 58 HIS n 1 59 GLU n 1 60 LEU n 1 61 ASN n 1 62 ASP n 1 63 CYS n 1 64 ARG n 1 65 ILE n 1 66 PHE n 1 67 PHE n 1 68 GLY n 1 69 LYS n 1 70 THR n 1 71 LYS n 1 72 LEU n 1 73 MSE n 1 74 ALA n 1 75 ARG n 1 76 ALA n 1 77 LEU n 1 78 GLY n 1 79 THR n 1 80 THR n 1 81 PRO n 1 82 GLU n 1 83 GLU n 1 84 GLU n 1 85 GLN n 1 86 ALA n 1 87 ASP n 1 88 GLY n 1 89 LEU n 1 90 HIS n 1 91 ARG n 1 92 LEU n 1 93 THR n 1 94 ARG n 1 95 TYR n 1 96 CYS n 1 97 THR n 1 98 GLY n 1 99 THR n 1 100 VAL n 1 101 GLY n 1 102 LEU n 1 103 LEU n 1 104 PHE n 1 105 THR n 1 106 ASN n 1 107 ARG n 1 108 ASP n 1 109 PRO n 1 110 ALA n 1 111 ASP n 1 112 ILE n 1 113 GLU n 1 114 SER n 1 115 TYR n 1 116 PHE n 1 117 SER n 1 118 ASN n 1 119 LEU n 1 120 SER n 1 121 GLN n 1 122 VAL n 1 123 ASP n 1 124 PHE n 1 125 ALA n 1 126 ARG n 1 127 ALA n 1 128 GLY n 1 129 THR n 1 130 VAL n 1 131 ALA n 1 132 PRO n 1 133 ARG n 1 134 THR n 1 135 VAL n 1 136 THR n 1 137 VAL n 1 138 PRO n 1 139 PRO n 1 140 GLY n 1 141 ILE n 1 142 VAL n 1 143 TYR n 1 144 SER n 1 145 THR n 1 146 GLY n 1 147 GLY n 1 148 GLU n 1 149 VAL n 1 150 PRO n 1 151 PRO n 1 152 GLU n 1 153 HIS n 1 154 ASP n 1 155 VAL n 1 156 PRO n 1 157 VAL n 1 158 SER n 1 159 HIS n 1 160 THR n 1 161 LEU n 1 162 GLU n 1 163 PRO n 1 164 GLU n 1 165 LEU n 1 166 ARG n 1 167 ARG n 1 168 LEU n 1 169 GLY n 1 170 MSE n 1 171 PRO n 1 172 VAL n 1 173 ARG n 1 174 MSE n 1 175 ILE n 1 176 LYS n 1 177 GLY n 1 178 LYS n 1 179 VAL n 1 180 CYS n 1 181 LEU n 1 182 GLY n 1 183 ASP n 1 184 GLU n 1 185 LYS n 1 186 GLY n 1 187 GLU n 1 188 ALA n 1 189 SER n 1 190 GLU n 1 191 GLY n 1 192 TYR n 1 193 THR n 1 194 ILE n 1 195 CYS n 1 196 LYS n 1 197 GLU n 1 198 GLY n 1 199 GLU n 1 200 VAL n 1 201 LEU n 1 202 ASP n 1 203 SER n 1 204 ARG n 1 205 GLN n 1 206 THR n 1 207 ARG n 1 208 LEU n 1 209 LEU n 1 210 LYS n 1 211 LEU n 1 212 PHE n 1 213 SER n 1 214 ILE n 1 215 CYS n 1 216 LEU n 1 217 SER n 1 218 GLU n 1 219 PHE n 1 220 LYS n 1 221 VAL n 1 222 SER n 1 223 LEU n 1 224 LEU n 1 225 GLY n 1 226 TYR n 1 227 TRP n 1 228 SER n 1 229 SER n 1 230 ALA n 1 231 SER n 1 232 GLY n 1 233 GLU n 1 234 VAL n 1 235 THR n 1 236 GLU n 1 237 LEU n 1 238 GLU n 1 239 ALA n 1 240 GLY n 1 241 LYS n 1 242 THR n 1 243 ARG n 1 244 PRO n 1 245 LYS n 1 246 ARG n 1 247 GLU n 1 248 GLY n 1 249 ASN n 1 250 ARG n 1 251 ARG n 1 252 GLN n 1 253 ALA n 1 254 MSE n 1 255 ASN n 1 256 GLY n 1 257 ASP n 1 258 GLU n 1 259 MSE n 1 260 ASP n 1 261 GLU n 1 262 ASP n 1 263 GLN n 1 264 SER n 1 265 SER n 1 266 ASP n 1 267 GLU n 1 268 ASP n 1 269 SER n 1 270 ASP n 1 271 GLY n 1 272 SER n 1 273 HIS n 1 274 HIS n 1 275 HIS n 1 276 HIS n 1 277 HIS n 1 278 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 278 _entity_src_gen.gene_src_common_name 'Thermochaetoides thermophila' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CTHT_0025680 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 1495 / CBS 144.50 / IMI 039719' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 759272 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 ARG 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 TYR 10 10 ? ? ? A . n A 1 11 HIS 11 11 ? ? ? A . n A 1 12 LEU 12 12 ? ? ? A . n A 1 13 THR 13 13 ? ? ? A . n A 1 14 GLN 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 ASN 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 LYS 18 18 ? ? ? A . n A 1 19 GLY 19 19 ? ? ? A . n A 1 20 ARG 20 20 ? ? ? A . n A 1 21 GLU 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 LYS 23 23 ? ? ? A . n A 1 24 GLU 24 24 ? ? ? A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 MSE 48 48 48 MSE MSE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MSE 73 73 73 MSE MSE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 MSE 170 170 170 MSE MSE A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 MSE 174 174 174 MSE MSE A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 CYS 180 180 180 CYS CYS A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLY 182 182 ? ? ? A . n A 1 183 ASP 183 183 ? ? ? A . n A 1 184 GLU 184 184 ? ? ? A . n A 1 185 LYS 185 185 ? ? ? A . n A 1 186 GLY 186 186 ? ? ? A . n A 1 187 GLU 187 187 ? ? ? A . n A 1 188 ALA 188 188 ? ? ? A . n A 1 189 SER 189 189 ? ? ? A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 CYS 195 195 195 CYS CYS A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 CYS 215 215 215 CYS CYS A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 TRP 227 227 227 TRP TRP A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 GLU 236 236 236 GLU GLU A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 LYS 241 241 241 LYS LYS A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 PRO 244 244 244 PRO PRO A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 ARG 251 251 ? ? ? A . n A 1 252 GLN 252 252 ? ? ? A . n A 1 253 ALA 253 253 ? ? ? A . n A 1 254 MSE 254 254 ? ? ? A . n A 1 255 ASN 255 255 ? ? ? A . n A 1 256 GLY 256 256 ? ? ? A . n A 1 257 ASP 257 257 ? ? ? A . n A 1 258 GLU 258 258 ? ? ? A . n A 1 259 MSE 259 259 ? ? ? A . n A 1 260 ASP 260 260 ? ? ? A . n A 1 261 GLU 261 261 ? ? ? A . n A 1 262 ASP 262 262 ? ? ? A . n A 1 263 GLN 263 263 ? ? ? A . n A 1 264 SER 264 264 ? ? ? A . n A 1 265 SER 265 265 ? ? ? A . n A 1 266 ASP 266 266 ? ? ? A . n A 1 267 GLU 267 267 ? ? ? A . n A 1 268 ASP 268 268 ? ? ? A . n A 1 269 SER 269 269 ? ? ? A . n A 1 270 ASP 270 270 ? ? ? A . n A 1 271 GLY 271 271 ? ? ? A . n A 1 272 SER 272 272 ? ? ? A . n A 1 273 HIS 273 273 ? ? ? A . n A 1 274 HIS 274 274 ? ? ? A . n A 1 275 HIS 275 275 ? ? ? A . n A 1 276 HIS 276 276 ? ? ? A . n A 1 277 HIS 277 277 ? ? ? A . n A 1 278 HIS 278 278 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 18 HOH HOH A . B 2 HOH 2 302 9 HOH HOH A . B 2 HOH 3 303 16 HOH HOH A . B 2 HOH 4 304 25 HOH HOH A . B 2 HOH 5 305 51 HOH HOH A . B 2 HOH 6 306 48 HOH HOH A . B 2 HOH 7 307 4 HOH HOH A . B 2 HOH 8 308 27 HOH HOH A . B 2 HOH 9 309 66 HOH HOH A . B 2 HOH 10 310 13 HOH HOH A . B 2 HOH 11 311 67 HOH HOH A . B 2 HOH 12 312 5 HOH HOH A . B 2 HOH 13 313 22 HOH HOH A . B 2 HOH 14 314 49 HOH HOH A . B 2 HOH 15 315 14 HOH HOH A . B 2 HOH 16 316 55 HOH HOH A . B 2 HOH 17 317 47 HOH HOH A . B 2 HOH 18 318 61 HOH HOH A . B 2 HOH 19 319 37 HOH HOH A . B 2 HOH 20 320 76 HOH HOH A . B 2 HOH 21 321 52 HOH HOH A . B 2 HOH 22 322 45 HOH HOH A . B 2 HOH 23 323 78 HOH HOH A . B 2 HOH 24 324 56 HOH HOH A . B 2 HOH 25 325 7 HOH HOH A . B 2 HOH 26 326 10 HOH HOH A . B 2 HOH 27 327 58 HOH HOH A . B 2 HOH 28 328 1 HOH HOH A . B 2 HOH 29 329 77 HOH HOH A . B 2 HOH 30 330 6 HOH HOH A . B 2 HOH 31 331 17 HOH HOH A . B 2 HOH 32 332 35 HOH HOH A . B 2 HOH 33 333 11 HOH HOH A . B 2 HOH 34 334 39 HOH HOH A . B 2 HOH 35 335 8 HOH HOH A . B 2 HOH 36 336 28 HOH HOH A . B 2 HOH 37 337 2 HOH HOH A . B 2 HOH 38 338 32 HOH HOH A . B 2 HOH 39 339 59 HOH HOH A . B 2 HOH 40 340 34 HOH HOH A . B 2 HOH 41 341 31 HOH HOH A . B 2 HOH 42 342 54 HOH HOH A . B 2 HOH 43 343 43 HOH HOH A . B 2 HOH 44 344 65 HOH HOH A . B 2 HOH 45 345 71 HOH HOH A . B 2 HOH 46 346 63 HOH HOH A . B 2 HOH 47 347 3 HOH HOH A . B 2 HOH 48 348 40 HOH HOH A . B 2 HOH 49 349 20 HOH HOH A . B 2 HOH 50 350 68 HOH HOH A . B 2 HOH 51 351 12 HOH HOH A . B 2 HOH 52 352 64 HOH HOH A . B 2 HOH 53 353 50 HOH HOH A . B 2 HOH 54 354 74 HOH HOH A . B 2 HOH 55 355 70 HOH HOH A . B 2 HOH 56 356 33 HOH HOH A . B 2 HOH 57 357 41 HOH HOH A . B 2 HOH 58 358 80 HOH HOH A . B 2 HOH 59 359 38 HOH HOH A . B 2 HOH 60 360 23 HOH HOH A . B 2 HOH 61 361 29 HOH HOH A . B 2 HOH 62 362 60 HOH HOH A . B 2 HOH 63 363 69 HOH HOH A . B 2 HOH 64 364 57 HOH HOH A . B 2 HOH 65 365 42 HOH HOH A . B 2 HOH 66 366 79 HOH HOH A . B 2 HOH 67 367 15 HOH HOH A . B 2 HOH 68 368 26 HOH HOH A . B 2 HOH 69 369 30 HOH HOH A . B 2 HOH 70 370 62 HOH HOH A . B 2 HOH 71 371 44 HOH HOH A . B 2 HOH 72 372 36 HOH HOH A . B 2 HOH 73 373 24 HOH HOH A . B 2 HOH 74 374 19 HOH HOH A . B 2 HOH 75 375 81 HOH HOH A . B 2 HOH 76 376 21 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 112.12 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9XB4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.245 _cell.length_a_esd ? _cell.length_b 65.541 _cell.length_b_esd ? _cell.length_c 71.205 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9XB4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9XB4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M bicine and 2.22 M (NH4)2SO4' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-06-04 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97861 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL10U2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97861 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL10U2 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9XB4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 41.56 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8932 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.46 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.57 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.59 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 891 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.848 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9XB4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 41.56 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8782 _refine.ls_number_reflns_R_free 884 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.49 _refine.ls_percent_reflns_R_free 10.07 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2233 _refine.ls_R_factor_R_free 0.2827 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2166 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.73 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.39 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 41.56 _refine_hist.number_atoms_solvent 76 _refine_hist.number_atoms_total 1803 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1727 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1830 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.046 ? 2491 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 5.389 ? 265 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.059 ? 279 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 328 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.50 2.65 . . 145 1338 99.00 . . . . 0.2639 . . . . . . . . . . . . . . . 0.3807 'X-RAY DIFFRACTION' 2.66 2.86 . . 156 1323 99.00 . . . . 0.2643 . . . . . . . . . . . . . . . 0.3896 'X-RAY DIFFRACTION' 2.86 3.15 . . 145 1294 97.00 . . . . 0.2647 . . . . . . . . . . . . . . . 0.3906 'X-RAY DIFFRACTION' 3.15 3.60 . . 134 1273 94.00 . . . . 0.2286 . . . . . . . . . . . . . . . 0.2973 'X-RAY DIFFRACTION' 3.60 4.54 . . 151 1296 96.00 . . . . 0.1850 . . . . . . . . . . . . . . . 0.2641 'X-RAY DIFFRACTION' 4.54 41.56 . . 153 1374 99.00 . . . . 0.1959 . . . . . . . . . . . . . . . 0.2087 # _struct.entry_id 9XB4 _struct.title 'Crystal structure of Mrt4 (L96C) mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9XB4 _struct_keywords.text ;Fumaramidmycin-based derivatives, Azole-resistant fungi, ribosome assembly factor, target identification, protein-RNA interaction, RNA BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MRT4_CHATD _struct_ref.pdbx_db_accession G0S616 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPKSKRARVYHLTQVNKKGREAKERLFSNIRETIPKYQHCFVFSVDNMRNNYLKDVRHELNDCRIFFGKTKLMARALGTT PEEEQADGLHRLTRYLTGTVGLLFTNRDPADIESYFSNLSQVDFARAGTVAPRTVTVPPGIVYSTGGEVPPEHDVPVSHT LEPELRRLGMPVRMIKGKVCLGDEKGEASEGYTICKEGEVLDSRQTRLLKLFSICLSEFKVSLLGYWSSASGEVTELEAG KTRPKREGNRRQAMNGDEMDEDQSSDEDSD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9XB4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 270 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G0S616 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 270 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 270 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9XB4 CYS A 96 ? UNP G0S616 LEU 96 'engineered mutation' 96 1 1 9XB4 GLY A 271 ? UNP G0S616 ? ? 'expression tag' 271 2 1 9XB4 SER A 272 ? UNP G0S616 ? ? 'expression tag' 272 3 1 9XB4 HIS A 273 ? UNP G0S616 ? ? 'expression tag' 273 4 1 9XB4 HIS A 274 ? UNP G0S616 ? ? 'expression tag' 274 5 1 9XB4 HIS A 275 ? UNP G0S616 ? ? 'expression tag' 275 6 1 9XB4 HIS A 276 ? UNP G0S616 ? ? 'expression tag' 276 7 1 9XB4 HIS A 277 ? UNP G0S616 ? ? 'expression tag' 277 8 1 9XB4 HIS A 278 ? UNP G0S616 ? ? 'expression tag' 278 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 25 ? ILE A 34 ? ARG A 25 ILE A 34 1 ? 10 HELX_P HELX_P2 AA2 PRO A 35 ? TYR A 37 ? PRO A 35 TYR A 37 5 ? 3 HELX_P HELX_P3 AA3 ARG A 49 ? LEU A 60 ? ARG A 49 LEU A 60 1 ? 12 HELX_P HELX_P4 AA4 LYS A 69 ? GLY A 78 ? LYS A 69 GLY A 78 1 ? 10 HELX_P HELX_P5 AA5 GLY A 88 ? CYS A 96 ? GLY A 88 CYS A 96 5 ? 9 HELX_P HELX_P6 AA6 ASP A 108 ? LEU A 119 ? ASP A 108 LEU A 119 1 ? 12 HELX_P HELX_P7 AA7 PRO A 150 ? ASP A 154 ? PRO A 150 ASP A 154 5 ? 5 HELX_P HELX_P8 AA8 SER A 158 ? THR A 160 ? SER A 158 THR A 160 5 ? 3 HELX_P HELX_P9 AA9 LEU A 161 ? LEU A 168 ? LEU A 161 LEU A 168 1 ? 8 HELX_P HELX_P10 AB1 ASP A 202 ? PHE A 212 ? ASP A 202 PHE A 212 1 ? 11 HELX_P HELX_P11 AB2 LEU A 237 ? THR A 242 ? LEU A 237 THR A 242 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASN 47 C A ? ? 1_555 A MSE 48 N ? ? A ASN 47 A MSE 48 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale2 covale both ? A ASN 47 C B ? ? 1_555 A MSE 48 N ? ? A ASN 47 A MSE 48 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? A MSE 48 C ? ? ? 1_555 A ARG 49 N ? ? A MSE 48 A ARG 49 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A LEU 72 C ? ? ? 1_555 A MSE 73 N ? ? A LEU 72 A MSE 73 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? A MSE 73 C ? ? ? 1_555 A ALA 74 N ? ? A MSE 73 A ALA 74 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale6 covale both ? A GLY 169 C ? ? ? 1_555 A MSE 170 N ? ? A GLY 169 A MSE 170 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale7 covale both ? A MSE 170 C ? ? ? 1_555 A PRO 171 N ? ? A MSE 170 A PRO 171 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale8 covale both ? A ARG 173 C ? ? ? 1_555 A MSE 174 N ? ? A ARG 173 A MSE 174 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale9 covale both ? A MSE 174 C ? ? ? 1_555 A ILE 175 N ? ? A MSE 174 A ILE 175 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 48 ? . . . . MSE A 48 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 73 ? . . . . MSE A 73 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 170 ? . . . . MSE A 170 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 174 ? . . . . MSE A 174 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 2 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 64 ? PHE A 66 ? ARG A 64 PHE A 66 AA1 2 VAL A 100 ? THR A 105 ? VAL A 100 THR A 105 AA1 3 HIS A 39 ? ASP A 46 ? HIS A 39 ASP A 46 AA1 4 SER A 217 ? SER A 228 ? SER A 217 SER A 228 AA1 5 GLN A 121 ? ASP A 123 ? GLN A 121 ASP A 123 AA2 1 ARG A 64 ? PHE A 66 ? ARG A 64 PHE A 66 AA2 2 VAL A 100 ? THR A 105 ? VAL A 100 THR A 105 AA2 3 HIS A 39 ? ASP A 46 ? HIS A 39 ASP A 46 AA2 4 SER A 217 ? SER A 228 ? SER A 217 SER A 228 AA2 5 VAL A 234 ? GLU A 236 ? VAL A 234 GLU A 236 AA3 1 VAL A 135 ? VAL A 137 ? VAL A 135 VAL A 137 AA3 2 TYR A 192 ? CYS A 195 ? TYR A 192 CYS A 195 AA4 1 GLY A 140 ? ILE A 141 ? GLY A 140 ILE A 141 AA4 2 LYS A 178 ? LEU A 181 ? LYS A 178 LEU A 181 AA4 3 ARG A 173 ? ILE A 175 ? ARG A 173 ILE A 175 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 64 ? N ARG A 64 O PHE A 104 ? O PHE A 104 AA1 2 3 O LEU A 103 ? O LEU A 103 N PHE A 41 ? N PHE A 41 AA1 3 4 N SER A 44 ? N SER A 44 O SER A 222 ? O SER A 222 AA1 4 5 O PHE A 219 ? O PHE A 219 N GLN A 121 ? N GLN A 121 AA2 1 2 N ARG A 64 ? N ARG A 64 O PHE A 104 ? O PHE A 104 AA2 2 3 O LEU A 103 ? O LEU A 103 N PHE A 41 ? N PHE A 41 AA2 3 4 N SER A 44 ? N SER A 44 O SER A 222 ? O SER A 222 AA2 4 5 N TYR A 226 ? N TYR A 226 O THR A 235 ? O THR A 235 AA3 1 2 N VAL A 137 ? N VAL A 137 O TYR A 192 ? O TYR A 192 AA4 1 2 N GLY A 140 ? N GLY A 140 O LEU A 181 ? O LEU A 181 AA4 2 3 O CYS A 180 ? O CYS A 180 N ARG A 173 ? N ARG A 173 # _pdbx_entry_details.entry_id 9XB4 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 60 ? ? -95.04 52.40 2 1 PHE A 67 ? ? -141.02 58.24 3 1 ASN A 249 ? ? -42.21 -73.46 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 48 A MSE 48 ? MET 'modified residue' 2 A MSE 73 A MSE 73 ? MET 'modified residue' 3 A MSE 170 A MSE 170 ? MET 'modified residue' 4 A MSE 174 A MSE 174 ? MET 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A ARG 6 ? A ARG 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A TYR 10 ? A TYR 10 11 1 Y 1 A HIS 11 ? A HIS 11 12 1 Y 1 A LEU 12 ? A LEU 12 13 1 Y 1 A THR 13 ? A THR 13 14 1 Y 1 A GLN 14 ? A GLN 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A ASN 16 ? A ASN 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A LYS 18 ? A LYS 18 19 1 Y 1 A GLY 19 ? A GLY 19 20 1 Y 1 A ARG 20 ? A ARG 20 21 1 Y 1 A GLU 21 ? A GLU 21 22 1 Y 1 A ALA 22 ? A ALA 22 23 1 Y 1 A LYS 23 ? A LYS 23 24 1 Y 1 A GLU 24 ? A GLU 24 25 1 Y 1 A GLY 182 ? A GLY 182 26 1 Y 1 A ASP 183 ? A ASP 183 27 1 Y 1 A GLU 184 ? A GLU 184 28 1 Y 1 A LYS 185 ? A LYS 185 29 1 Y 1 A GLY 186 ? A GLY 186 30 1 Y 1 A GLU 187 ? A GLU 187 31 1 Y 1 A ALA 188 ? A ALA 188 32 1 Y 1 A SER 189 ? A SER 189 33 1 Y 1 A ARG 251 ? A ARG 251 34 1 Y 1 A GLN 252 ? A GLN 252 35 1 Y 1 A ALA 253 ? A ALA 253 36 1 Y 1 A MSE 254 ? A MSE 254 37 1 Y 1 A ASN 255 ? A ASN 255 38 1 Y 1 A GLY 256 ? A GLY 256 39 1 Y 1 A ASP 257 ? A ASP 257 40 1 Y 1 A GLU 258 ? A GLU 258 41 1 Y 1 A MSE 259 ? A MSE 259 42 1 Y 1 A ASP 260 ? A ASP 260 43 1 Y 1 A GLU 261 ? A GLU 261 44 1 Y 1 A ASP 262 ? A ASP 262 45 1 Y 1 A GLN 263 ? A GLN 263 46 1 Y 1 A SER 264 ? A SER 264 47 1 Y 1 A SER 265 ? A SER 265 48 1 Y 1 A ASP 266 ? A ASP 266 49 1 Y 1 A GLU 267 ? A GLU 267 50 1 Y 1 A ASP 268 ? A ASP 268 51 1 Y 1 A SER 269 ? A SER 269 52 1 Y 1 A ASP 270 ? A ASP 270 53 1 Y 1 A GLY 271 ? A GLY 271 54 1 Y 1 A SER 272 ? A SER 272 55 1 Y 1 A HIS 273 ? A HIS 273 56 1 Y 1 A HIS 274 ? A HIS 274 57 1 Y 1 A HIS 275 ? A HIS 275 58 1 Y 1 A HIS 276 ? A HIS 276 59 1 Y 1 A HIS 277 ? A HIS 277 60 1 Y 1 A HIS 278 ? A HIS 278 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 22177036 1 'National Natural Science Foundation of China (NSFC)' China 22377030 2 'National Natural Science Foundation of China (NSFC)' China 22373039 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4NWB _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9XB4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016599 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006747 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015258 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015160 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_ #